>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=248
C1 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C2 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C3 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C4 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C5 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C6 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C7 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C8 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C9 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C10 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C11 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C12 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
**************************************************
C1 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C2 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C3 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C4 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C5 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C6 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C7 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C8 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C9 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C10 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C11 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C12 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
**************************************************
C1 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C2 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C3 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C4 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C5 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C6 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C7 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C8 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C9 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C10 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C11 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C12 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
**************************************************
C1 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C2 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C3 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C4 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C5 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C6 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C7 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C8 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C9 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C10 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C11 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C12 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
**************************************************
C1 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C2 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C3 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C4 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C5 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C6 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C7 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C8 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C9 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C10 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C11 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C12 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
**********************************:*** ********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [32736]--->[32736]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.676 Mb, Max= 31.578 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
FORMAT of file /tmp/tmp3041069845306218777aln Not Supported[FATAL:T-COFFEE]
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:248 S:100 BS:248
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.19 C1 C6 99.19
TOP 5 0 99.19 C6 C1 99.19
BOT 0 6 99.19 C1 C7 99.19
TOP 6 0 99.19 C7 C1 99.19
BOT 0 7 99.19 C1 C8 99.19
TOP 7 0 99.19 C8 C1 99.19
BOT 0 8 99.19 C1 C9 99.19
TOP 8 0 99.19 C9 C1 99.19
BOT 0 9 99.19 C1 C10 99.19
TOP 9 0 99.19 C10 C1 99.19
BOT 0 10 99.19 C1 C11 99.19
TOP 10 0 99.19 C11 C1 99.19
BOT 0 11 98.79 C1 C12 98.79
TOP 11 0 98.79 C12 C1 98.79
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.19 C2 C6 99.19
TOP 5 1 99.19 C6 C2 99.19
BOT 1 6 99.19 C2 C7 99.19
TOP 6 1 99.19 C7 C2 99.19
BOT 1 7 99.19 C2 C8 99.19
TOP 7 1 99.19 C8 C2 99.19
BOT 1 8 99.19 C2 C9 99.19
TOP 8 1 99.19 C9 C2 99.19
BOT 1 9 99.19 C2 C10 99.19
TOP 9 1 99.19 C10 C2 99.19
BOT 1 10 99.19 C2 C11 99.19
TOP 10 1 99.19 C11 C2 99.19
BOT 1 11 98.79 C2 C12 98.79
TOP 11 1 98.79 C12 C2 98.79
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.19 C3 C6 99.19
TOP 5 2 99.19 C6 C3 99.19
BOT 2 6 99.19 C3 C7 99.19
TOP 6 2 99.19 C7 C3 99.19
BOT 2 7 99.19 C3 C8 99.19
TOP 7 2 99.19 C8 C3 99.19
BOT 2 8 99.19 C3 C9 99.19
TOP 8 2 99.19 C9 C3 99.19
BOT 2 9 99.19 C3 C10 99.19
TOP 9 2 99.19 C10 C3 99.19
BOT 2 10 99.19 C3 C11 99.19
TOP 10 2 99.19 C11 C3 99.19
BOT 2 11 98.79 C3 C12 98.79
TOP 11 2 98.79 C12 C3 98.79
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.19 C4 C6 99.19
TOP 5 3 99.19 C6 C4 99.19
BOT 3 6 99.19 C4 C7 99.19
TOP 6 3 99.19 C7 C4 99.19
BOT 3 7 99.19 C4 C8 99.19
TOP 7 3 99.19 C8 C4 99.19
BOT 3 8 99.19 C4 C9 99.19
TOP 8 3 99.19 C9 C4 99.19
BOT 3 9 99.19 C4 C10 99.19
TOP 9 3 99.19 C10 C4 99.19
BOT 3 10 99.19 C4 C11 99.19
TOP 10 3 99.19 C11 C4 99.19
BOT 3 11 98.79 C4 C12 98.79
TOP 11 3 98.79 C12 C4 98.79
BOT 4 5 99.19 C5 C6 99.19
TOP 5 4 99.19 C6 C5 99.19
BOT 4 6 99.19 C5 C7 99.19
TOP 6 4 99.19 C7 C5 99.19
BOT 4 7 99.19 C5 C8 99.19
TOP 7 4 99.19 C8 C5 99.19
BOT 4 8 99.19 C5 C9 99.19
TOP 8 4 99.19 C9 C5 99.19
BOT 4 9 99.19 C5 C10 99.19
TOP 9 4 99.19 C10 C5 99.19
BOT 4 10 99.19 C5 C11 99.19
TOP 10 4 99.19 C11 C5 99.19
BOT 4 11 98.79 C5 C12 98.79
TOP 11 4 98.79 C12 C5 98.79
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 5 11 99.60 C6 C12 99.60
TOP 11 5 99.60 C12 C6 99.60
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 6 11 99.60 C7 C12 99.60
TOP 11 6 99.60 C12 C7 99.60
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 7 11 99.60 C8 C12 99.60
TOP 11 7 99.60 C12 C8 99.60
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 8 11 99.60 C9 C12 99.60
TOP 11 8 99.60 C12 C9 99.60
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
BOT 9 11 99.60 C10 C12 99.60
TOP 11 9 99.60 C12 C10 99.60
BOT 10 11 99.60 C11 C12 99.60
TOP 11 10 99.60 C12 C11 99.60
AVG 0 C1 * 99.45
AVG 1 C2 * 99.45
AVG 2 C3 * 99.45
AVG 3 C4 * 99.45
AVG 4 C5 * 99.45
AVG 5 C6 * 99.60
AVG 6 C7 * 99.60
AVG 7 C8 * 99.60
AVG 8 C9 * 99.60
AVG 9 C10 * 99.60
AVG 10 C11 * 99.60
AVG 11 C12 * 99.23
TOT TOT * 99.51
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C2 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C3 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C4 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C5 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C6 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C7 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C8 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C9 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
C10 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C11 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C12 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
****************************************** *******
C1 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C2 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C3 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C4 GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
C5 GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
C6 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C7 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C8 GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C9 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C10 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C11 GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C12 GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
***.**.***** ******** *****************.**********
C1 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C2 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C3 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C4 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C5 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C6 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C7 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C8 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C9 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
C10 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C11 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C12 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
********************************** **.************
C1 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C2 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C3 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C4 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C5 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C6 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C7 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C8 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C9 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C10 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C11 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C12 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
**************************************************
C1 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C2 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C3 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C4 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C5 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C6 CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C7 CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C8 CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C9 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C10 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C11 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C12 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
*** **************.*******************************
C1 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C2 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C3 AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C4 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C5 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C6 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C7 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C8 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C9 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C10 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C11 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C12 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
************* ************************************
C1 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C2 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C3 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C4 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C5 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C6 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C7 CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C8 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C9 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C10 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C11 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C12 TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
**********.**************************************
C1 CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C2 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C3 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C4 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C5 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C6 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C7 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C8 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C9 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C10 CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
C11 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C12 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
****** ** *********************** ***********.****
C1 AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
C2 AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
C3 AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
C4 AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
C5 AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
C6 AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
C7 AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
C8 AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
C9 AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
C10 AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
C11 AGGTTGCCACCGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
C12 AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
**********.***** *********************************
C1 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C2 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C3 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C4 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C5 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C6 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C7 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C8 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C9 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C10 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C11 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C12 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
**************************************************
C1 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C2 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C3 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C4 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C5 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C6 TCCCATCCGATTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C7 TCCCATCCGTTTGGGTCTGGCCCTCAACTTCTCAGTCTTCTACTATGAGA
C8 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C9 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C10 TCCCATCCGTTTGGGTCTGGCCCTCAACTTCTCAGTCTTCTACTATGAGA
C11 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCTGTCTTCTACTATGAGA
C12 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
*********:************** ********:****************
C1 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C2 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C3 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C4 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C5 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C6 TTTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C7 TCTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C8 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C9 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C10 TTTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C11 TTTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C12 TTTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
* ********.***************************************
C1 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C2 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C3 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C4 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C5 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C6 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C7 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C8 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C9 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C10 GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C11 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C12 GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
** ***********.*********** ***********************
C1 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C2 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C3 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C4 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C5 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C6 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
C7 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C8 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C9 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
C10 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C11 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
C12 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
************************************ ** ******** *
C1 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C2 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C3 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C4 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C5 ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C6 ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
C7 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C8 ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
C9 ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
C10 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C11 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C12 ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
**.* ******** *..*.******:******************
>C1
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C2
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C3
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C4
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C5
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C6
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGATTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>C7
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTCAACTTCTCAGTCTTCTACTATGAGA
TCTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C8
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>C9
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C10
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTCAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C11
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACCGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCTGTCTTCTACTATGAGA
TTTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C12
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCGCCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 12 taxa and 744 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480086267
Setting output file names to "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1852767428
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 7866673551
Seed = 2024918179
Swapseed = 1480086267
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 7 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 34 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2721.660685 -- -24.979900
Chain 2 -- -2736.079169 -- -24.979900
Chain 3 -- -2716.659076 -- -24.979900
Chain 4 -- -2716.386984 -- -24.979900
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2689.038363 -- -24.979900
Chain 2 -- -2688.785519 -- -24.979900
Chain 3 -- -2642.493619 -- -24.979900
Chain 4 -- -2670.318846 -- -24.979900
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2721.661] (-2736.079) (-2716.659) (-2716.387) * [-2689.038] (-2688.786) (-2642.494) (-2670.319)
500 -- (-1370.304) [-1367.398] (-1377.826) (-1376.308) * (-1372.706) (-1428.158) (-1378.588) [-1372.938] -- 0:00:00
1000 -- (-1377.966) (-1359.029) [-1354.194] (-1372.327) * [-1359.218] (-1376.202) (-1363.191) (-1358.560) -- 0:16:39
1500 -- (-1366.390) (-1356.499) [-1350.806] (-1363.566) * [-1358.425] (-1366.924) (-1361.063) (-1366.722) -- 0:11:05
2000 -- (-1359.763) (-1369.942) [-1348.966] (-1366.278) * [-1352.743] (-1369.645) (-1363.740) (-1357.058) -- 0:08:19
2500 -- (-1365.287) [-1354.442] (-1349.385) (-1359.788) * (-1352.151) (-1357.106) [-1356.377] (-1346.249) -- 0:06:39
3000 -- [-1367.520] (-1353.159) (-1355.866) (-1352.962) * (-1353.297) [-1351.402] (-1351.778) (-1359.334) -- 0:05:32
3500 -- (-1360.393) (-1354.409) [-1343.830] (-1363.823) * [-1353.455] (-1348.278) (-1358.787) (-1357.088) -- 0:04:44
4000 -- (-1365.672) (-1355.819) (-1363.350) [-1360.393] * (-1354.511) [-1349.033] (-1360.332) (-1360.735) -- 0:04:09
4500 -- [-1360.656] (-1354.688) (-1366.269) (-1375.276) * [-1348.872] (-1344.787) (-1348.567) (-1360.718) -- 0:03:41
5000 -- (-1353.008) [-1352.997] (-1357.324) (-1359.668) * (-1360.849) [-1355.301] (-1359.143) (-1364.535) -- 0:06:38
Average standard deviation of split frequencies: 0.047140
5500 -- (-1361.907) (-1356.554) (-1342.809) [-1360.167] * (-1353.493) [-1350.465] (-1372.083) (-1366.595) -- 0:06:01
6000 -- (-1352.154) [-1350.411] (-1367.532) (-1367.675) * (-1359.151) (-1361.507) [-1359.993] (-1351.970) -- 0:05:31
6500 -- (-1347.705) (-1366.730) (-1379.341) [-1354.755] * [-1343.788] (-1369.325) (-1371.364) (-1380.238) -- 0:05:05
7000 -- [-1355.234] (-1362.829) (-1371.252) (-1367.791) * [-1347.302] (-1369.230) (-1385.788) (-1384.252) -- 0:04:43
7500 -- [-1351.993] (-1373.319) (-1385.091) (-1360.129) * [-1344.392] (-1367.027) (-1372.768) (-1363.268) -- 0:04:24
8000 -- [-1354.340] (-1379.742) (-1380.431) (-1362.461) * [-1346.470] (-1368.656) (-1367.664) (-1363.299) -- 0:04:08
8500 -- [-1351.193] (-1380.240) (-1386.691) (-1382.378) * [-1347.546] (-1376.296) (-1371.137) (-1381.659) -- 0:03:53
9000 -- [-1352.314] (-1383.852) (-1369.561) (-1377.691) * [-1341.953] (-1395.193) (-1379.318) (-1382.507) -- 0:05:30
9500 -- [-1360.233] (-1377.084) (-1364.121) (-1379.619) * [-1344.214] (-1381.410) (-1378.994) (-1381.037) -- 0:05:12
10000 -- [-1360.642] (-1389.983) (-1374.265) (-1371.873) * [-1357.976] (-1389.062) (-1376.959) (-1386.568) -- 0:04:57
Average standard deviation of split frequencies: 0.075130
10500 -- [-1344.810] (-1379.191) (-1385.088) (-1374.845) * [-1345.054] (-1378.265) (-1367.134) (-1382.556) -- 0:04:42
11000 -- [-1347.478] (-1374.097) (-1381.234) (-1388.557) * (-1344.454) (-1380.494) [-1373.841] (-1382.397) -- 0:04:29
11500 -- [-1344.222] (-1368.033) (-1383.042) (-1364.209) * (-1352.426) (-1381.804) [-1360.759] (-1390.122) -- 0:04:17
12000 -- [-1351.839] (-1388.593) (-1375.783) (-1386.928) * (-1368.646) (-1381.612) [-1360.151] (-1387.621) -- 0:04:07
12500 -- (-1352.178) (-1372.364) (-1360.886) [-1371.869] * [-1362.464] (-1372.585) (-1390.125) (-1365.439) -- 0:05:16
13000 -- (-1353.196) [-1357.906] (-1386.657) (-1374.862) * (-1369.786) (-1361.707) (-1376.939) [-1354.887] -- 0:05:03
13500 -- [-1348.787] (-1368.841) (-1380.106) (-1364.243) * (-1350.155) (-1374.600) (-1376.826) [-1349.935] -- 0:04:52
14000 -- [-1347.362] (-1378.318) (-1360.761) (-1363.504) * (-1355.558) (-1374.135) (-1394.367) [-1352.261] -- 0:04:41
14500 -- [-1346.817] (-1366.935) (-1364.735) (-1381.644) * [-1345.974] (-1394.124) (-1368.474) (-1369.811) -- 0:04:31
15000 -- (-1356.275) [-1350.345] (-1368.142) (-1379.294) * [-1347.360] (-1379.361) (-1374.625) (-1362.578) -- 0:04:22
Average standard deviation of split frequencies: 0.084179
15500 -- (-1354.475) (-1360.123) [-1357.653] (-1383.939) * (-1360.925) (-1379.053) (-1387.213) [-1370.661] -- 0:04:14
16000 -- [-1342.425] (-1365.512) (-1361.118) (-1363.920) * (-1353.035) (-1366.460) (-1367.927) [-1353.470] -- 0:04:06
16500 -- (-1349.625) (-1374.422) (-1360.456) [-1361.552] * (-1358.816) (-1364.533) [-1363.714] (-1364.826) -- 0:04:58
17000 -- [-1338.582] (-1370.536) (-1377.338) (-1362.741) * [-1341.151] (-1381.199) (-1377.222) (-1351.737) -- 0:04:49
17500 -- [-1350.107] (-1369.044) (-1381.284) (-1365.636) * [-1351.969] (-1367.623) (-1386.883) (-1364.388) -- 0:04:40
18000 -- [-1363.058] (-1366.222) (-1373.976) (-1368.034) * (-1359.596) (-1368.316) (-1389.092) [-1351.332] -- 0:04:32
18500 -- [-1336.443] (-1371.895) (-1373.995) (-1374.561) * [-1356.710] (-1383.904) (-1384.340) (-1368.431) -- 0:04:25
19000 -- [-1347.867] (-1362.242) (-1371.401) (-1368.182) * (-1345.292) (-1388.532) (-1375.588) [-1357.175] -- 0:04:18
19500 -- [-1349.318] (-1362.337) (-1380.224) (-1364.033) * [-1339.594] (-1383.066) (-1365.996) (-1371.408) -- 0:04:11
20000 -- [-1345.530] (-1360.525) (-1389.837) (-1381.536) * [-1356.002] (-1377.078) (-1375.032) (-1374.844) -- 0:04:05
Average standard deviation of split frequencies: 0.064282
20500 -- [-1363.017] (-1373.595) (-1385.620) (-1372.301) * (-1361.706) [-1348.077] (-1373.175) (-1367.035) -- 0:04:46
21000 -- (-1375.972) (-1362.967) (-1379.493) [-1365.273] * (-1360.453) [-1359.408] (-1376.745) (-1376.531) -- 0:04:39
21500 -- [-1353.494] (-1367.982) (-1370.715) (-1363.376) * (-1367.918) [-1361.144] (-1361.245) (-1384.455) -- 0:04:33
22000 -- (-1378.622) (-1357.692) (-1379.533) [-1363.369] * (-1375.342) (-1379.018) [-1359.654] (-1364.187) -- 0:04:26
22500 -- (-1385.796) (-1355.252) (-1371.486) [-1370.690] * [-1363.218] (-1380.382) (-1394.758) (-1365.252) -- 0:04:20
23000 -- (-1381.751) [-1354.497] (-1376.417) (-1372.286) * [-1347.623] (-1380.056) (-1370.524) (-1379.783) -- 0:04:14
23500 -- (-1378.858) [-1356.836] (-1372.604) (-1387.889) * [-1344.355] (-1369.338) (-1365.251) (-1370.952) -- 0:04:09
24000 -- (-1388.367) [-1349.034] (-1360.747) (-1380.400) * [-1350.269] (-1380.896) (-1359.632) (-1373.975) -- 0:04:44
24500 -- (-1384.875) (-1362.885) (-1378.603) [-1363.049] * (-1376.720) (-1372.288) [-1363.103] (-1383.848) -- 0:04:38
25000 -- [-1368.309] (-1368.485) (-1384.964) (-1362.275) * (-1378.422) (-1373.102) [-1359.398] (-1368.822) -- 0:04:33
Average standard deviation of split frequencies: 0.051035
25500 -- (-1378.302) [-1355.485] (-1377.930) (-1357.654) * (-1366.932) [-1374.898] (-1359.282) (-1383.077) -- 0:04:27
26000 -- (-1374.563) (-1353.855) (-1382.764) [-1352.103] * [-1370.343] (-1375.465) (-1362.638) (-1368.956) -- 0:04:22
26500 -- (-1382.077) (-1360.505) (-1378.941) [-1349.304] * (-1368.855) (-1382.376) (-1380.055) [-1373.751] -- 0:04:17
27000 -- (-1372.884) [-1355.590] (-1384.572) (-1373.540) * (-1361.845) [-1361.143] (-1372.869) (-1388.604) -- 0:04:48
27500 -- (-1376.618) [-1359.956] (-1373.824) (-1372.766) * [-1345.502] (-1385.807) (-1375.806) (-1373.651) -- 0:04:42
28000 -- (-1369.987) [-1365.293] (-1396.472) (-1364.253) * [-1353.440] (-1383.452) (-1379.461) (-1383.587) -- 0:04:37
28500 -- (-1379.796) (-1369.354) (-1385.127) [-1362.725] * [-1357.005] (-1375.776) (-1375.927) (-1375.756) -- 0:04:32
29000 -- (-1386.696) [-1364.408] (-1383.346) (-1361.378) * [-1362.807] (-1386.713) (-1363.207) (-1367.358) -- 0:04:27
29500 -- (-1355.002) (-1371.507) (-1380.565) [-1361.054] * [-1358.679] (-1377.512) (-1365.293) (-1371.073) -- 0:04:23
30000 -- (-1361.310) (-1386.430) (-1380.694) [-1367.211] * (-1363.246) (-1383.514) (-1382.919) [-1352.221] -- 0:04:18
Average standard deviation of split frequencies: 0.042913
30500 -- [-1338.612] (-1369.305) (-1383.326) (-1352.675) * (-1373.684) (-1391.285) (-1379.294) [-1351.990] -- 0:04:46
31000 -- [-1340.539] (-1374.067) (-1383.759) (-1374.924) * [-1365.596] (-1382.746) (-1378.171) (-1371.287) -- 0:04:41
31500 -- [-1344.810] (-1388.210) (-1386.099) (-1367.374) * (-1369.108) (-1379.192) (-1374.135) [-1351.396] -- 0:04:36
32000 -- [-1353.861] (-1368.387) (-1396.852) (-1365.025) * (-1382.727) (-1392.171) (-1368.213) [-1353.063] -- 0:04:32
32500 -- (-1354.177) [-1364.012] (-1378.386) (-1391.250) * (-1386.827) (-1377.131) (-1376.544) [-1358.557] -- 0:04:27
33000 -- [-1347.788] (-1365.479) (-1385.478) (-1370.026) * (-1372.718) (-1376.792) (-1378.316) [-1350.212] -- 0:04:23
33500 -- [-1384.725] (-1362.758) (-1391.853) (-1366.914) * (-1374.477) (-1382.470) (-1380.683) [-1346.607] -- 0:04:19
34000 -- (-1380.305) (-1365.193) (-1377.412) [-1364.092] * (-1370.095) (-1388.543) (-1373.476) [-1358.944] -- 0:04:44
34500 -- (-1385.546) (-1379.726) (-1383.143) [-1358.863] * [-1361.148] (-1379.716) (-1383.340) (-1357.813) -- 0:04:39
35000 -- (-1392.845) (-1373.910) (-1382.576) [-1357.785] * (-1373.712) (-1379.180) (-1375.174) [-1360.396] -- 0:04:35
Average standard deviation of split frequencies: 0.042130
35500 -- (-1383.447) [-1369.759] (-1386.607) (-1367.682) * (-1380.701) (-1376.859) [-1349.049] (-1361.391) -- 0:04:31
36000 -- (-1381.868) (-1366.018) (-1381.754) [-1365.368] * (-1376.446) (-1377.451) (-1367.236) [-1340.730] -- 0:04:27
36500 -- (-1379.310) [-1371.847] (-1380.379) (-1346.081) * (-1380.964) [-1364.178] (-1368.775) (-1369.773) -- 0:04:23
37000 -- (-1389.231) (-1364.500) (-1378.891) [-1346.311] * (-1388.761) [-1366.422] (-1379.071) (-1369.975) -- 0:04:20
37500 -- (-1378.489) (-1360.004) (-1387.185) [-1357.335] * (-1385.283) (-1394.393) (-1374.158) [-1372.235] -- 0:04:16
38000 -- (-1391.460) (-1366.075) (-1374.122) [-1353.424] * (-1382.130) [-1351.876] (-1382.599) (-1371.009) -- 0:04:38
38500 -- (-1375.272) (-1372.280) (-1382.319) [-1355.109] * (-1377.889) (-1358.717) (-1373.905) [-1371.520] -- 0:04:34
39000 -- (-1385.314) (-1373.825) [-1361.143] (-1364.347) * (-1370.090) [-1355.653] (-1378.028) (-1367.958) -- 0:04:31
39500 -- (-1397.097) (-1381.795) [-1360.668] (-1358.047) * (-1355.298) [-1365.899] (-1383.336) (-1390.962) -- 0:04:27
40000 -- (-1374.839) (-1392.403) (-1376.959) [-1354.338] * [-1337.472] (-1366.784) (-1383.533) (-1377.706) -- 0:04:24
Average standard deviation of split frequencies: 0.045841
40500 -- (-1372.786) (-1387.836) (-1379.229) [-1344.706] * [-1354.545] (-1377.992) (-1374.165) (-1374.046) -- 0:04:20
41000 -- (-1368.345) (-1367.705) (-1373.417) [-1346.286] * [-1342.636] (-1380.119) (-1378.687) (-1380.853) -- 0:04:17
41500 -- [-1359.506] (-1369.200) (-1379.152) (-1355.242) * [-1348.206] (-1386.512) (-1370.677) (-1370.863) -- 0:04:14
42000 -- (-1375.722) (-1370.019) (-1398.743) [-1363.278] * [-1355.831] (-1377.221) (-1373.968) (-1388.979) -- 0:04:33
42500 -- [-1374.237] (-1374.291) (-1378.542) (-1375.780) * [-1354.655] (-1373.145) (-1379.770) (-1383.477) -- 0:04:30
43000 -- (-1380.420) (-1375.466) (-1372.984) [-1368.761] * [-1372.819] (-1377.292) (-1373.913) (-1382.083) -- 0:04:27
43500 -- (-1371.846) [-1359.162] (-1373.227) (-1367.306) * [-1354.805] (-1361.906) (-1370.663) (-1381.045) -- 0:04:23
44000 -- (-1377.838) (-1378.751) (-1384.328) [-1369.105] * [-1354.602] (-1372.539) (-1363.315) (-1382.929) -- 0:04:20
44500 -- (-1386.978) [-1362.166] (-1364.121) (-1381.214) * [-1354.216] (-1380.922) (-1361.939) (-1383.936) -- 0:04:17
45000 -- (-1381.063) (-1365.618) [-1376.580] (-1380.548) * (-1368.784) (-1388.462) [-1352.988] (-1384.992) -- 0:04:14
Average standard deviation of split frequencies: 0.040612
45500 -- (-1377.523) (-1368.469) (-1381.791) [-1365.523] * (-1377.372) [-1368.207] (-1371.625) (-1368.732) -- 0:04:32
46000 -- (-1385.914) (-1371.754) (-1379.479) [-1353.588] * (-1359.854) (-1385.976) [-1359.092] (-1376.013) -- 0:04:29
46500 -- (-1379.020) [-1369.745] (-1364.443) (-1359.862) * (-1365.851) [-1375.693] (-1375.118) (-1384.397) -- 0:04:26
47000 -- (-1387.497) (-1371.634) (-1380.892) [-1344.433] * [-1362.876] (-1378.411) (-1386.027) (-1373.317) -- 0:04:23
47500 -- (-1375.198) (-1376.250) (-1375.099) [-1349.720] * [-1358.297] (-1386.721) (-1368.086) (-1379.156) -- 0:04:20
48000 -- (-1388.023) [-1369.887] (-1364.411) (-1351.776) * [-1364.291] (-1384.763) (-1371.865) (-1370.056) -- 0:04:17
48500 -- (-1392.452) [-1365.839] (-1358.457) (-1363.280) * [-1384.772] (-1391.691) (-1367.452) (-1372.765) -- 0:04:15
49000 -- (-1370.364) (-1379.920) (-1373.395) [-1356.149] * (-1374.088) (-1380.089) [-1363.532] (-1367.665) -- 0:04:12
49500 -- (-1373.229) (-1381.447) (-1359.396) [-1346.863] * (-1381.279) (-1371.291) [-1366.272] (-1365.246) -- 0:04:28
50000 -- (-1378.803) (-1383.356) [-1360.671] (-1353.514) * (-1380.091) (-1374.859) [-1365.538] (-1380.263) -- 0:04:26
Average standard deviation of split frequencies: 0.040452
50500 -- (-1384.707) (-1383.009) [-1365.745] (-1367.408) * (-1381.232) (-1381.302) [-1365.003] (-1379.540) -- 0:04:23
51000 -- (-1392.150) [-1385.770] (-1373.542) (-1381.142) * (-1388.405) (-1382.080) [-1356.099] (-1385.675) -- 0:04:20
51500 -- [-1360.006] (-1370.010) (-1370.069) (-1369.132) * (-1383.210) (-1363.243) [-1369.041] (-1385.014) -- 0:04:17
52000 -- [-1367.153] (-1371.402) (-1364.922) (-1375.504) * (-1387.575) (-1365.828) [-1362.576] (-1384.192) -- 0:04:15
52500 -- (-1381.881) (-1358.384) [-1367.939] (-1376.838) * (-1381.019) (-1363.892) [-1360.292] (-1386.758) -- 0:04:12
53000 -- (-1361.759) (-1372.499) [-1369.713] (-1367.529) * (-1375.163) [-1364.969] (-1362.902) (-1378.168) -- 0:04:10
53500 -- [-1362.665] (-1362.370) (-1376.455) (-1371.368) * (-1371.690) (-1388.273) [-1352.506] (-1356.927) -- 0:04:25
54000 -- (-1364.611) [-1372.863] (-1386.425) (-1361.488) * [-1351.063] (-1389.746) (-1355.742) (-1360.273) -- 0:04:22
54500 -- (-1377.856) [-1366.509] (-1363.339) (-1367.719) * [-1358.400] (-1376.964) (-1370.923) (-1366.316) -- 0:04:20
55000 -- (-1385.866) (-1375.194) (-1357.019) [-1359.718] * [-1363.094] (-1374.957) (-1377.321) (-1375.753) -- 0:04:17
Average standard deviation of split frequencies: 0.039985
55500 -- (-1387.110) (-1388.031) (-1364.158) [-1358.372] * [-1355.153] (-1352.195) (-1370.688) (-1377.249) -- 0:04:15
56000 -- (-1363.517) [-1365.787] (-1374.428) (-1380.491) * (-1375.818) (-1369.661) [-1366.588] (-1380.295) -- 0:04:12
56500 -- (-1357.183) [-1354.558] (-1367.342) (-1375.713) * (-1378.352) (-1361.564) (-1374.741) [-1357.725] -- 0:04:10
57000 -- [-1365.679] (-1354.242) (-1375.335) (-1371.583) * [-1355.791] (-1377.399) (-1372.535) (-1378.759) -- 0:04:24
57500 -- (-1386.945) [-1359.092] (-1368.992) (-1382.813) * [-1360.827] (-1390.503) (-1357.928) (-1381.280) -- 0:04:22
58000 -- (-1382.243) [-1355.121] (-1360.900) (-1379.049) * (-1375.549) (-1372.290) [-1364.748] (-1386.757) -- 0:04:19
58500 -- (-1381.810) (-1360.510) [-1361.788] (-1369.220) * [-1342.705] (-1393.123) (-1377.952) (-1370.814) -- 0:04:17
59000 -- (-1369.387) [-1359.974] (-1380.172) (-1384.369) * (-1351.665) (-1386.427) (-1379.838) [-1378.237] -- 0:04:15
59500 -- (-1383.546) (-1368.360) (-1366.758) [-1356.227] * [-1344.060] (-1391.065) (-1378.203) (-1371.432) -- 0:04:12
60000 -- (-1380.966) [-1348.473] (-1382.788) (-1359.695) * [-1349.375] (-1379.110) (-1376.269) (-1371.042) -- 0:04:10
Average standard deviation of split frequencies: 0.038852
60500 -- (-1394.933) (-1364.144) [-1379.638] (-1349.663) * (-1362.416) (-1374.695) [-1374.048] (-1382.383) -- 0:04:08
61000 -- (-1381.904) (-1372.316) (-1379.930) [-1346.531] * [-1347.748] (-1384.596) (-1364.068) (-1377.975) -- 0:04:21
61500 -- (-1384.510) (-1368.547) (-1364.507) [-1352.647] * [-1359.835] (-1350.055) (-1376.383) (-1377.476) -- 0:04:19
62000 -- (-1377.383) (-1361.443) (-1379.985) [-1341.691] * [-1351.602] (-1351.896) (-1369.631) (-1380.826) -- 0:04:17
62500 -- (-1379.606) (-1381.717) (-1361.567) [-1357.677] * [-1381.605] (-1361.068) (-1386.622) (-1381.122) -- 0:04:15
63000 -- (-1371.879) (-1368.235) (-1361.726) [-1346.405] * (-1382.846) [-1357.359] (-1375.736) (-1391.204) -- 0:04:12
63500 -- (-1380.550) (-1370.031) [-1362.352] (-1356.479) * (-1374.138) [-1361.938] (-1368.190) (-1388.074) -- 0:04:10
64000 -- (-1360.494) (-1381.148) [-1348.099] (-1362.789) * (-1375.315) [-1361.751] (-1376.443) (-1380.695) -- 0:04:08
64500 -- (-1378.659) (-1377.970) [-1365.563] (-1357.306) * (-1377.953) [-1358.652] (-1391.344) (-1372.551) -- 0:04:06
65000 -- (-1382.179) (-1388.088) (-1354.948) [-1355.519] * (-1384.964) (-1359.775) (-1389.171) [-1365.161] -- 0:04:18
Average standard deviation of split frequencies: 0.040060
65500 -- (-1378.912) (-1393.017) (-1358.610) [-1355.217] * (-1388.635) (-1370.421) (-1371.484) [-1358.574] -- 0:04:16
66000 -- (-1367.200) (-1360.591) [-1351.466] (-1368.258) * (-1380.066) (-1360.279) [-1369.316] (-1360.677) -- 0:04:14
66500 -- (-1372.035) [-1364.944] (-1366.932) (-1379.149) * (-1389.647) (-1372.970) (-1376.936) [-1360.651] -- 0:04:12
67000 -- (-1380.307) (-1363.658) (-1373.067) [-1362.034] * (-1380.597) (-1375.884) (-1357.586) [-1353.362] -- 0:04:10
67500 -- [-1358.729] (-1383.344) (-1380.267) (-1383.119) * (-1375.977) [-1350.826] (-1372.845) (-1383.103) -- 0:04:08
68000 -- [-1354.983] (-1375.992) (-1381.198) (-1381.795) * (-1381.443) (-1356.279) [-1369.123] (-1378.593) -- 0:04:06
68500 -- [-1362.715] (-1382.299) (-1398.437) (-1375.120) * (-1384.863) [-1362.363] (-1373.849) (-1375.221) -- 0:04:04
69000 -- [-1351.056] (-1371.064) (-1395.373) (-1379.945) * [-1372.988] (-1365.197) (-1379.129) (-1381.862) -- 0:04:16
69500 -- [-1356.330] (-1348.138) (-1378.478) (-1377.748) * (-1378.481) (-1365.241) [-1372.376] (-1357.394) -- 0:04:14
70000 -- (-1368.492) (-1361.572) (-1378.456) [-1365.282] * (-1386.119) (-1382.668) [-1358.670] (-1382.519) -- 0:04:12
Average standard deviation of split frequencies: 0.037902
70500 -- [-1347.678] (-1366.983) (-1378.265) (-1385.735) * (-1370.753) (-1380.712) (-1381.886) [-1361.274] -- 0:04:10
71000 -- [-1352.656] (-1378.271) (-1368.800) (-1354.201) * (-1385.985) (-1390.457) [-1359.885] (-1348.416) -- 0:04:08
71500 -- [-1348.575] (-1389.078) (-1379.763) (-1373.799) * (-1390.942) (-1375.877) (-1358.724) [-1344.987] -- 0:04:06
72000 -- (-1361.357) (-1387.871) (-1380.899) [-1361.063] * (-1386.722) (-1379.271) (-1375.229) [-1359.386] -- 0:04:04
72500 -- (-1361.323) (-1394.295) (-1375.345) [-1354.726] * (-1379.758) (-1359.520) (-1371.971) [-1348.737] -- 0:04:03
73000 -- (-1366.358) (-1391.914) (-1371.241) [-1339.679] * (-1371.995) [-1359.830] (-1381.433) (-1381.410) -- 0:04:13
73500 -- (-1367.886) (-1387.794) (-1363.065) [-1357.336] * (-1369.955) [-1343.522] (-1370.402) (-1380.458) -- 0:04:12
74000 -- (-1383.646) (-1381.503) (-1348.744) [-1347.925] * (-1373.428) [-1350.541] (-1372.516) (-1374.886) -- 0:04:10
74500 -- (-1382.192) (-1381.116) [-1360.004] (-1342.991) * (-1366.048) (-1358.410) [-1356.520] (-1377.072) -- 0:04:08
75000 -- (-1369.454) (-1385.815) (-1370.131) [-1355.935] * (-1371.355) [-1365.447] (-1350.438) (-1369.375) -- 0:04:06
Average standard deviation of split frequencies: 0.036652
75500 -- [-1342.891] (-1380.201) (-1388.520) (-1363.509) * (-1387.069) (-1385.632) (-1351.146) [-1368.271] -- 0:04:04
76000 -- (-1374.706) (-1384.961) (-1376.954) [-1357.927] * (-1364.877) (-1343.283) [-1346.854] (-1365.782) -- 0:04:03
76500 -- (-1375.647) (-1376.959) (-1375.076) [-1356.350] * (-1375.368) [-1360.664] (-1373.057) (-1370.914) -- 0:04:13
77000 -- [-1358.696] (-1369.923) (-1385.325) (-1362.793) * (-1385.810) (-1365.728) (-1385.465) [-1347.242] -- 0:04:11
77500 -- (-1359.696) (-1374.072) (-1389.724) [-1351.511] * (-1373.083) [-1350.107] (-1384.962) (-1348.947) -- 0:04:09
78000 -- [-1363.345] (-1369.201) (-1387.200) (-1364.116) * (-1372.115) (-1385.025) (-1373.423) [-1346.360] -- 0:04:08
78500 -- [-1367.182] (-1371.731) (-1378.758) (-1372.600) * (-1372.626) (-1371.529) (-1387.977) [-1352.132] -- 0:04:06
79000 -- (-1369.451) (-1371.575) [-1361.473] (-1381.773) * (-1371.341) (-1380.013) (-1381.291) [-1345.439] -- 0:04:04
79500 -- [-1352.507] (-1375.482) (-1388.487) (-1367.253) * (-1389.853) (-1367.544) (-1384.424) [-1355.474] -- 0:04:03
80000 -- (-1365.744) (-1359.943) (-1378.800) [-1366.278] * (-1373.795) (-1359.209) (-1382.950) [-1366.212] -- 0:04:01
Average standard deviation of split frequencies: 0.035341
80500 -- (-1380.136) (-1388.272) (-1360.176) [-1366.932] * (-1379.118) (-1356.062) [-1390.148] (-1375.384) -- 0:04:11
81000 -- (-1363.109) [-1371.275] (-1359.250) (-1387.635) * (-1385.870) [-1361.141] (-1386.678) (-1374.434) -- 0:04:09
81500 -- [-1359.937] (-1369.621) (-1357.786) (-1377.346) * [-1364.384] (-1359.393) (-1388.675) (-1382.137) -- 0:04:07
82000 -- (-1356.932) (-1376.835) [-1360.687] (-1376.274) * (-1379.963) [-1353.909] (-1374.310) (-1377.919) -- 0:04:06
82500 -- [-1355.588] (-1382.250) (-1379.524) (-1378.373) * (-1383.110) (-1352.359) (-1374.715) [-1349.237] -- 0:04:04
83000 -- [-1350.110] (-1386.013) (-1370.518) (-1384.975) * (-1374.850) [-1354.738] (-1365.816) (-1375.369) -- 0:04:03
83500 -- (-1356.189) (-1390.002) [-1369.601] (-1377.556) * (-1379.818) [-1347.046] (-1381.191) (-1365.627) -- 0:04:01
84000 -- [-1350.869] (-1385.408) (-1374.753) (-1383.656) * (-1380.786) (-1368.809) (-1378.140) [-1371.205] -- 0:03:59
84500 -- [-1362.549] (-1378.054) (-1365.614) (-1383.709) * (-1385.591) [-1357.860] (-1376.690) (-1367.038) -- 0:04:09
85000 -- (-1356.376) [-1357.221] (-1384.904) (-1369.315) * (-1380.175) [-1359.425] (-1376.137) (-1353.768) -- 0:04:07
Average standard deviation of split frequencies: 0.032889
85500 -- (-1374.176) (-1370.786) [-1363.897] (-1379.164) * (-1373.086) (-1353.842) (-1376.134) [-1354.041] -- 0:04:06
86000 -- (-1383.606) (-1364.448) [-1356.505] (-1367.042) * (-1379.862) (-1368.362) (-1375.806) [-1349.373] -- 0:04:04
86500 -- (-1374.840) (-1378.402) [-1351.073] (-1373.144) * (-1372.226) (-1377.637) [-1361.540] (-1364.980) -- 0:04:02
87000 -- [-1353.721] (-1376.622) (-1372.954) (-1377.039) * (-1361.401) (-1378.559) [-1345.537] (-1367.242) -- 0:04:01
87500 -- [-1369.079] (-1366.807) (-1384.126) (-1373.296) * (-1366.861) (-1377.185) [-1346.660] (-1376.317) -- 0:03:59
88000 -- [-1368.613] (-1391.606) (-1383.768) (-1377.964) * (-1365.764) (-1378.019) [-1343.842] (-1379.174) -- 0:04:08
88500 -- (-1374.069) (-1373.223) (-1375.339) [-1375.246] * (-1362.781) (-1380.365) [-1350.099] (-1374.331) -- 0:04:07
89000 -- [-1371.368] (-1370.477) (-1374.526) (-1386.522) * [-1356.166] (-1382.471) (-1358.658) (-1368.839) -- 0:04:05
89500 -- (-1380.216) (-1367.125) [-1376.551] (-1387.944) * (-1376.785) (-1383.792) (-1375.897) [-1363.589] -- 0:04:04
90000 -- (-1383.785) [-1371.516] (-1380.167) (-1379.060) * (-1361.994) (-1381.105) [-1361.118] (-1370.693) -- 0:04:02
Average standard deviation of split frequencies: 0.031648
90500 -- (-1379.058) [-1363.592] (-1375.554) (-1386.369) * [-1355.618] (-1377.453) (-1352.729) (-1366.138) -- 0:04:01
91000 -- (-1378.514) (-1359.895) (-1388.622) [-1375.882] * (-1379.227) (-1387.953) [-1354.726] (-1366.642) -- 0:03:59
91500 -- (-1381.962) [-1372.772] (-1379.440) (-1377.305) * (-1382.806) (-1389.266) [-1340.780] (-1378.947) -- 0:03:58
92000 -- (-1377.010) (-1387.148) [-1375.907] (-1380.836) * (-1389.732) [-1366.873] (-1369.911) (-1371.200) -- 0:04:06
92500 -- (-1377.220) (-1384.005) [-1354.462] (-1380.699) * (-1386.447) [-1370.797] (-1378.964) (-1373.224) -- 0:04:05
93000 -- [-1346.929] (-1386.532) (-1381.270) (-1369.533) * (-1391.495) (-1381.712) [-1362.240] (-1381.000) -- 0:04:03
93500 -- (-1362.858) [-1353.271] (-1370.192) (-1367.719) * (-1379.373) (-1375.793) [-1345.718] (-1373.863) -- 0:04:02
94000 -- (-1383.806) [-1351.887] (-1385.490) (-1362.858) * (-1370.703) [-1357.567] (-1354.582) (-1379.262) -- 0:04:00
94500 -- (-1370.713) [-1354.366] (-1388.725) (-1374.171) * (-1377.453) [-1347.889] (-1351.443) (-1387.500) -- 0:03:59
95000 -- (-1368.554) [-1361.677] (-1369.322) (-1376.270) * [-1365.371] (-1359.601) (-1375.388) (-1390.546) -- 0:03:58
Average standard deviation of split frequencies: 0.027677
95500 -- (-1370.350) (-1369.577) (-1377.497) [-1382.373] * (-1384.019) (-1361.258) [-1350.763] (-1391.616) -- 0:03:56
96000 -- (-1367.684) [-1368.929] (-1376.443) (-1392.786) * (-1370.650) [-1366.935] (-1369.707) (-1384.262) -- 0:04:04
96500 -- (-1376.330) [-1348.700] (-1384.612) (-1376.610) * (-1381.850) (-1349.830) [-1375.471] (-1383.853) -- 0:04:03
97000 -- (-1385.394) [-1353.657] (-1383.748) (-1386.828) * (-1388.550) [-1345.997] (-1372.321) (-1389.734) -- 0:04:02
97500 -- (-1375.638) [-1355.867] (-1369.095) (-1388.592) * (-1375.461) [-1351.812] (-1379.923) (-1387.563) -- 0:04:00
98000 -- (-1374.023) [-1348.779] (-1381.848) (-1378.583) * (-1376.064) [-1357.788] (-1378.532) (-1382.920) -- 0:03:59
98500 -- [-1345.039] (-1358.921) (-1376.258) (-1372.746) * (-1383.333) [-1350.515] (-1374.717) (-1385.071) -- 0:03:57
99000 -- [-1355.450] (-1371.149) (-1370.174) (-1370.018) * (-1372.634) (-1354.725) [-1378.862] (-1392.972) -- 0:04:05
99500 -- [-1360.030] (-1366.717) (-1386.098) (-1385.705) * (-1384.947) (-1372.436) [-1367.832] (-1393.231) -- 0:04:04
100000 -- [-1352.421] (-1369.900) (-1372.686) (-1381.823) * (-1364.980) [-1351.379] (-1385.237) (-1384.761) -- 0:04:03
Average standard deviation of split frequencies: 0.028736
100500 -- (-1350.738) (-1375.612) (-1384.241) [-1359.899] * (-1370.556) [-1379.172] (-1383.607) (-1383.261) -- 0:04:01
101000 -- (-1364.020) (-1362.905) (-1365.065) [-1348.822] * [-1364.931] (-1377.231) (-1390.540) (-1379.495) -- 0:04:00
101500 -- (-1367.958) (-1378.727) (-1370.925) [-1352.790] * (-1377.800) (-1372.712) (-1382.249) [-1375.943] -- 0:03:59
102000 -- (-1384.779) (-1376.208) [-1351.798] (-1347.088) * (-1377.209) (-1386.508) (-1374.249) [-1369.629] -- 0:03:57
102500 -- [-1356.303] (-1365.675) (-1371.577) (-1378.882) * [-1372.548] (-1379.244) (-1380.026) (-1375.482) -- 0:04:05
103000 -- [-1342.225] (-1369.780) (-1369.733) (-1376.156) * (-1379.538) (-1374.699) (-1380.237) [-1363.370] -- 0:04:03
103500 -- [-1344.881] (-1359.407) (-1377.676) (-1385.616) * (-1391.645) (-1375.176) (-1375.650) [-1360.400] -- 0:04:02
104000 -- [-1356.445] (-1377.901) (-1380.323) (-1369.230) * (-1382.624) (-1378.684) (-1383.890) [-1366.147] -- 0:04:01
104500 -- [-1351.132] (-1375.874) (-1382.018) (-1376.055) * (-1378.023) (-1385.946) [-1367.646] (-1375.679) -- 0:03:59
105000 -- (-1353.444) (-1372.538) [-1372.916] (-1384.269) * (-1383.298) (-1358.929) [-1350.003] (-1368.720) -- 0:03:58
Average standard deviation of split frequencies: 0.024662
105500 -- [-1350.178] (-1381.105) (-1372.866) (-1387.762) * (-1372.646) (-1370.783) [-1349.312] (-1382.908) -- 0:03:57
106000 -- [-1342.401] (-1378.861) (-1366.818) (-1389.268) * (-1375.485) (-1366.922) [-1348.022] (-1376.530) -- 0:03:56
106500 -- [-1345.657] (-1373.871) (-1377.760) (-1380.320) * (-1383.595) (-1382.675) (-1363.759) [-1371.683] -- 0:04:03
107000 -- [-1354.982] (-1369.623) (-1353.635) (-1381.589) * (-1379.900) (-1377.077) (-1362.332) [-1365.750] -- 0:04:02
107500 -- (-1369.674) (-1375.629) [-1350.140] (-1353.445) * (-1352.384) (-1371.982) (-1377.867) [-1351.188] -- 0:04:00
108000 -- (-1378.050) (-1379.977) (-1358.797) [-1369.664] * (-1354.562) (-1368.012) (-1374.804) [-1357.622] -- 0:03:59
108500 -- [-1357.482] (-1377.671) (-1358.249) (-1378.394) * (-1376.814) (-1365.725) (-1382.768) [-1355.737] -- 0:03:58
109000 -- [-1348.579] (-1375.237) (-1372.205) (-1375.122) * (-1378.266) (-1376.557) [-1364.078] (-1361.784) -- 0:03:57
109500 -- [-1367.595] (-1375.968) (-1384.675) (-1378.290) * (-1388.459) [-1371.879] (-1379.283) (-1368.298) -- 0:03:55
110000 -- [-1360.971] (-1380.805) (-1378.817) (-1383.728) * (-1390.691) [-1366.871] (-1385.039) (-1365.193) -- 0:03:54
Average standard deviation of split frequencies: 0.019473
110500 -- (-1375.182) (-1371.904) (-1372.294) [-1366.861] * (-1380.160) (-1368.163) [-1361.801] (-1366.995) -- 0:04:01
111000 -- (-1376.127) (-1366.194) (-1378.091) [-1349.259] * (-1362.880) (-1365.732) [-1347.277] (-1367.986) -- 0:04:00
111500 -- [-1355.539] (-1379.374) (-1376.400) (-1361.810) * [-1366.023] (-1380.601) (-1375.540) (-1385.699) -- 0:03:59
112000 -- (-1381.204) [-1380.206] (-1375.131) (-1379.883) * (-1375.558) [-1363.651] (-1377.923) (-1400.377) -- 0:03:57
112500 -- (-1366.229) [-1368.848] (-1370.889) (-1370.694) * (-1374.545) (-1381.218) [-1373.005] (-1372.606) -- 0:03:56
113000 -- (-1375.422) (-1379.160) [-1361.448] (-1386.467) * (-1372.738) (-1373.012) (-1369.359) [-1374.173] -- 0:03:55
113500 -- (-1382.920) [-1363.120] (-1362.091) (-1380.591) * [-1372.758] (-1389.558) (-1360.013) (-1383.059) -- 0:03:54
114000 -- (-1381.790) (-1365.972) (-1379.467) [-1355.287] * (-1368.937) (-1390.524) [-1351.106] (-1384.143) -- 0:04:00
114500 -- (-1369.624) [-1371.159] (-1374.658) (-1390.744) * (-1376.238) (-1386.137) [-1360.088] (-1380.965) -- 0:03:59
115000 -- (-1368.064) [-1364.152] (-1365.141) (-1380.812) * (-1376.479) (-1382.960) [-1354.021] (-1376.025) -- 0:03:58
Average standard deviation of split frequencies: 0.017416
115500 -- (-1377.024) [-1360.347] (-1365.583) (-1378.263) * (-1362.427) (-1385.749) [-1369.478] (-1380.064) -- 0:03:57
116000 -- [-1365.483] (-1373.012) (-1358.959) (-1385.443) * (-1366.846) (-1372.307) [-1350.139] (-1375.768) -- 0:03:56
116500 -- [-1356.349] (-1367.039) (-1383.449) (-1385.614) * (-1371.223) (-1373.833) (-1366.862) [-1371.782] -- 0:03:55
117000 -- [-1362.279] (-1382.499) (-1383.108) (-1387.395) * (-1371.345) [-1353.040] (-1383.176) (-1375.747) -- 0:03:53
117500 -- [-1369.370] (-1372.390) (-1376.175) (-1378.652) * (-1383.481) (-1364.932) [-1371.715] (-1381.361) -- 0:03:52
118000 -- [-1371.256] (-1371.062) (-1382.563) (-1381.159) * (-1381.038) [-1357.069] (-1377.088) (-1367.913) -- 0:03:59
118500 -- [-1342.624] (-1378.116) (-1380.125) (-1378.641) * (-1361.021) [-1348.643] (-1377.746) (-1383.286) -- 0:03:58
119000 -- (-1374.892) [-1365.341] (-1370.495) (-1381.049) * (-1369.866) [-1356.037] (-1372.900) (-1377.035) -- 0:03:56
119500 -- [-1363.423] (-1374.600) (-1360.913) (-1373.090) * (-1379.867) (-1363.913) [-1367.584] (-1376.867) -- 0:03:55
120000 -- (-1373.442) [-1367.474] (-1366.540) (-1386.053) * (-1367.680) [-1357.593] (-1380.600) (-1387.052) -- 0:03:54
Average standard deviation of split frequencies: 0.018045
120500 -- (-1386.180) [-1363.475] (-1368.736) (-1385.315) * (-1362.552) (-1375.122) [-1357.853] (-1393.492) -- 0:03:53
121000 -- (-1381.346) [-1372.954] (-1357.420) (-1382.576) * (-1383.092) [-1351.910] (-1360.135) (-1365.785) -- 0:03:52
121500 -- (-1384.396) (-1367.197) [-1364.248] (-1387.832) * (-1384.781) [-1374.454] (-1370.409) (-1365.728) -- 0:03:51
122000 -- (-1381.145) [-1370.424] (-1356.506) (-1398.478) * (-1386.927) [-1364.428] (-1367.091) (-1362.340) -- 0:03:57
122500 -- (-1371.479) [-1365.303] (-1359.877) (-1383.803) * (-1370.259) (-1360.701) (-1389.582) [-1357.076] -- 0:03:56
123000 -- (-1374.571) (-1370.874) [-1344.940] (-1384.549) * (-1360.570) (-1354.303) (-1378.221) [-1356.665] -- 0:03:55
123500 -- (-1372.336) (-1372.248) [-1371.260] (-1381.632) * (-1380.766) [-1357.075] (-1367.115) (-1357.184) -- 0:03:54
124000 -- (-1363.108) (-1369.150) [-1363.019] (-1366.707) * (-1372.484) (-1390.164) [-1364.104] (-1359.376) -- 0:03:53
124500 -- (-1379.910) (-1388.147) (-1372.374) [-1353.730] * (-1379.685) (-1388.230) [-1362.469] (-1373.906) -- 0:03:52
125000 -- (-1378.336) (-1377.095) (-1376.347) [-1359.747] * (-1388.271) [-1348.321] (-1367.338) (-1366.875) -- 0:03:51
Average standard deviation of split frequencies: 0.020666
125500 -- (-1380.473) (-1376.219) (-1385.593) [-1359.730] * (-1394.975) (-1381.205) (-1340.677) [-1345.377] -- 0:03:56
126000 -- (-1385.821) (-1369.783) (-1357.172) [-1345.768] * (-1384.145) (-1376.883) [-1360.274] (-1354.298) -- 0:03:55
126500 -- (-1378.815) (-1381.866) (-1366.297) [-1356.809] * (-1373.058) (-1388.820) [-1369.939] (-1361.567) -- 0:03:54
127000 -- (-1364.280) (-1390.087) [-1358.361] (-1382.201) * [-1367.654] (-1372.731) (-1376.211) (-1360.881) -- 0:03:53
127500 -- (-1391.370) (-1371.735) [-1353.071] (-1376.921) * (-1389.391) (-1372.744) (-1382.372) [-1357.015] -- 0:03:52
128000 -- (-1383.795) (-1369.759) [-1360.510] (-1384.309) * (-1387.765) (-1374.023) (-1383.248) [-1357.274] -- 0:03:51
128500 -- (-1381.668) [-1370.380] (-1363.653) (-1370.132) * (-1385.455) (-1359.328) [-1377.400] (-1380.067) -- 0:03:50
129000 -- [-1367.637] (-1364.206) (-1369.593) (-1394.220) * (-1367.330) [-1357.254] (-1377.530) (-1360.172) -- 0:03:49
129500 -- (-1382.001) [-1364.077] (-1389.482) (-1367.223) * (-1362.661) (-1361.920) (-1366.690) [-1353.452] -- 0:03:55
130000 -- (-1374.185) (-1374.648) [-1360.408] (-1375.436) * (-1362.196) (-1370.022) (-1366.075) [-1348.596] -- 0:03:54
Average standard deviation of split frequencies: 0.017710
130500 -- (-1379.473) [-1366.541] (-1360.747) (-1359.771) * (-1381.331) (-1389.366) (-1360.443) [-1342.934] -- 0:03:53
131000 -- (-1387.376) (-1373.499) [-1361.074] (-1371.916) * (-1375.014) (-1378.538) (-1354.016) [-1368.757] -- 0:03:52
131500 -- (-1392.991) (-1366.235) [-1354.258] (-1364.089) * (-1384.555) (-1381.970) [-1358.564] (-1368.378) -- 0:03:51
132000 -- (-1383.952) (-1369.723) (-1377.875) [-1366.117] * (-1373.730) (-1368.056) [-1358.022] (-1382.855) -- 0:03:50
132500 -- (-1386.701) (-1382.561) (-1368.671) [-1361.751] * (-1380.380) (-1388.420) (-1372.065) [-1353.305] -- 0:03:49
133000 -- (-1377.958) [-1378.068] (-1376.690) (-1369.598) * (-1368.566) (-1378.194) [-1362.335] (-1368.777) -- 0:03:48
133500 -- (-1382.823) [-1349.915] (-1388.415) (-1367.330) * [-1366.216] (-1382.309) (-1368.171) (-1377.991) -- 0:03:53
134000 -- [-1365.488] (-1349.877) (-1380.403) (-1373.671) * (-1377.621) (-1377.239) [-1349.139] (-1369.742) -- 0:03:52
134500 -- (-1386.305) [-1350.913] (-1369.577) (-1381.150) * (-1380.787) (-1391.804) (-1362.977) [-1351.991] -- 0:03:51
135000 -- (-1390.140) (-1381.157) (-1367.937) [-1359.620] * (-1376.312) (-1380.853) [-1367.388] (-1352.428) -- 0:03:50
Average standard deviation of split frequencies: 0.017001
135500 -- (-1380.693) (-1370.709) (-1352.529) [-1359.877] * (-1372.885) (-1396.331) [-1369.019] (-1353.550) -- 0:03:49
136000 -- (-1388.323) (-1385.792) (-1365.379) [-1372.296] * (-1381.198) (-1382.370) [-1362.916] (-1381.312) -- 0:03:48
136500 -- (-1383.760) (-1366.804) [-1357.672] (-1378.704) * (-1382.597) (-1389.486) [-1356.972] (-1380.754) -- 0:03:47
137000 -- (-1374.300) (-1378.362) [-1354.652] (-1354.097) * (-1374.252) (-1368.322) [-1348.945] (-1394.289) -- 0:03:46
137500 -- (-1380.960) [-1362.532] (-1377.609) (-1371.642) * [-1352.956] (-1369.400) (-1353.541) (-1384.481) -- 0:03:52
138000 -- (-1380.914) (-1358.753) [-1357.209] (-1367.083) * (-1365.827) (-1376.832) [-1339.217] (-1379.583) -- 0:03:51
138500 -- (-1379.209) [-1366.476] (-1368.023) (-1385.811) * (-1381.503) (-1376.495) [-1343.075] (-1353.958) -- 0:03:50
139000 -- (-1387.746) [-1374.740] (-1373.632) (-1391.478) * (-1388.367) [-1354.980] (-1360.684) (-1360.137) -- 0:03:49
139500 -- [-1373.811] (-1371.422) (-1363.018) (-1396.066) * (-1367.298) (-1373.942) (-1381.914) [-1348.344] -- 0:03:48
140000 -- (-1383.695) (-1370.428) (-1374.370) [-1364.272] * (-1391.849) (-1379.916) (-1377.719) [-1343.868] -- 0:03:47
Average standard deviation of split frequencies: 0.015639
140500 -- [-1355.002] (-1379.952) (-1381.124) (-1385.316) * (-1376.043) (-1386.820) [-1368.082] (-1369.113) -- 0:03:46
141000 -- (-1352.755) (-1374.011) (-1381.910) [-1363.641] * (-1374.946) [-1375.896] (-1381.152) (-1360.379) -- 0:03:51
141500 -- [-1355.883] (-1376.331) (-1382.051) (-1367.972) * (-1367.296) [-1367.971] (-1376.382) (-1363.083) -- 0:03:50
142000 -- [-1356.077] (-1379.653) (-1383.926) (-1380.981) * (-1363.491) (-1373.694) (-1380.620) [-1367.022] -- 0:03:49
142500 -- [-1343.242] (-1386.538) (-1378.229) (-1365.422) * (-1375.166) (-1376.736) [-1366.169] (-1358.258) -- 0:03:48
143000 -- [-1344.621] (-1358.556) (-1378.797) (-1373.617) * (-1371.125) (-1368.002) (-1366.849) [-1363.851] -- 0:03:47
143500 -- (-1381.290) (-1367.841) [-1361.456] (-1388.189) * [-1377.732] (-1363.942) (-1383.231) (-1367.047) -- 0:03:46
144000 -- [-1353.725] (-1374.362) (-1373.275) (-1372.248) * (-1378.764) [-1361.459] (-1386.089) (-1349.917) -- 0:03:45
144500 -- [-1346.341] (-1369.736) (-1370.518) (-1383.025) * (-1376.159) (-1357.784) (-1378.962) [-1347.359] -- 0:03:44
145000 -- [-1360.316] (-1369.843) (-1380.106) (-1379.546) * (-1375.316) (-1370.828) (-1376.257) [-1353.023] -- 0:03:49
Average standard deviation of split frequencies: 0.014914
145500 -- (-1387.227) (-1362.692) (-1379.879) [-1372.770] * (-1373.503) [-1356.275] (-1378.961) (-1367.390) -- 0:03:49
146000 -- (-1374.227) (-1374.601) [-1356.325] (-1375.350) * (-1364.182) (-1369.195) (-1379.250) [-1361.218] -- 0:03:48
146500 -- (-1374.447) (-1381.662) [-1352.791] (-1380.419) * (-1367.089) (-1375.257) (-1365.223) [-1364.528] -- 0:03:47
147000 -- (-1393.787) (-1373.217) [-1355.573] (-1375.321) * [-1374.854] (-1371.397) (-1384.217) (-1384.112) -- 0:03:46
147500 -- (-1383.734) (-1364.333) [-1354.481] (-1363.213) * (-1378.691) [-1352.735] (-1361.363) (-1377.939) -- 0:03:45
148000 -- (-1379.525) [-1353.631] (-1371.081) (-1360.336) * (-1372.832) [-1366.975] (-1355.757) (-1352.752) -- 0:03:44
148500 -- (-1380.572) [-1364.814] (-1383.041) (-1362.516) * (-1359.225) (-1379.795) [-1355.238] (-1358.951) -- 0:03:43
149000 -- (-1368.385) (-1383.197) (-1383.706) [-1354.916] * (-1362.926) [-1355.993] (-1370.271) (-1367.797) -- 0:03:48
149500 -- (-1386.457) (-1373.930) (-1374.014) [-1357.595] * (-1365.647) (-1384.204) (-1365.942) [-1346.477] -- 0:03:47
150000 -- (-1393.922) (-1366.587) (-1353.577) [-1347.759] * (-1372.875) (-1383.010) (-1374.029) [-1342.469] -- 0:03:46
Average standard deviation of split frequencies: 0.013558
150500 -- (-1391.372) (-1384.787) (-1358.230) [-1367.035] * (-1377.507) [-1370.804] (-1377.051) (-1359.084) -- 0:03:45
151000 -- (-1387.481) (-1381.070) [-1364.009] (-1372.683) * (-1385.275) [-1368.691] (-1379.680) (-1360.356) -- 0:03:44
151500 -- (-1384.812) (-1377.354) [-1364.498] (-1369.997) * (-1386.441) (-1380.614) (-1381.330) [-1347.886] -- 0:03:44
152000 -- (-1392.793) (-1382.352) [-1365.671] (-1373.700) * (-1379.791) [-1354.575] (-1379.776) (-1355.803) -- 0:03:43
152500 -- (-1385.499) (-1387.966) (-1368.051) [-1362.838] * (-1380.233) [-1352.127] (-1374.141) (-1374.318) -- 0:03:47
153000 -- (-1374.980) (-1389.236) (-1370.753) [-1360.411] * (-1377.098) [-1363.037] (-1372.495) (-1376.238) -- 0:03:46
153500 -- (-1381.243) (-1387.266) [-1363.170] (-1359.327) * (-1385.840) [-1356.103] (-1380.046) (-1387.999) -- 0:03:46
154000 -- (-1378.244) (-1390.451) [-1361.450] (-1360.866) * (-1382.474) [-1352.824] (-1385.709) (-1370.065) -- 0:03:45
154500 -- (-1372.663) (-1383.493) (-1365.725) [-1354.646] * (-1371.015) [-1350.915] (-1376.094) (-1370.742) -- 0:03:44
155000 -- (-1362.856) (-1386.156) [-1364.200] (-1385.450) * (-1389.739) [-1358.057] (-1370.590) (-1367.803) -- 0:03:43
Average standard deviation of split frequencies: 0.011936
155500 -- (-1369.199) (-1379.734) (-1376.046) [-1370.636] * (-1380.286) [-1345.317] (-1363.494) (-1379.515) -- 0:03:42
156000 -- (-1378.908) (-1390.154) [-1377.964] (-1367.956) * (-1376.769) [-1356.624] (-1373.286) (-1373.331) -- 0:03:41
156500 -- (-1374.211) (-1384.414) [-1367.626] (-1372.173) * (-1380.468) [-1354.644] (-1373.601) (-1380.612) -- 0:03:46
157000 -- [-1358.167] (-1374.806) (-1376.719) (-1389.154) * (-1373.140) [-1343.273] (-1367.574) (-1381.227) -- 0:03:45
157500 -- [-1368.356] (-1379.554) (-1376.829) (-1375.392) * [-1352.071] (-1352.838) (-1388.742) (-1371.125) -- 0:03:44
158000 -- (-1352.801) (-1378.804) (-1397.357) [-1365.142] * (-1351.537) [-1335.660] (-1380.044) (-1381.796) -- 0:03:43
158500 -- [-1353.438] (-1401.540) (-1373.727) (-1370.820) * (-1379.285) [-1353.753] (-1371.354) (-1373.189) -- 0:03:42
159000 -- [-1345.485] (-1381.571) (-1366.558) (-1381.922) * (-1383.864) [-1361.828] (-1355.515) (-1371.863) -- 0:03:42
159500 -- [-1362.562] (-1378.903) (-1371.454) (-1375.450) * (-1382.609) [-1352.476] (-1354.790) (-1373.551) -- 0:03:41
160000 -- (-1365.410) (-1370.251) [-1367.457] (-1378.884) * (-1388.592) [-1354.814] (-1369.486) (-1370.397) -- 0:03:45
Average standard deviation of split frequencies: 0.011883
160500 -- [-1353.196] (-1378.499) (-1374.436) (-1378.633) * (-1382.927) [-1358.249] (-1374.028) (-1373.845) -- 0:03:44
161000 -- [-1340.313] (-1383.037) (-1367.306) (-1382.110) * (-1353.934) [-1371.255] (-1385.594) (-1382.348) -- 0:03:44
161500 -- [-1358.652] (-1381.793) (-1362.787) (-1379.253) * [-1355.403] (-1370.597) (-1375.765) (-1380.218) -- 0:03:43
162000 -- (-1378.426) (-1371.501) [-1369.452] (-1379.954) * [-1343.877] (-1377.563) (-1378.542) (-1372.059) -- 0:03:42
162500 -- [-1354.687] (-1364.399) (-1384.372) (-1383.297) * (-1377.924) (-1374.356) (-1368.066) [-1366.621] -- 0:03:41
163000 -- [-1355.083] (-1379.286) (-1385.467) (-1371.416) * [-1357.447] (-1357.734) (-1355.779) (-1373.408) -- 0:03:40
163500 -- [-1344.708] (-1374.681) (-1382.028) (-1372.127) * (-1391.927) (-1365.808) [-1349.793] (-1386.559) -- 0:03:39
164000 -- [-1357.560] (-1377.892) (-1389.946) (-1379.237) * [-1360.807] (-1372.528) (-1358.416) (-1384.942) -- 0:03:44
164500 -- (-1362.496) [-1364.563] (-1384.262) (-1383.295) * (-1368.401) (-1383.882) [-1352.866] (-1373.588) -- 0:03:43
165000 -- [-1356.667] (-1353.150) (-1372.155) (-1371.299) * (-1380.732) (-1383.072) [-1364.499] (-1382.147) -- 0:03:42
Average standard deviation of split frequencies: 0.013388
165500 -- (-1362.600) [-1379.261] (-1371.222) (-1375.421) * (-1377.629) (-1376.868) [-1369.015] (-1395.844) -- 0:03:41
166000 -- (-1378.559) [-1353.917] (-1384.420) (-1378.313) * (-1380.192) [-1369.388] (-1372.739) (-1378.866) -- 0:03:41
166500 -- (-1379.178) (-1357.911) [-1351.549] (-1385.195) * (-1356.341) (-1357.076) [-1353.415] (-1392.715) -- 0:03:40
167000 -- [-1366.424] (-1374.304) (-1371.668) (-1375.104) * (-1378.475) (-1367.181) [-1366.576] (-1379.008) -- 0:03:39
167500 -- [-1355.126] (-1369.789) (-1377.480) (-1388.967) * [-1366.281] (-1375.022) (-1362.773) (-1389.850) -- 0:03:38
168000 -- [-1355.394] (-1372.560) (-1368.055) (-1387.858) * [-1340.847] (-1376.330) (-1359.911) (-1389.305) -- 0:03:42
168500 -- [-1365.500] (-1367.706) (-1389.549) (-1376.239) * (-1356.568) (-1372.619) [-1349.632] (-1389.306) -- 0:03:42
169000 -- [-1361.979] (-1356.249) (-1383.881) (-1389.879) * (-1358.911) (-1390.778) [-1348.858] (-1381.977) -- 0:03:41
169500 -- [-1352.989] (-1369.335) (-1374.684) (-1383.418) * (-1372.322) (-1394.564) [-1347.639] (-1375.636) -- 0:03:40
170000 -- [-1347.520] (-1380.786) (-1390.430) (-1380.602) * [-1349.057] (-1379.766) (-1354.157) (-1360.712) -- 0:03:39
Average standard deviation of split frequencies: 0.015317
170500 -- [-1355.029] (-1377.148) (-1390.892) (-1377.504) * (-1366.856) (-1381.672) (-1348.316) [-1348.513] -- 0:03:38
171000 -- [-1359.521] (-1386.859) (-1383.133) (-1366.082) * (-1354.658) (-1400.455) (-1354.139) [-1352.918] -- 0:03:38
171500 -- [-1351.803] (-1384.463) (-1379.417) (-1386.103) * (-1394.328) (-1387.702) (-1360.016) [-1349.824] -- 0:03:42
172000 -- [-1350.253] (-1360.352) (-1372.212) (-1368.060) * (-1373.452) (-1385.759) [-1364.411] (-1345.009) -- 0:03:41
172500 -- [-1370.377] (-1383.187) (-1372.740) (-1373.912) * [-1346.519] (-1376.830) (-1381.670) (-1346.926) -- 0:03:40
173000 -- [-1353.414] (-1366.339) (-1379.262) (-1384.739) * [-1350.365] (-1385.839) (-1379.310) (-1363.814) -- 0:03:39
173500 -- [-1362.505] (-1372.631) (-1383.753) (-1375.945) * [-1346.193] (-1372.816) (-1382.607) (-1360.362) -- 0:03:39
174000 -- (-1384.602) (-1383.937) (-1383.298) [-1382.644] * [-1340.688] (-1372.593) (-1380.970) (-1356.382) -- 0:03:38
174500 -- (-1392.524) (-1381.223) [-1371.225] (-1384.590) * [-1354.150] (-1381.097) (-1373.218) (-1361.964) -- 0:03:37
175000 -- (-1371.237) (-1380.803) (-1372.609) [-1345.565] * [-1372.256] (-1375.254) (-1369.215) (-1382.393) -- 0:03:36
Average standard deviation of split frequencies: 0.014123
175500 -- (-1371.398) (-1381.944) [-1365.684] (-1375.694) * (-1376.018) [-1362.617] (-1355.421) (-1371.790) -- 0:03:40
176000 -- (-1387.852) (-1388.884) (-1379.587) [-1351.167] * (-1389.971) (-1358.552) [-1371.967] (-1383.296) -- 0:03:40
176500 -- (-1365.779) (-1384.012) (-1379.227) [-1364.051] * (-1378.422) (-1368.374) (-1372.432) [-1367.545] -- 0:03:39
177000 -- (-1382.410) (-1388.315) [-1367.252] (-1382.943) * (-1368.127) [-1356.252] (-1356.038) (-1380.883) -- 0:03:38
177500 -- [-1356.313] (-1380.003) (-1376.816) (-1376.229) * (-1363.284) (-1365.598) [-1361.323] (-1379.213) -- 0:03:37
178000 -- [-1350.911] (-1388.175) (-1375.566) (-1361.866) * (-1379.679) (-1376.644) [-1349.170] (-1386.264) -- 0:03:37
178500 -- [-1342.774] (-1393.846) (-1364.570) (-1377.621) * (-1355.881) (-1384.227) [-1352.533] (-1379.362) -- 0:03:36
179000 -- [-1356.125] (-1395.344) (-1357.873) (-1387.333) * (-1349.883) (-1386.438) [-1352.594] (-1375.598) -- 0:03:35
179500 -- (-1364.481) (-1385.649) [-1369.224] (-1383.732) * [-1343.095] (-1373.583) (-1365.353) (-1373.050) -- 0:03:39
180000 -- (-1363.069) (-1386.196) [-1360.244] (-1386.931) * (-1349.704) [-1360.778] (-1384.848) (-1388.711) -- 0:03:38
Average standard deviation of split frequencies: 0.013521
180500 -- [-1358.105] (-1381.317) (-1352.405) (-1385.222) * [-1344.918] (-1361.665) (-1387.418) (-1372.489) -- 0:03:37
181000 -- [-1350.848] (-1381.275) (-1370.626) (-1380.518) * [-1348.361] (-1381.423) (-1377.492) (-1373.395) -- 0:03:37
181500 -- [-1359.378] (-1378.935) (-1367.851) (-1387.524) * [-1355.903] (-1379.399) (-1382.757) (-1383.317) -- 0:03:36
182000 -- [-1344.366] (-1382.554) (-1360.163) (-1377.405) * [-1357.281] (-1374.375) (-1379.617) (-1370.999) -- 0:03:35
182500 -- [-1350.419] (-1377.472) (-1357.805) (-1380.182) * (-1370.659) (-1382.137) (-1381.079) [-1355.239] -- 0:03:35
183000 -- [-1347.482] (-1368.852) (-1362.108) (-1371.968) * [-1346.720] (-1354.752) (-1372.220) (-1383.441) -- 0:03:38
183500 -- (-1369.964) (-1388.821) [-1347.704] (-1377.986) * [-1352.798] (-1358.259) (-1382.862) (-1396.093) -- 0:03:38
184000 -- (-1364.256) (-1379.172) [-1356.450] (-1381.681) * (-1360.299) [-1369.823] (-1381.596) (-1371.658) -- 0:03:37
184500 -- (-1356.510) (-1381.104) [-1346.324] (-1378.130) * [-1350.161] (-1374.462) (-1377.352) (-1374.502) -- 0:03:36
185000 -- (-1377.972) (-1387.233) [-1366.536] (-1377.110) * (-1377.380) (-1395.014) [-1374.382] (-1383.948) -- 0:03:35
Average standard deviation of split frequencies: 0.014861
185500 -- [-1344.090] (-1384.893) (-1370.240) (-1367.806) * (-1387.396) (-1380.119) [-1368.304] (-1379.075) -- 0:03:35
186000 -- (-1353.485) (-1378.311) [-1375.205] (-1382.879) * (-1366.901) [-1363.495] (-1374.377) (-1390.406) -- 0:03:34
186500 -- [-1358.215] (-1386.764) (-1380.230) (-1362.731) * (-1372.298) (-1374.508) [-1359.333] (-1366.606) -- 0:03:33
187000 -- (-1371.921) (-1377.252) (-1382.241) [-1352.277] * (-1374.940) (-1384.554) (-1351.377) [-1354.783] -- 0:03:37
187500 -- [-1354.676] (-1377.070) (-1383.673) (-1371.746) * (-1383.785) (-1386.491) [-1349.853] (-1381.111) -- 0:03:36
188000 -- (-1382.203) (-1371.601) (-1376.742) [-1353.164] * (-1379.891) (-1385.313) [-1365.828] (-1376.727) -- 0:03:35
188500 -- (-1382.963) (-1387.810) (-1371.397) [-1346.260] * (-1393.085) (-1383.763) (-1375.282) [-1360.924] -- 0:03:35
189000 -- (-1383.964) (-1369.098) (-1383.390) [-1357.863] * (-1387.662) (-1391.502) [-1369.908] (-1374.656) -- 0:03:34
189500 -- (-1377.829) (-1380.202) (-1386.163) [-1353.901] * (-1390.220) (-1378.331) (-1360.559) [-1367.088] -- 0:03:33
190000 -- [-1370.987] (-1379.016) (-1383.833) (-1362.614) * (-1387.124) (-1374.164) (-1353.243) [-1373.293] -- 0:03:33
Average standard deviation of split frequencies: 0.013539
190500 -- (-1369.136) (-1358.742) (-1380.082) [-1340.930] * (-1384.482) (-1384.178) [-1359.535] (-1371.886) -- 0:03:32
191000 -- (-1364.647) [-1353.181] (-1384.393) (-1358.242) * (-1380.040) (-1367.579) [-1346.586] (-1387.962) -- 0:03:36
191500 -- (-1370.519) (-1368.067) (-1369.457) [-1355.835] * (-1394.691) (-1384.095) [-1358.374] (-1380.877) -- 0:03:35
192000 -- (-1380.408) (-1357.536) (-1373.693) [-1357.640] * (-1378.789) [-1358.648] (-1384.209) (-1376.366) -- 0:03:34
192500 -- (-1386.561) [-1350.992] (-1379.307) (-1364.843) * (-1390.635) (-1361.398) [-1366.621] (-1381.224) -- 0:03:33
193000 -- (-1379.680) [-1353.520] (-1387.659) (-1387.979) * [-1361.269] (-1350.116) (-1344.829) (-1388.373) -- 0:03:33
193500 -- [-1363.554] (-1361.303) (-1377.210) (-1368.169) * (-1375.553) [-1354.279] (-1364.711) (-1381.562) -- 0:03:32
194000 -- [-1361.924] (-1364.228) (-1373.588) (-1381.793) * (-1376.484) [-1345.650] (-1372.936) (-1390.601) -- 0:03:31
194500 -- (-1361.771) [-1356.667] (-1356.014) (-1377.787) * (-1372.478) (-1366.392) [-1370.464] (-1381.354) -- 0:03:35
195000 -- (-1379.050) [-1361.991] (-1377.703) (-1368.971) * [-1363.554] (-1376.364) (-1375.924) (-1394.455) -- 0:03:34
Average standard deviation of split frequencies: 0.012942
195500 -- (-1371.792) [-1343.975] (-1383.747) (-1386.629) * (-1360.931) (-1382.497) [-1369.986] (-1379.641) -- 0:03:33
196000 -- (-1382.757) [-1344.309] (-1370.554) (-1378.135) * (-1385.684) (-1376.797) [-1355.419] (-1368.344) -- 0:03:33
196500 -- (-1380.586) (-1369.285) (-1377.530) [-1367.815] * (-1382.093) (-1376.149) (-1372.759) [-1361.484] -- 0:03:32
197000 -- [-1373.878] (-1370.255) (-1380.829) (-1367.664) * (-1386.429) (-1366.711) [-1374.075] (-1383.097) -- 0:03:31
197500 -- [-1363.306] (-1371.009) (-1387.720) (-1363.466) * (-1388.555) (-1356.026) (-1366.310) [-1354.654] -- 0:03:31
198000 -- [-1354.172] (-1370.585) (-1369.711) (-1377.764) * (-1384.576) (-1371.816) (-1371.111) [-1355.520] -- 0:03:30
198500 -- (-1359.132) (-1389.682) (-1372.136) [-1366.505] * (-1373.138) (-1384.504) (-1382.702) [-1347.826] -- 0:03:34
199000 -- (-1363.200) (-1381.182) (-1389.809) [-1368.223] * (-1383.808) (-1389.835) (-1364.178) [-1342.168] -- 0:03:33
199500 -- [-1370.450] (-1378.192) (-1399.225) (-1373.390) * (-1383.156) (-1379.935) (-1366.858) [-1341.982] -- 0:03:32
200000 -- [-1375.570] (-1376.576) (-1365.698) (-1368.613) * (-1395.982) (-1376.716) (-1363.586) [-1357.019] -- 0:03:32
Average standard deviation of split frequencies: 0.013088
200500 -- (-1373.462) (-1382.285) (-1354.390) [-1362.432] * (-1377.436) (-1379.663) (-1368.219) [-1360.209] -- 0:03:31
201000 -- (-1370.035) (-1372.844) [-1354.512] (-1370.739) * (-1383.426) (-1371.859) (-1384.752) [-1347.444] -- 0:03:30
201500 -- (-1383.312) (-1379.662) [-1352.600] (-1380.328) * (-1385.486) (-1382.820) (-1363.876) [-1348.054] -- 0:03:30
202000 -- (-1381.730) (-1377.744) [-1367.552] (-1371.829) * [-1364.350] (-1364.362) (-1376.442) (-1368.703) -- 0:03:33
202500 -- (-1394.028) (-1385.614) [-1358.685] (-1370.748) * (-1372.138) (-1342.388) [-1346.635] (-1377.786) -- 0:03:32
203000 -- (-1380.085) (-1373.308) (-1360.852) [-1362.705] * (-1384.035) [-1352.883] (-1361.082) (-1371.798) -- 0:03:32
203500 -- (-1366.725) (-1369.558) [-1362.042] (-1371.109) * (-1368.231) [-1355.281] (-1369.168) (-1389.792) -- 0:03:31
204000 -- (-1378.376) (-1363.840) [-1351.112] (-1374.825) * (-1381.646) (-1366.295) [-1356.639] (-1377.033) -- 0:03:30
204500 -- (-1395.814) [-1359.638] (-1348.440) (-1371.737) * (-1370.073) [-1355.550] (-1359.943) (-1375.233) -- 0:03:30
205000 -- (-1381.328) (-1358.295) [-1347.540] (-1388.085) * (-1374.601) [-1363.105] (-1375.238) (-1383.066) -- 0:03:29
Average standard deviation of split frequencies: 0.013730
205500 -- (-1380.978) (-1386.960) (-1348.197) [-1375.215] * (-1372.299) [-1346.443] (-1366.080) (-1376.472) -- 0:03:28
206000 -- (-1386.315) (-1376.268) [-1374.838] (-1379.611) * (-1379.185) [-1345.100] (-1381.138) (-1378.090) -- 0:03:31
206500 -- (-1390.856) (-1374.274) [-1352.902] (-1363.685) * (-1372.402) [-1344.886] (-1377.704) (-1386.485) -- 0:03:31
207000 -- (-1371.809) (-1390.431) (-1369.284) [-1360.153] * (-1372.745) [-1347.486] (-1381.714) (-1379.381) -- 0:03:30
207500 -- [-1367.594] (-1379.759) (-1376.233) (-1356.708) * (-1371.248) [-1371.081] (-1381.681) (-1383.475) -- 0:03:30
208000 -- (-1380.808) (-1373.488) [-1379.291] (-1356.118) * (-1374.844) [-1371.693] (-1378.572) (-1383.695) -- 0:03:29
208500 -- (-1376.098) (-1366.419) (-1381.998) [-1354.590] * [-1350.057] (-1374.218) (-1373.907) (-1390.008) -- 0:03:28
209000 -- (-1372.392) (-1380.651) (-1392.131) [-1352.734] * [-1349.469] (-1372.061) (-1387.651) (-1394.915) -- 0:03:28
209500 -- (-1368.963) [-1369.420] (-1375.342) (-1356.069) * [-1367.329] (-1385.683) (-1378.848) (-1385.739) -- 0:03:27
210000 -- (-1377.938) (-1373.876) (-1383.442) [-1349.452] * (-1356.606) [-1355.345] (-1373.179) (-1370.897) -- 0:03:30
Average standard deviation of split frequencies: 0.015238
210500 -- (-1387.741) (-1370.822) (-1379.690) [-1341.114] * (-1372.081) [-1360.782] (-1378.423) (-1357.101) -- 0:03:30
211000 -- (-1380.685) (-1377.638) (-1372.788) [-1356.688] * (-1368.463) [-1371.323] (-1385.713) (-1371.346) -- 0:03:29
211500 -- (-1372.907) (-1382.749) [-1374.974] (-1351.443) * (-1379.909) (-1379.774) (-1373.798) [-1360.023] -- 0:03:28
212000 -- (-1378.418) (-1383.283) [-1364.051] (-1361.521) * [-1347.825] (-1373.656) (-1367.073) (-1367.649) -- 0:03:28
212500 -- (-1374.734) (-1358.904) (-1383.252) [-1347.470] * [-1356.904] (-1380.105) (-1383.062) (-1372.026) -- 0:03:27
213000 -- (-1381.219) (-1368.356) (-1380.523) [-1344.162] * [-1349.710] (-1376.953) (-1376.020) (-1364.075) -- 0:03:26
213500 -- (-1381.082) (-1361.634) (-1381.607) [-1355.550] * (-1348.401) [-1358.321] (-1375.745) (-1382.865) -- 0:03:26
214000 -- (-1380.536) (-1367.488) [-1364.909] (-1363.424) * [-1353.912] (-1368.878) (-1376.804) (-1376.771) -- 0:03:29
214500 -- (-1378.849) (-1374.134) (-1352.331) [-1367.617] * [-1347.541] (-1383.057) (-1380.043) (-1376.279) -- 0:03:28
215000 -- (-1395.022) [-1355.069] (-1367.688) (-1350.040) * [-1358.088] (-1381.340) (-1367.559) (-1374.082) -- 0:03:28
Average standard deviation of split frequencies: 0.013822
215500 -- (-1375.948) (-1361.746) (-1366.915) [-1356.915] * [-1369.839] (-1380.801) (-1386.026) (-1369.202) -- 0:03:27
216000 -- (-1378.234) (-1367.780) (-1361.870) [-1364.083] * [-1368.016] (-1370.954) (-1383.848) (-1370.084) -- 0:03:26
216500 -- (-1383.249) [-1349.070] (-1350.220) (-1379.161) * (-1377.999) (-1384.090) [-1370.164] (-1382.623) -- 0:03:26
217000 -- (-1377.800) (-1352.427) [-1337.785] (-1375.457) * (-1365.924) [-1371.374] (-1381.249) (-1379.383) -- 0:03:25
217500 -- (-1380.975) (-1370.786) [-1347.465] (-1374.723) * (-1366.049) (-1370.394) [-1362.352] (-1379.863) -- 0:03:28
218000 -- (-1389.024) (-1377.348) [-1356.580] (-1361.057) * (-1356.650) (-1371.096) [-1363.585] (-1397.762) -- 0:03:28
218500 -- (-1382.948) (-1382.076) [-1343.769] (-1355.086) * (-1348.321) (-1375.815) [-1340.293] (-1379.149) -- 0:03:27
219000 -- (-1375.736) (-1382.131) (-1360.725) [-1371.595] * (-1356.373) (-1360.039) [-1355.018] (-1381.751) -- 0:03:26
219500 -- (-1389.623) (-1376.211) [-1355.038] (-1358.345) * (-1374.361) (-1377.700) [-1367.705] (-1382.094) -- 0:03:26
220000 -- (-1370.359) (-1368.324) [-1349.614] (-1371.446) * [-1357.426] (-1364.044) (-1380.256) (-1373.114) -- 0:03:25
Average standard deviation of split frequencies: 0.013835
220500 -- (-1362.919) (-1375.735) (-1360.469) [-1353.781] * (-1378.083) (-1373.927) (-1376.693) [-1352.638] -- 0:03:25
221000 -- (-1374.447) (-1377.977) (-1374.790) [-1354.151] * (-1377.874) [-1364.603] (-1374.689) (-1369.590) -- 0:03:24
221500 -- (-1379.123) (-1357.897) (-1367.898) [-1340.135] * (-1362.776) [-1356.952] (-1376.531) (-1362.242) -- 0:03:27
222000 -- (-1382.219) [-1360.644] (-1376.276) (-1353.303) * (-1372.959) (-1362.733) (-1381.653) [-1366.676] -- 0:03:26
222500 -- (-1384.693) [-1363.394] (-1378.218) (-1357.372) * (-1369.735) [-1358.880] (-1382.384) (-1379.146) -- 0:03:26
223000 -- (-1381.586) [-1372.430] (-1369.953) (-1349.237) * (-1363.372) (-1355.615) [-1347.869] (-1391.778) -- 0:03:25
223500 -- (-1371.420) (-1379.831) [-1374.035] (-1354.231) * [-1357.371] (-1366.563) (-1362.141) (-1386.562) -- 0:03:24
224000 -- (-1378.186) (-1373.612) (-1369.975) [-1350.073] * [-1368.636] (-1376.086) (-1368.324) (-1381.011) -- 0:03:24
224500 -- (-1383.335) (-1366.501) (-1377.567) [-1348.393] * [-1360.033] (-1374.226) (-1363.972) (-1371.410) -- 0:03:23
225000 -- (-1384.168) (-1373.303) (-1376.739) [-1362.433] * [-1365.621] (-1378.178) (-1358.674) (-1370.704) -- 0:03:23
Average standard deviation of split frequencies: 0.013111
225500 -- (-1376.875) (-1387.460) (-1374.243) [-1348.962] * (-1374.059) [-1352.770] (-1357.170) (-1359.844) -- 0:03:26
226000 -- (-1389.689) (-1384.081) (-1374.869) [-1364.365] * (-1386.713) [-1366.917] (-1358.938) (-1365.739) -- 0:03:25
226500 -- (-1372.429) (-1392.948) (-1375.069) [-1358.978] * (-1391.687) (-1380.146) (-1366.196) [-1361.939] -- 0:03:24
227000 -- (-1375.033) [-1371.749] (-1365.795) (-1375.888) * (-1375.538) (-1356.878) (-1360.412) [-1359.574] -- 0:03:24
227500 -- (-1376.806) [-1365.175] (-1383.474) (-1372.217) * (-1372.524) (-1373.217) [-1367.376] (-1364.531) -- 0:03:23
228000 -- (-1374.119) (-1372.731) (-1373.615) [-1353.046] * (-1362.450) (-1370.173) [-1368.741] (-1375.580) -- 0:03:23
228500 -- (-1364.354) (-1385.553) (-1377.035) [-1352.451] * (-1372.914) [-1372.067] (-1384.223) (-1359.785) -- 0:03:22
229000 -- (-1386.164) (-1369.790) (-1381.296) [-1366.504] * (-1374.285) [-1351.111] (-1370.297) (-1366.055) -- 0:03:25
229500 -- (-1374.292) (-1379.238) (-1387.528) [-1363.967] * (-1366.866) [-1363.019] (-1369.783) (-1383.607) -- 0:03:24
230000 -- (-1377.937) [-1373.689] (-1384.330) (-1376.352) * (-1362.079) [-1349.218] (-1369.423) (-1380.140) -- 0:03:24
Average standard deviation of split frequencies: 0.011445
230500 -- (-1384.395) [-1359.049] (-1384.223) (-1370.651) * [-1385.725] (-1356.786) (-1374.028) (-1379.706) -- 0:03:23
231000 -- (-1382.493) (-1361.661) (-1384.850) [-1363.398] * (-1380.953) [-1363.561] (-1376.511) (-1360.055) -- 0:03:23
231500 -- (-1384.269) [-1348.828] (-1374.518) (-1372.767) * (-1373.403) [-1370.584] (-1362.489) (-1386.225) -- 0:03:22
232000 -- (-1389.182) [-1361.017] (-1371.895) (-1383.575) * (-1375.185) [-1354.491] (-1373.525) (-1377.933) -- 0:03:21
232500 -- (-1377.335) [-1360.264] (-1375.426) (-1368.810) * (-1363.461) (-1385.313) (-1384.907) [-1372.766] -- 0:03:21
233000 -- (-1379.506) [-1345.647] (-1383.964) (-1363.549) * (-1378.621) [-1349.330] (-1374.525) (-1381.962) -- 0:03:24
233500 -- (-1379.216) (-1373.799) (-1371.418) [-1360.628] * (-1365.258) [-1350.384] (-1376.228) (-1382.363) -- 0:03:23
234000 -- (-1371.395) (-1376.280) (-1349.200) [-1348.404] * (-1377.185) [-1357.997] (-1378.419) (-1375.455) -- 0:03:22
234500 -- (-1364.745) (-1385.439) (-1388.778) [-1357.836] * (-1387.021) (-1368.533) (-1369.306) [-1358.412] -- 0:03:22
235000 -- (-1363.483) (-1385.875) [-1365.397] (-1371.624) * (-1365.695) [-1367.260] (-1371.225) (-1363.744) -- 0:03:21
Average standard deviation of split frequencies: 0.012270
235500 -- (-1377.334) (-1371.029) (-1374.819) [-1358.772] * (-1372.182) [-1356.028] (-1379.143) (-1376.010) -- 0:03:21
236000 -- (-1376.814) (-1384.217) (-1372.379) [-1357.351] * [-1367.581] (-1381.738) (-1378.061) (-1377.621) -- 0:03:20
236500 -- (-1368.663) (-1384.645) (-1383.086) [-1354.086] * (-1362.210) (-1372.033) (-1386.427) [-1365.577] -- 0:03:20
237000 -- (-1370.505) (-1389.786) (-1377.356) [-1351.069] * [-1360.057] (-1388.151) (-1352.335) (-1383.111) -- 0:03:22
237500 -- (-1368.033) (-1386.923) (-1372.040) [-1350.953] * (-1363.021) (-1383.233) [-1353.068] (-1385.365) -- 0:03:22
238000 -- (-1379.125) (-1375.394) (-1383.769) [-1363.396] * (-1364.515) (-1382.525) [-1361.984] (-1385.199) -- 0:03:21
238500 -- [-1354.244] (-1371.269) (-1380.725) (-1371.753) * [-1359.476] (-1381.107) (-1364.751) (-1379.841) -- 0:03:21
239000 -- (-1360.175) [-1363.558] (-1357.260) (-1374.696) * (-1362.395) (-1373.114) (-1380.098) [-1364.678] -- 0:03:20
239500 -- [-1361.120] (-1356.048) (-1376.211) (-1374.671) * [-1342.740] (-1370.100) (-1374.004) (-1380.607) -- 0:03:20
240000 -- (-1379.273) (-1371.974) [-1367.297] (-1381.025) * [-1356.617] (-1381.039) (-1367.938) (-1375.113) -- 0:03:19
Average standard deviation of split frequencies: 0.012312
240500 -- (-1391.882) [-1359.204] (-1366.760) (-1374.475) * [-1350.578] (-1372.289) (-1386.741) (-1365.520) -- 0:03:22
241000 -- (-1361.368) (-1350.231) [-1362.266] (-1383.609) * [-1354.125] (-1379.636) (-1363.982) (-1370.171) -- 0:03:21
241500 -- (-1382.902) [-1351.137] (-1357.688) (-1364.575) * (-1356.687) [-1361.023] (-1382.039) (-1360.900) -- 0:03:21
242000 -- (-1379.953) [-1360.523] (-1368.926) (-1379.503) * (-1360.636) [-1365.573] (-1381.190) (-1350.445) -- 0:03:20
242500 -- (-1373.154) (-1361.408) [-1360.568] (-1380.715) * (-1379.977) (-1357.821) (-1370.141) [-1341.456] -- 0:03:19
243000 -- (-1376.645) [-1341.846] (-1370.675) (-1375.500) * (-1380.559) (-1379.316) (-1359.617) [-1348.474] -- 0:03:19
243500 -- (-1380.134) [-1367.199] (-1379.753) (-1374.968) * (-1397.637) (-1372.511) [-1346.045] (-1367.307) -- 0:03:18
244000 -- (-1379.373) (-1359.218) [-1354.335] (-1366.145) * (-1378.862) (-1361.055) (-1374.435) [-1373.513] -- 0:03:18
244500 -- (-1381.275) (-1378.984) (-1371.647) [-1354.716] * (-1388.960) (-1381.526) [-1373.935] (-1375.879) -- 0:03:20
245000 -- (-1361.283) (-1375.868) (-1359.244) [-1365.965] * (-1386.422) (-1353.350) [-1364.552] (-1376.423) -- 0:03:20
Average standard deviation of split frequencies: 0.012228
245500 -- (-1359.503) [-1357.595] (-1375.773) (-1377.053) * (-1387.193) [-1350.083] (-1383.851) (-1372.164) -- 0:03:19
246000 -- (-1379.235) [-1360.625] (-1367.705) (-1366.909) * (-1389.162) [-1350.517] (-1365.698) (-1361.192) -- 0:03:19
246500 -- (-1376.874) (-1365.464) (-1369.739) [-1350.933] * (-1384.016) [-1345.129] (-1356.159) (-1384.688) -- 0:03:18
247000 -- (-1387.147) (-1370.998) (-1377.666) [-1353.892] * (-1394.680) (-1350.306) [-1342.571] (-1398.726) -- 0:03:18
247500 -- (-1380.330) (-1366.664) (-1377.754) [-1352.575] * (-1383.041) (-1371.119) [-1361.119] (-1374.682) -- 0:03:17
248000 -- (-1377.386) (-1388.291) (-1380.944) [-1372.116] * (-1383.491) (-1385.555) [-1363.227] (-1368.682) -- 0:03:17
248500 -- [-1358.915] (-1371.986) (-1384.836) (-1363.715) * (-1379.530) [-1358.924] (-1381.747) (-1379.607) -- 0:03:19
249000 -- [-1351.169] (-1379.217) (-1382.064) (-1373.081) * (-1384.014) (-1372.010) [-1380.927] (-1371.168) -- 0:03:19
249500 -- [-1344.776] (-1366.638) (-1376.777) (-1367.686) * [-1376.188] (-1380.789) (-1379.622) (-1387.254) -- 0:03:18
250000 -- (-1362.183) (-1379.051) (-1388.080) [-1363.348] * (-1354.350) [-1356.290] (-1392.876) (-1374.406) -- 0:03:18
Average standard deviation of split frequencies: 0.011660
250500 -- (-1368.814) (-1374.890) (-1378.356) [-1362.304] * (-1374.816) (-1357.977) (-1377.296) [-1348.794] -- 0:03:17
251000 -- (-1373.388) (-1376.898) (-1396.531) [-1362.627] * (-1393.521) [-1351.677] (-1379.226) (-1352.938) -- 0:03:16
251500 -- (-1367.877) [-1377.028] (-1379.655) (-1364.495) * (-1377.189) (-1389.195) (-1371.592) [-1350.270] -- 0:03:16
252000 -- (-1380.691) (-1370.776) [-1364.726] (-1367.741) * (-1374.279) (-1371.655) (-1361.017) [-1342.410] -- 0:03:18
252500 -- (-1373.949) (-1361.077) [-1350.767] (-1376.946) * [-1354.085] (-1389.066) (-1373.098) (-1369.816) -- 0:03:18
253000 -- (-1374.000) [-1366.667] (-1381.726) (-1367.460) * (-1377.244) (-1382.705) [-1358.238] (-1378.168) -- 0:03:17
253500 -- (-1357.776) (-1376.852) (-1383.946) [-1363.475] * (-1359.225) [-1346.725] (-1365.651) (-1379.687) -- 0:03:17
254000 -- [-1345.710] (-1388.240) (-1379.812) (-1363.509) * (-1383.670) [-1354.753] (-1362.387) (-1382.637) -- 0:03:16
254500 -- (-1353.678) (-1387.301) (-1377.843) [-1358.647] * [-1369.308] (-1370.135) (-1358.249) (-1384.591) -- 0:03:16
255000 -- (-1359.444) (-1382.851) [-1369.634] (-1375.421) * (-1376.267) (-1375.711) [-1353.434] (-1379.751) -- 0:03:15
Average standard deviation of split frequencies: 0.013719
255500 -- (-1362.589) (-1389.243) [-1349.984] (-1380.468) * (-1384.351) (-1384.735) [-1361.568] (-1371.982) -- 0:03:15
256000 -- (-1376.295) (-1384.403) (-1381.447) [-1360.101] * (-1381.197) (-1375.988) [-1351.749] (-1380.397) -- 0:03:17
256500 -- (-1375.953) (-1389.452) (-1365.327) [-1362.514] * (-1386.823) (-1365.474) (-1370.276) [-1359.579] -- 0:03:17
257000 -- (-1377.257) (-1385.958) (-1383.182) [-1350.942] * [-1372.679] (-1370.700) (-1378.727) (-1375.202) -- 0:03:16
257500 -- (-1369.795) (-1378.027) (-1382.577) [-1354.572] * (-1384.358) (-1368.920) (-1368.325) [-1354.963] -- 0:03:16
258000 -- [-1358.476] (-1374.288) (-1380.268) (-1363.486) * (-1388.846) (-1372.220) (-1381.615) [-1352.596] -- 0:03:15
258500 -- (-1347.123) (-1388.320) (-1368.086) [-1365.910] * (-1378.733) [-1368.550] (-1377.585) (-1344.278) -- 0:03:15
259000 -- (-1347.560) (-1385.171) (-1374.708) [-1351.958] * (-1376.300) (-1370.636) (-1366.716) [-1347.684] -- 0:03:14
259500 -- [-1339.982] (-1379.108) (-1376.071) (-1369.786) * (-1374.586) (-1383.100) (-1377.247) [-1360.797] -- 0:03:16
260000 -- [-1349.636] (-1385.167) (-1370.125) (-1370.273) * (-1376.335) (-1383.930) [-1372.847] (-1380.786) -- 0:03:16
Average standard deviation of split frequencies: 0.015415
260500 -- (-1366.829) (-1376.262) (-1360.354) [-1372.771] * [-1377.694] (-1374.841) (-1374.471) (-1378.485) -- 0:03:15
261000 -- [-1353.715] (-1375.376) (-1384.111) (-1379.362) * (-1374.196) (-1381.357) [-1370.395] (-1376.647) -- 0:03:15
261500 -- (-1353.751) [-1363.343] (-1379.928) (-1367.645) * (-1370.606) [-1361.179] (-1380.410) (-1386.858) -- 0:03:14
262000 -- [-1347.673] (-1367.198) (-1380.882) (-1369.300) * [-1366.819] (-1369.939) (-1390.218) (-1374.883) -- 0:03:14
262500 -- (-1349.617) (-1366.510) (-1379.146) [-1350.803] * (-1342.238) (-1378.449) (-1374.810) [-1361.283] -- 0:03:13
263000 -- (-1356.857) (-1376.842) (-1383.263) [-1347.812] * (-1376.628) [-1366.380] (-1388.408) (-1360.683) -- 0:03:13
263500 -- [-1351.022] (-1385.343) (-1362.704) (-1355.681) * [-1353.083] (-1380.905) (-1380.886) (-1375.771) -- 0:03:15
264000 -- [-1354.326] (-1378.035) (-1390.005) (-1364.917) * [-1357.994] (-1376.645) (-1387.566) (-1378.484) -- 0:03:15
264500 -- [-1340.609] (-1380.265) (-1371.416) (-1384.940) * (-1354.112) (-1380.493) [-1379.639] (-1379.257) -- 0:03:14
265000 -- [-1362.888] (-1365.977) (-1376.786) (-1382.401) * [-1366.846] (-1381.261) (-1376.312) (-1375.159) -- 0:03:14
Average standard deviation of split frequencies: 0.014684
265500 -- [-1354.141] (-1381.874) (-1383.962) (-1377.048) * (-1364.034) (-1389.203) [-1371.014] (-1375.201) -- 0:03:13
266000 -- [-1352.581] (-1377.749) (-1379.767) (-1371.530) * [-1373.793] (-1383.381) (-1365.082) (-1390.818) -- 0:03:13
266500 -- [-1355.556] (-1370.052) (-1377.270) (-1384.234) * (-1369.883) (-1371.966) [-1353.456] (-1387.022) -- 0:03:12
267000 -- (-1370.411) [-1360.270] (-1374.401) (-1362.434) * (-1357.933) (-1380.178) [-1352.113] (-1383.322) -- 0:03:12
267500 -- [-1367.594] (-1375.159) (-1383.681) (-1379.159) * [-1349.298] (-1372.572) (-1351.531) (-1382.235) -- 0:03:14
268000 -- (-1376.671) (-1382.212) [-1360.232] (-1379.300) * (-1375.638) (-1383.483) [-1365.965] (-1388.339) -- 0:03:13
268500 -- (-1371.710) (-1375.331) [-1354.804] (-1381.157) * (-1374.832) [-1358.974] (-1370.077) (-1380.183) -- 0:03:13
269000 -- (-1390.220) [-1359.571] (-1366.126) (-1382.072) * (-1381.923) (-1361.916) [-1367.020] (-1384.684) -- 0:03:12
269500 -- (-1364.053) [-1360.233] (-1362.519) (-1364.300) * (-1373.409) [-1351.096] (-1378.407) (-1378.974) -- 0:03:12
270000 -- (-1376.682) (-1381.976) [-1357.874] (-1383.532) * (-1388.790) [-1358.109] (-1359.272) (-1384.249) -- 0:03:11
Average standard deviation of split frequencies: 0.014456
270500 -- [-1362.688] (-1384.088) (-1361.089) (-1376.877) * (-1389.562) [-1360.403] (-1363.463) (-1383.948) -- 0:03:11
271000 -- [-1341.674] (-1382.053) (-1383.891) (-1378.903) * (-1380.981) [-1349.844] (-1360.911) (-1365.461) -- 0:03:10
271500 -- [-1366.533] (-1368.347) (-1388.981) (-1391.131) * (-1371.083) (-1368.559) (-1382.073) [-1349.988] -- 0:03:13
272000 -- [-1350.911] (-1376.632) (-1388.658) (-1392.256) * (-1378.559) (-1375.048) (-1384.884) [-1363.053] -- 0:03:12
272500 -- [-1359.498] (-1378.697) (-1389.695) (-1386.723) * (-1375.196) (-1393.178) (-1373.276) [-1360.380] -- 0:03:12
273000 -- (-1373.785) (-1379.632) [-1369.924] (-1391.634) * (-1382.646) (-1378.032) (-1366.131) [-1351.269] -- 0:03:11
273500 -- (-1352.780) [-1357.363] (-1364.772) (-1385.502) * (-1376.857) (-1370.581) (-1384.664) [-1356.011] -- 0:03:11
274000 -- [-1349.935] (-1352.805) (-1380.948) (-1369.110) * (-1374.928) (-1391.328) [-1354.396] (-1361.972) -- 0:03:10
274500 -- (-1374.445) (-1384.398) (-1380.353) [-1361.557] * (-1381.082) (-1379.904) [-1365.929] (-1374.157) -- 0:03:10
275000 -- (-1380.395) (-1377.428) [-1352.392] (-1355.122) * (-1379.632) [-1356.742] (-1376.857) (-1380.098) -- 0:03:12
Average standard deviation of split frequencies: 0.013493
275500 -- (-1364.428) (-1376.841) (-1348.375) [-1338.629] * (-1372.275) [-1359.155] (-1354.069) (-1379.599) -- 0:03:11
276000 -- (-1367.302) (-1372.514) [-1341.922] (-1382.986) * (-1377.676) (-1347.728) [-1358.890] (-1382.596) -- 0:03:11
276500 -- (-1375.227) (-1370.975) [-1355.199] (-1381.601) * (-1381.274) [-1365.475] (-1362.011) (-1373.176) -- 0:03:11
277000 -- (-1382.576) (-1375.017) [-1365.928] (-1370.775) * (-1378.348) (-1362.808) [-1365.614] (-1379.119) -- 0:03:10
277500 -- (-1386.783) (-1360.273) [-1346.966] (-1377.236) * (-1389.734) [-1349.309] (-1373.134) (-1379.052) -- 0:03:10
278000 -- (-1382.651) [-1357.846] (-1362.803) (-1377.918) * (-1374.089) (-1348.393) [-1351.574] (-1382.526) -- 0:03:09
278500 -- (-1385.255) (-1353.169) [-1354.825] (-1380.071) * (-1388.680) [-1345.661] (-1357.293) (-1377.246) -- 0:03:09
279000 -- (-1386.183) (-1368.229) [-1353.504] (-1368.235) * (-1383.581) [-1355.374] (-1370.056) (-1375.688) -- 0:03:11
279500 -- (-1387.837) [-1346.387] (-1372.740) (-1376.692) * [-1373.652] (-1373.960) (-1386.908) (-1375.532) -- 0:03:10
280000 -- (-1392.884) [-1361.403] (-1378.284) (-1371.909) * (-1365.979) [-1362.717] (-1393.159) (-1364.083) -- 0:03:10
Average standard deviation of split frequencies: 0.014956
280500 -- (-1383.326) [-1342.385] (-1379.987) (-1375.503) * (-1350.456) [-1343.994] (-1378.807) (-1372.394) -- 0:03:09
281000 -- (-1379.540) (-1360.500) [-1352.655] (-1371.921) * [-1355.270] (-1359.045) (-1380.072) (-1375.111) -- 0:03:09
281500 -- (-1379.375) (-1343.416) [-1346.934] (-1386.104) * (-1367.014) [-1360.218] (-1378.941) (-1370.656) -- 0:03:08
282000 -- (-1382.869) (-1364.308) [-1361.415] (-1377.036) * [-1352.813] (-1365.525) (-1381.706) (-1374.060) -- 0:03:08
282500 -- (-1373.259) [-1356.341] (-1387.166) (-1390.868) * [-1361.854] (-1379.499) (-1374.835) (-1375.139) -- 0:03:07
283000 -- (-1380.978) [-1348.707] (-1375.320) (-1387.426) * [-1364.463] (-1384.080) (-1370.000) (-1353.082) -- 0:03:10
283500 -- (-1389.933) [-1353.507] (-1383.990) (-1372.399) * (-1375.501) (-1378.314) (-1356.426) [-1351.168] -- 0:03:09
284000 -- (-1381.127) (-1357.499) [-1372.088] (-1373.607) * (-1376.013) (-1384.996) [-1360.509] (-1363.519) -- 0:03:09
284500 -- [-1359.439] (-1368.673) (-1378.206) (-1372.036) * (-1367.811) (-1377.469) (-1378.713) [-1363.496] -- 0:03:08
285000 -- [-1353.382] (-1358.974) (-1386.469) (-1380.627) * (-1390.396) (-1379.015) (-1381.717) [-1353.319] -- 0:03:08
Average standard deviation of split frequencies: 0.014834
285500 -- (-1363.024) [-1354.537] (-1378.830) (-1382.604) * (-1386.597) (-1371.731) (-1371.342) [-1352.980] -- 0:03:07
286000 -- [-1368.285] (-1361.730) (-1390.108) (-1380.479) * [-1369.180] (-1374.380) (-1360.648) (-1373.962) -- 0:03:07
286500 -- (-1370.861) [-1362.828] (-1379.326) (-1352.522) * (-1375.281) [-1372.622] (-1372.761) (-1375.940) -- 0:03:09
287000 -- (-1392.336) [-1345.749] (-1382.608) (-1364.950) * (-1378.129) (-1380.987) [-1357.310] (-1374.664) -- 0:03:08
287500 -- (-1384.170) [-1368.303] (-1371.653) (-1381.680) * (-1371.967) (-1379.551) [-1360.091] (-1387.019) -- 0:03:08
288000 -- (-1361.401) [-1353.576] (-1376.866) (-1361.454) * (-1377.378) (-1374.289) [-1353.696] (-1380.285) -- 0:03:07
288500 -- (-1373.894) [-1349.374] (-1370.010) (-1382.363) * (-1369.092) (-1379.004) [-1364.729] (-1389.215) -- 0:03:07
289000 -- [-1363.245] (-1371.955) (-1362.956) (-1385.135) * (-1364.544) (-1380.728) (-1359.367) [-1356.531] -- 0:03:06
289500 -- (-1384.172) (-1358.290) [-1359.119] (-1376.863) * (-1383.024) (-1380.594) (-1374.584) [-1350.243] -- 0:03:06
290000 -- (-1369.020) [-1351.534] (-1386.314) (-1369.683) * (-1381.704) (-1379.039) [-1345.640] (-1349.891) -- 0:03:06
Average standard deviation of split frequencies: 0.015894
290500 -- (-1362.783) [-1359.440] (-1384.747) (-1376.457) * (-1377.147) (-1370.335) [-1341.171] (-1363.424) -- 0:03:08
291000 -- (-1368.570) [-1368.832] (-1388.072) (-1372.361) * (-1373.316) (-1365.279) (-1376.475) [-1354.419] -- 0:03:07
291500 -- (-1366.651) [-1363.226] (-1377.922) (-1388.674) * (-1378.167) (-1380.008) [-1361.990] (-1379.712) -- 0:03:07
292000 -- (-1373.653) [-1353.800] (-1380.837) (-1382.459) * (-1375.982) (-1377.713) [-1350.842] (-1375.087) -- 0:03:06
292500 -- (-1364.961) [-1361.716] (-1366.578) (-1375.442) * [-1348.016] (-1361.403) (-1357.894) (-1375.216) -- 0:03:06
293000 -- (-1375.783) [-1379.303] (-1369.929) (-1382.789) * [-1361.949] (-1376.539) (-1359.493) (-1380.888) -- 0:03:05
293500 -- [-1366.857] (-1370.624) (-1370.730) (-1376.954) * (-1348.106) [-1360.056] (-1373.957) (-1379.470) -- 0:03:05
294000 -- (-1362.758) [-1368.271] (-1375.509) (-1385.881) * (-1379.327) (-1377.388) [-1351.489] (-1377.805) -- 0:03:07
294500 -- (-1377.071) (-1376.749) [-1357.301] (-1386.478) * (-1392.658) (-1382.795) [-1344.428] (-1377.236) -- 0:03:06
295000 -- (-1388.612) (-1378.462) [-1370.881] (-1381.183) * (-1375.825) (-1361.643) [-1345.083] (-1373.340) -- 0:03:06
Average standard deviation of split frequencies: 0.015607
295500 -- [-1367.173] (-1380.205) (-1380.972) (-1378.376) * (-1384.895) (-1379.548) (-1362.614) [-1360.367] -- 0:03:05
296000 -- [-1360.983] (-1361.227) (-1385.778) (-1374.337) * (-1383.699) (-1390.304) [-1354.348] (-1370.478) -- 0:03:05
296500 -- (-1368.208) [-1360.182] (-1384.344) (-1384.503) * (-1387.648) (-1377.090) (-1357.805) [-1361.184] -- 0:03:05
297000 -- (-1368.193) (-1364.161) (-1379.096) [-1368.539] * (-1390.936) (-1389.540) (-1372.388) [-1355.191] -- 0:03:04
297500 -- (-1362.403) (-1370.825) (-1381.546) [-1358.944] * (-1388.695) [-1374.178] (-1367.409) (-1362.052) -- 0:03:04
298000 -- [-1368.136] (-1386.227) (-1379.000) (-1366.582) * (-1358.992) (-1377.063) (-1386.838) [-1354.801] -- 0:03:06
298500 -- [-1339.992] (-1388.267) (-1385.682) (-1369.601) * (-1373.492) (-1382.073) [-1357.482] (-1359.296) -- 0:03:05
299000 -- (-1353.715) (-1387.557) (-1389.121) [-1371.220] * [-1354.174] (-1379.803) (-1379.691) (-1380.346) -- 0:03:05
299500 -- (-1363.239) [-1352.969] (-1379.706) (-1374.778) * [-1361.132] (-1387.625) (-1380.123) (-1365.021) -- 0:03:04
300000 -- (-1350.275) [-1368.194] (-1366.933) (-1379.599) * (-1366.038) (-1381.459) [-1363.355] (-1369.117) -- 0:03:04
Average standard deviation of split frequencies: 0.014895
300500 -- [-1354.548] (-1370.266) (-1396.164) (-1360.400) * (-1381.769) (-1382.944) (-1367.923) [-1357.808] -- 0:03:03
301000 -- (-1368.732) (-1376.754) [-1360.940] (-1365.264) * (-1382.828) (-1374.826) (-1369.431) [-1363.708] -- 0:03:03
301500 -- (-1381.042) (-1368.055) [-1360.456] (-1366.459) * (-1375.628) [-1368.449] (-1371.033) (-1364.950) -- 0:03:03
302000 -- (-1392.056) (-1382.225) (-1371.252) [-1365.618] * (-1374.590) (-1367.935) (-1373.541) [-1357.890] -- 0:03:04
302500 -- (-1374.902) [-1361.231] (-1369.744) (-1352.789) * [-1368.691] (-1382.336) (-1373.445) (-1369.503) -- 0:03:04
303000 -- [-1360.481] (-1379.742) (-1362.882) (-1383.201) * [-1344.216] (-1372.813) (-1371.399) (-1366.069) -- 0:03:04
303500 -- (-1368.459) (-1375.221) [-1366.334] (-1387.739) * [-1349.472] (-1375.933) (-1380.860) (-1366.450) -- 0:03:03
304000 -- (-1378.737) [-1379.504] (-1364.074) (-1375.154) * (-1353.227) (-1370.855) (-1380.570) [-1350.344] -- 0:03:03
304500 -- (-1388.343) (-1375.228) [-1353.400] (-1360.996) * [-1366.645] (-1381.890) (-1383.489) (-1385.409) -- 0:03:02
305000 -- (-1381.087) (-1368.721) [-1366.625] (-1364.364) * (-1360.145) (-1371.197) (-1378.854) [-1377.886] -- 0:03:02
Average standard deviation of split frequencies: 0.014672
305500 -- (-1374.530) (-1372.623) (-1363.643) [-1353.735] * [-1358.775] (-1373.169) (-1374.326) (-1380.561) -- 0:03:04
306000 -- [-1367.009] (-1384.157) (-1380.131) (-1382.300) * (-1377.764) [-1362.464] (-1385.089) (-1373.457) -- 0:03:03
306500 -- (-1380.878) [-1335.228] (-1376.116) (-1368.915) * (-1369.101) [-1356.768] (-1386.255) (-1381.417) -- 0:03:03
307000 -- (-1378.412) [-1381.140] (-1380.797) (-1367.328) * (-1387.692) (-1350.960) (-1385.791) [-1361.634] -- 0:03:02
307500 -- (-1377.784) (-1376.808) (-1397.835) [-1371.715] * (-1359.676) (-1350.893) (-1382.346) [-1360.584] -- 0:03:02
308000 -- (-1395.482) (-1372.664) (-1381.171) [-1347.987] * (-1384.301) [-1349.379] (-1372.355) (-1367.366) -- 0:03:01
308500 -- (-1383.875) [-1363.143] (-1380.486) (-1365.990) * (-1350.155) (-1362.913) (-1380.921) [-1361.889] -- 0:03:01
309000 -- (-1385.751) (-1351.721) (-1389.343) [-1369.584] * [-1373.256] (-1381.248) (-1376.742) (-1367.886) -- 0:03:01
309500 -- (-1348.161) (-1374.085) (-1372.777) [-1356.954] * (-1367.835) [-1362.786] (-1378.801) (-1381.894) -- 0:03:02
310000 -- [-1346.264] (-1381.302) (-1370.464) (-1363.772) * (-1366.780) (-1378.030) (-1374.100) [-1357.377] -- 0:03:02
Average standard deviation of split frequencies: 0.014740
310500 -- (-1361.756) (-1382.944) (-1356.644) [-1347.370] * (-1380.846) (-1382.851) (-1363.236) [-1354.926] -- 0:03:02
311000 -- [-1343.353] (-1375.413) (-1379.511) (-1353.067) * [-1364.449] (-1392.685) (-1376.279) (-1354.329) -- 0:03:01
311500 -- [-1349.084] (-1365.513) (-1376.170) (-1371.231) * (-1370.521) (-1386.243) (-1373.997) [-1355.097] -- 0:03:01
312000 -- [-1350.722] (-1367.877) (-1381.626) (-1366.787) * (-1364.941) (-1376.366) (-1370.454) [-1354.764] -- 0:03:00
312500 -- [-1348.223] (-1348.866) (-1380.786) (-1365.753) * (-1380.492) (-1373.911) (-1368.035) [-1362.635] -- 0:03:00
313000 -- (-1368.685) (-1373.555) (-1376.938) [-1342.476] * (-1362.689) (-1383.317) (-1365.438) [-1350.670] -- 0:02:59
313500 -- (-1354.627) (-1377.472) (-1382.142) [-1359.382] * (-1357.727) (-1373.714) [-1354.272] (-1347.175) -- 0:03:01
314000 -- (-1348.475) [-1360.773] (-1389.086) (-1376.318) * [-1353.244] (-1383.713) (-1358.273) (-1368.189) -- 0:03:01
314500 -- (-1357.274) (-1375.205) (-1371.537) [-1355.726] * (-1352.733) (-1380.802) [-1349.274] (-1359.235) -- 0:03:00
315000 -- (-1359.087) (-1381.261) (-1376.550) [-1369.183] * [-1363.281] (-1388.295) (-1358.094) (-1365.727) -- 0:03:00
Average standard deviation of split frequencies: 0.014470
315500 -- (-1364.403) (-1369.430) (-1365.699) [-1349.967] * (-1359.476) (-1380.438) [-1357.556] (-1392.037) -- 0:03:00
316000 -- (-1375.307) [-1361.381] (-1376.247) (-1382.184) * (-1374.635) (-1367.618) [-1354.157] (-1366.734) -- 0:02:59
316500 -- (-1380.516) [-1355.893] (-1374.483) (-1374.155) * (-1376.239) (-1376.940) [-1353.331] (-1374.894) -- 0:02:59
317000 -- (-1371.016) [-1365.186] (-1379.341) (-1366.866) * (-1379.554) (-1371.580) [-1361.852] (-1372.992) -- 0:02:58
317500 -- (-1379.438) [-1357.226] (-1366.449) (-1372.153) * (-1381.343) (-1374.699) (-1379.423) [-1353.620] -- 0:03:00
318000 -- (-1366.656) [-1344.168] (-1376.235) (-1361.701) * (-1374.948) [-1356.142] (-1391.178) (-1364.303) -- 0:03:00
318500 -- (-1375.834) [-1356.107] (-1389.939) (-1355.361) * (-1372.359) [-1364.552] (-1380.020) (-1370.743) -- 0:02:59
319000 -- (-1380.417) (-1366.739) (-1383.817) [-1366.105] * (-1382.758) [-1353.783] (-1380.108) (-1361.691) -- 0:02:59
319500 -- (-1383.028) (-1376.258) (-1366.942) [-1361.725] * (-1374.960) [-1346.858] (-1367.586) (-1374.735) -- 0:02:58
320000 -- (-1385.120) (-1370.380) [-1364.228] (-1374.012) * (-1344.032) [-1342.841] (-1360.441) (-1377.066) -- 0:02:58
Average standard deviation of split frequencies: 0.014841
320500 -- (-1378.765) (-1362.131) [-1353.989] (-1361.544) * (-1361.508) [-1341.368] (-1372.578) (-1376.765) -- 0:02:58
321000 -- (-1374.853) [-1362.032] (-1352.309) (-1367.807) * (-1356.534) [-1358.329] (-1373.547) (-1387.408) -- 0:02:59
321500 -- (-1382.858) (-1373.163) [-1348.136] (-1367.117) * (-1365.995) (-1378.418) [-1359.382] (-1377.014) -- 0:02:59
322000 -- (-1371.369) (-1372.009) [-1366.428] (-1361.692) * (-1372.417) (-1379.252) [-1352.322] (-1370.841) -- 0:02:58
322500 -- [-1357.868] (-1382.958) (-1368.133) (-1360.907) * (-1382.056) (-1379.972) [-1345.476] (-1394.075) -- 0:02:58
323000 -- (-1369.280) (-1388.836) [-1351.554] (-1365.434) * (-1377.597) (-1378.452) [-1359.317] (-1370.477) -- 0:02:58
323500 -- (-1371.799) (-1376.322) (-1373.392) [-1371.354] * [-1355.016] (-1369.732) (-1358.415) (-1354.935) -- 0:02:57
324000 -- (-1369.456) [-1363.749] (-1382.388) (-1381.537) * (-1361.990) (-1375.152) (-1375.825) [-1354.865] -- 0:02:57
324500 -- [-1346.221] (-1375.407) (-1368.891) (-1378.966) * [-1356.816] (-1381.891) (-1382.787) (-1369.713) -- 0:02:56
325000 -- [-1362.941] (-1370.370) (-1385.083) (-1383.448) * [-1348.662] (-1387.275) (-1374.400) (-1370.901) -- 0:02:58
Average standard deviation of split frequencies: 0.014677
325500 -- [-1361.884] (-1364.957) (-1379.951) (-1357.315) * [-1361.164] (-1384.436) (-1390.848) (-1374.727) -- 0:02:58
326000 -- [-1351.977] (-1372.372) (-1371.671) (-1374.153) * (-1364.274) (-1377.629) (-1382.123) [-1370.005] -- 0:02:57
326500 -- (-1359.524) (-1376.622) [-1364.390] (-1377.276) * [-1361.094] (-1369.959) (-1383.900) (-1354.866) -- 0:02:57
327000 -- [-1355.501] (-1378.648) (-1368.781) (-1375.949) * (-1377.970) (-1380.838) (-1375.004) [-1359.589] -- 0:02:56
327500 -- [-1370.157] (-1369.995) (-1363.882) (-1375.742) * [-1363.842] (-1380.619) (-1372.952) (-1355.754) -- 0:02:56
328000 -- (-1366.332) [-1360.619] (-1381.459) (-1381.097) * (-1361.014) (-1391.049) (-1385.162) [-1347.099] -- 0:02:56
328500 -- (-1376.348) [-1352.226] (-1391.391) (-1365.588) * (-1376.124) (-1382.269) (-1370.391) [-1348.633] -- 0:02:55
329000 -- (-1386.719) [-1358.928] (-1383.487) (-1379.349) * (-1377.086) (-1379.738) [-1355.809] (-1348.032) -- 0:02:57
329500 -- (-1378.444) [-1346.749] (-1388.432) (-1370.756) * (-1376.202) (-1384.299) (-1363.514) [-1342.338] -- 0:02:57
330000 -- (-1373.160) (-1351.943) (-1393.959) [-1363.887] * (-1376.492) (-1392.691) (-1372.038) [-1352.951] -- 0:02:56
Average standard deviation of split frequencies: 0.013757
330500 -- (-1377.809) [-1362.582] (-1370.568) (-1371.183) * (-1380.479) (-1393.729) [-1349.598] (-1360.815) -- 0:02:56
331000 -- (-1380.612) [-1353.592] (-1381.106) (-1359.326) * (-1379.536) (-1385.762) [-1350.981] (-1354.697) -- 0:02:55
331500 -- (-1372.636) (-1362.763) (-1388.758) [-1351.047] * (-1373.801) (-1388.298) [-1358.896] (-1379.346) -- 0:02:55
332000 -- (-1388.006) (-1373.714) (-1380.028) [-1353.345] * (-1369.506) (-1390.619) [-1376.751] (-1368.087) -- 0:02:55
332500 -- (-1383.403) (-1380.556) (-1384.676) [-1371.611] * (-1380.455) (-1375.810) [-1368.264] (-1351.430) -- 0:02:56
333000 -- (-1369.045) [-1369.089] (-1381.696) (-1370.545) * (-1380.398) (-1366.587) (-1385.800) [-1359.665] -- 0:02:56
333500 -- (-1372.304) [-1366.017] (-1374.006) (-1370.250) * [-1354.615] (-1358.215) (-1377.569) (-1376.633) -- 0:02:55
334000 -- [-1352.305] (-1366.493) (-1374.367) (-1380.535) * (-1368.969) [-1368.734] (-1377.271) (-1384.532) -- 0:02:55
334500 -- [-1361.841] (-1372.837) (-1376.835) (-1372.380) * (-1375.395) (-1358.744) (-1381.507) [-1352.194] -- 0:02:55
335000 -- [-1351.271] (-1378.339) (-1372.449) (-1382.433) * (-1376.252) (-1378.329) (-1387.490) [-1354.340] -- 0:02:54
Average standard deviation of split frequencies: 0.013439
335500 -- (-1362.576) (-1377.427) [-1357.570] (-1387.051) * (-1355.852) (-1369.411) (-1379.312) [-1359.784] -- 0:02:54
336000 -- (-1374.643) (-1390.469) [-1368.704] (-1392.533) * (-1374.051) [-1356.592] (-1362.240) (-1365.492) -- 0:02:53
336500 -- (-1368.971) (-1381.299) (-1361.406) [-1342.824] * (-1375.891) (-1360.026) (-1373.720) [-1362.157] -- 0:02:55
337000 -- (-1373.992) (-1383.905) (-1372.039) [-1349.338] * (-1379.149) (-1360.644) [-1353.571] (-1383.267) -- 0:02:55
337500 -- (-1372.121) (-1382.328) (-1381.509) [-1347.649] * (-1393.186) (-1377.586) [-1363.481] (-1378.309) -- 0:02:54
338000 -- (-1380.385) (-1375.423) (-1378.918) [-1342.001] * (-1379.701) (-1372.465) [-1360.778] (-1383.372) -- 0:02:54
338500 -- (-1363.651) (-1381.829) (-1387.011) [-1351.211] * (-1378.218) [-1348.688] (-1374.383) (-1392.907) -- 0:02:53
339000 -- [-1355.025] (-1360.064) (-1376.736) (-1359.806) * (-1363.565) [-1360.555] (-1375.087) (-1373.609) -- 0:02:53
339500 -- (-1371.846) (-1372.589) [-1353.722] (-1382.724) * (-1361.847) [-1361.797] (-1373.803) (-1370.282) -- 0:02:53
340000 -- (-1375.506) (-1375.563) [-1368.245] (-1369.641) * [-1360.975] (-1362.392) (-1376.423) (-1380.414) -- 0:02:52
Average standard deviation of split frequencies: 0.014056
340500 -- (-1380.064) (-1380.261) (-1384.988) [-1349.122] * (-1356.961) [-1355.840] (-1369.874) (-1380.025) -- 0:02:54
341000 -- (-1382.777) (-1379.145) (-1376.907) [-1351.796] * (-1365.952) [-1370.346] (-1378.659) (-1380.279) -- 0:02:53
341500 -- (-1392.088) (-1378.015) [-1361.268] (-1354.144) * (-1392.170) [-1360.467] (-1376.537) (-1381.446) -- 0:02:53
342000 -- (-1378.748) (-1373.903) [-1364.178] (-1362.264) * [-1368.009] (-1352.931) (-1365.803) (-1387.132) -- 0:02:53
342500 -- (-1354.923) [-1368.683] (-1374.488) (-1381.134) * (-1379.332) (-1358.646) [-1360.883] (-1389.038) -- 0:02:52
343000 -- (-1357.539) [-1346.411] (-1374.111) (-1382.683) * (-1377.609) (-1363.053) [-1354.938] (-1377.746) -- 0:02:52
343500 -- (-1350.414) (-1365.081) [-1356.164] (-1390.600) * (-1378.991) [-1356.296] (-1367.055) (-1370.891) -- 0:02:52
344000 -- [-1346.659] (-1382.439) (-1361.678) (-1377.254) * [-1375.066] (-1375.559) (-1379.486) (-1380.805) -- 0:02:53
344500 -- [-1351.509] (-1378.020) (-1362.321) (-1377.359) * (-1370.653) (-1362.063) [-1363.793] (-1385.268) -- 0:02:53
345000 -- (-1397.214) (-1378.610) [-1370.533] (-1371.950) * (-1393.165) [-1351.982] (-1382.494) (-1388.559) -- 0:02:52
Average standard deviation of split frequencies: 0.015123
345500 -- (-1389.466) (-1371.108) [-1369.372] (-1374.118) * (-1381.048) [-1363.682] (-1376.556) (-1380.753) -- 0:02:52
346000 -- (-1387.702) [-1354.471] (-1372.064) (-1371.345) * (-1364.786) (-1376.570) (-1382.669) [-1361.691] -- 0:02:52
346500 -- (-1375.350) (-1376.335) [-1366.475] (-1379.493) * [-1360.052] (-1369.580) (-1382.185) (-1368.997) -- 0:02:51
347000 -- (-1386.907) (-1350.635) (-1376.569) [-1349.014] * (-1357.333) [-1353.388] (-1377.366) (-1357.723) -- 0:02:51
347500 -- (-1373.979) (-1354.342) (-1364.891) [-1356.263] * (-1357.473) (-1366.657) (-1377.026) [-1360.716] -- 0:02:50
348000 -- (-1369.731) (-1379.018) [-1372.637] (-1379.131) * (-1366.732) [-1366.969] (-1382.119) (-1357.579) -- 0:02:52
348500 -- [-1373.014] (-1368.310) (-1381.289) (-1369.252) * [-1360.025] (-1367.253) (-1372.175) (-1383.958) -- 0:02:51
349000 -- (-1377.959) (-1359.165) (-1383.480) [-1354.118] * [-1360.781] (-1391.987) (-1372.805) (-1364.735) -- 0:02:51
349500 -- (-1347.240) (-1374.613) (-1362.125) [-1371.725] * (-1353.571) (-1374.990) (-1374.238) [-1351.703] -- 0:02:51
350000 -- (-1375.825) (-1390.341) (-1370.684) [-1345.739] * [-1373.618] (-1369.138) (-1375.253) (-1359.991) -- 0:02:50
Average standard deviation of split frequencies: 0.015778
350500 -- (-1367.080) (-1389.446) (-1370.307) [-1345.908] * (-1370.960) (-1377.433) (-1371.491) [-1373.395] -- 0:02:50
351000 -- (-1373.413) (-1367.129) (-1368.590) [-1358.397] * (-1375.384) (-1383.452) (-1370.090) [-1362.178] -- 0:02:50
351500 -- (-1381.010) (-1350.349) (-1367.793) [-1351.958] * (-1380.217) [-1372.604] (-1373.009) (-1365.925) -- 0:02:49
352000 -- (-1377.186) (-1373.250) [-1353.130] (-1366.590) * (-1378.048) (-1354.088) (-1383.638) [-1365.856] -- 0:02:51
352500 -- (-1371.862) (-1357.957) [-1359.517] (-1353.073) * (-1375.187) [-1357.352] (-1383.680) (-1366.525) -- 0:02:50
353000 -- (-1382.910) (-1380.995) (-1365.527) [-1357.791] * (-1380.788) [-1368.113] (-1388.355) (-1367.499) -- 0:02:50
353500 -- (-1393.075) (-1380.111) (-1363.088) [-1362.623] * (-1377.846) [-1377.453] (-1381.176) (-1377.319) -- 0:02:50
354000 -- (-1378.689) [-1358.701] (-1360.241) (-1369.719) * (-1353.091) (-1365.498) [-1374.721] (-1371.198) -- 0:02:49
354500 -- (-1378.694) (-1380.964) (-1381.595) [-1371.246] * (-1367.389) (-1391.440) (-1385.618) [-1351.359] -- 0:02:49
355000 -- (-1370.045) (-1385.134) [-1370.017] (-1362.542) * [-1360.361] (-1381.896) (-1382.246) (-1354.102) -- 0:02:48
Average standard deviation of split frequencies: 0.016448
355500 -- [-1370.398] (-1379.674) (-1369.576) (-1378.833) * (-1383.549) (-1364.802) (-1378.068) [-1358.018] -- 0:02:50
356000 -- (-1371.242) (-1380.972) (-1366.714) [-1362.350] * (-1362.772) (-1367.003) (-1383.691) [-1351.908] -- 0:02:50
356500 -- (-1379.400) (-1378.156) (-1350.687) [-1357.992] * (-1363.226) [-1349.219] (-1382.144) (-1367.623) -- 0:02:49
357000 -- (-1371.880) (-1384.919) (-1366.857) [-1344.415] * [-1360.691] (-1382.511) (-1374.914) (-1381.754) -- 0:02:49
357500 -- (-1380.251) (-1382.291) [-1368.824] (-1395.736) * [-1349.010] (-1379.412) (-1374.570) (-1377.404) -- 0:02:48
358000 -- (-1391.120) (-1378.228) (-1384.245) [-1360.543] * [-1354.897] (-1380.579) (-1369.761) (-1393.154) -- 0:02:48
358500 -- [-1357.543] (-1383.067) (-1385.125) (-1364.295) * (-1356.977) (-1379.977) [-1360.345] (-1383.441) -- 0:02:48
359000 -- (-1374.580) (-1372.061) (-1373.267) [-1358.843] * [-1352.341] (-1366.234) (-1376.323) (-1390.856) -- 0:02:47
359500 -- (-1370.471) [-1350.715] (-1364.586) (-1360.836) * [-1364.076] (-1386.996) (-1361.328) (-1381.159) -- 0:02:49
360000 -- (-1366.317) [-1340.127] (-1378.903) (-1368.722) * [-1348.143] (-1375.715) (-1371.587) (-1392.177) -- 0:02:48
Average standard deviation of split frequencies: 0.016716
360500 -- (-1382.386) [-1349.860] (-1388.412) (-1379.094) * (-1365.937) (-1377.555) [-1353.361] (-1382.282) -- 0:02:48
361000 -- (-1380.320) [-1362.824] (-1368.569) (-1384.043) * (-1368.389) (-1366.127) [-1353.298] (-1380.565) -- 0:02:48
361500 -- (-1380.292) [-1346.119] (-1364.025) (-1383.586) * (-1377.300) (-1372.626) [-1365.240] (-1369.238) -- 0:02:47
362000 -- (-1370.748) [-1347.016] (-1355.416) (-1390.065) * [-1379.056] (-1385.149) (-1390.248) (-1381.101) -- 0:02:47
362500 -- (-1381.325) (-1368.467) [-1358.294] (-1367.455) * (-1373.616) (-1377.068) [-1359.713] (-1371.924) -- 0:02:47
363000 -- (-1382.137) (-1355.632) (-1370.674) [-1359.965] * (-1372.734) (-1382.060) [-1349.742] (-1359.518) -- 0:02:46
363500 -- (-1374.956) (-1358.258) [-1344.500] (-1369.833) * (-1356.844) (-1374.175) [-1346.682] (-1378.023) -- 0:02:48
364000 -- (-1366.717) [-1345.548] (-1344.922) (-1354.451) * [-1364.750] (-1390.651) (-1354.163) (-1369.622) -- 0:02:47
364500 -- (-1384.773) [-1355.457] (-1360.489) (-1365.812) * (-1346.468) (-1386.430) (-1366.234) [-1339.499] -- 0:02:47
365000 -- (-1380.027) [-1363.531] (-1389.696) (-1377.259) * (-1356.327) (-1388.016) [-1356.760] (-1356.525) -- 0:02:47
Average standard deviation of split frequencies: 0.017490
365500 -- (-1383.886) [-1360.443] (-1372.358) (-1376.416) * (-1364.652) [-1370.224] (-1360.790) (-1356.034) -- 0:02:46
366000 -- (-1380.210) (-1364.274) [-1369.549] (-1367.739) * [-1372.510] (-1380.980) (-1376.260) (-1373.719) -- 0:02:46
366500 -- (-1369.188) (-1366.842) [-1377.430] (-1359.127) * (-1371.134) (-1366.486) (-1387.236) [-1356.843] -- 0:02:45
367000 -- (-1366.883) (-1374.504) (-1363.211) [-1358.191] * (-1368.559) (-1386.294) (-1390.502) [-1356.831] -- 0:02:47
367500 -- (-1380.890) [-1355.564] (-1390.857) (-1364.303) * [-1353.317] (-1388.081) (-1387.251) (-1361.540) -- 0:02:46
368000 -- [-1355.721] (-1382.803) (-1379.973) (-1373.089) * (-1354.350) (-1384.693) (-1378.470) [-1344.717] -- 0:02:46
368500 -- (-1379.128) [-1370.165] (-1374.052) (-1372.352) * [-1362.739] (-1387.130) (-1383.695) (-1354.841) -- 0:02:46
369000 -- (-1367.817) (-1389.462) (-1374.498) [-1374.395] * (-1383.811) (-1384.293) (-1377.028) [-1346.535] -- 0:02:45
369500 -- (-1370.224) (-1369.663) (-1376.038) [-1356.645] * (-1393.500) (-1369.090) [-1372.920] (-1373.541) -- 0:02:45
370000 -- (-1366.029) (-1375.927) [-1359.696] (-1376.042) * (-1376.802) (-1367.028) (-1389.235) [-1366.999] -- 0:02:45
Average standard deviation of split frequencies: 0.017872
370500 -- (-1378.758) (-1367.734) [-1348.374] (-1371.016) * (-1360.492) [-1351.617] (-1380.888) (-1368.979) -- 0:02:44
371000 -- (-1375.831) (-1361.047) [-1357.545] (-1376.761) * [-1348.887] (-1365.328) (-1375.242) (-1374.537) -- 0:02:46
371500 -- (-1390.333) (-1365.917) [-1352.585] (-1376.179) * [-1373.971] (-1380.476) (-1386.467) (-1381.918) -- 0:02:45
372000 -- (-1376.177) (-1378.639) [-1351.555] (-1366.161) * (-1358.924) [-1368.925] (-1378.103) (-1379.280) -- 0:02:45
372500 -- (-1385.403) (-1379.801) [-1365.216] (-1361.218) * [-1350.718] (-1381.799) (-1388.994) (-1374.934) -- 0:02:45
373000 -- [-1365.831] (-1383.592) (-1372.878) (-1371.965) * [-1340.014] (-1376.397) (-1371.311) (-1387.626) -- 0:02:44
373500 -- (-1361.997) (-1373.498) [-1346.630] (-1379.172) * (-1366.827) (-1367.666) [-1356.710] (-1380.135) -- 0:02:44
374000 -- [-1363.220] (-1363.673) (-1376.457) (-1368.136) * (-1381.702) [-1363.151] (-1362.874) (-1380.373) -- 0:02:44
374500 -- (-1365.811) (-1387.435) (-1378.786) [-1351.491] * (-1380.462) (-1370.658) [-1357.448] (-1379.283) -- 0:02:43
375000 -- (-1378.093) (-1390.332) (-1398.007) [-1358.981] * (-1373.937) [-1348.691] (-1358.061) (-1376.256) -- 0:02:45
Average standard deviation of split frequencies: 0.018212
375500 -- [-1373.326] (-1374.225) (-1391.433) (-1365.538) * (-1376.254) [-1358.852] (-1368.721) (-1379.782) -- 0:02:44
376000 -- [-1348.603] (-1385.858) (-1390.726) (-1359.920) * [-1365.766] (-1354.058) (-1389.720) (-1376.653) -- 0:02:44
376500 -- [-1353.288] (-1383.915) (-1366.656) (-1388.031) * [-1369.635] (-1371.815) (-1377.055) (-1367.867) -- 0:02:43
377000 -- (-1361.204) (-1381.937) [-1366.258] (-1368.146) * (-1391.105) (-1382.616) [-1359.123] (-1371.266) -- 0:02:43
377500 -- (-1349.155) [-1371.538] (-1366.615) (-1367.097) * (-1382.820) [-1364.924] (-1371.549) (-1385.558) -- 0:02:43
378000 -- (-1364.100) (-1370.949) (-1357.909) [-1359.135] * [-1366.085] (-1380.074) (-1384.708) (-1378.048) -- 0:02:42
378500 -- (-1382.512) [-1370.799] (-1377.824) (-1377.998) * [-1359.763] (-1380.454) (-1377.174) (-1380.206) -- 0:02:44
379000 -- (-1372.503) [-1358.904] (-1383.558) (-1387.550) * (-1361.501) [-1365.931] (-1374.639) (-1379.782) -- 0:02:43
379500 -- (-1372.592) [-1358.172] (-1382.025) (-1380.029) * [-1358.072] (-1386.083) (-1368.189) (-1386.842) -- 0:02:43
380000 -- (-1370.228) [-1354.567] (-1377.309) (-1374.009) * (-1354.342) [-1357.893] (-1373.679) (-1392.641) -- 0:02:43
Average standard deviation of split frequencies: 0.018575
380500 -- (-1366.449) [-1347.659] (-1379.484) (-1370.826) * (-1379.205) [-1365.255] (-1374.498) (-1385.459) -- 0:02:42
381000 -- (-1384.689) [-1353.593] (-1380.749) (-1370.812) * (-1367.156) [-1364.041] (-1379.240) (-1358.365) -- 0:02:42
381500 -- (-1373.519) [-1337.168] (-1381.078) (-1373.654) * [-1365.134] (-1367.842) (-1375.711) (-1368.090) -- 0:02:42
382000 -- (-1374.283) [-1347.118] (-1370.232) (-1382.355) * (-1377.678) (-1376.809) [-1358.351] (-1368.687) -- 0:02:41
382500 -- (-1383.459) (-1364.339) (-1367.296) [-1378.626] * (-1374.299) (-1373.847) (-1355.597) [-1348.988] -- 0:02:43
383000 -- (-1376.106) (-1354.307) [-1355.631] (-1380.279) * [-1349.195] (-1380.855) (-1355.351) (-1368.301) -- 0:02:42
383500 -- (-1380.706) [-1357.842] (-1345.742) (-1381.731) * (-1368.893) (-1394.096) (-1373.915) [-1349.736] -- 0:02:42
384000 -- (-1368.149) (-1385.410) [-1356.201] (-1369.165) * (-1381.050) (-1367.471) (-1380.427) [-1357.249] -- 0:02:42
384500 -- (-1377.506) (-1372.314) (-1357.974) [-1359.548] * (-1387.285) [-1355.965] (-1381.137) (-1360.851) -- 0:02:41
385000 -- (-1372.105) (-1376.524) (-1371.088) [-1366.310] * (-1385.288) (-1363.188) (-1376.937) [-1370.090] -- 0:02:41
Average standard deviation of split frequencies: 0.019113
385500 -- (-1370.391) (-1372.459) [-1351.444] (-1380.461) * (-1384.528) (-1352.788) (-1383.321) [-1348.300] -- 0:02:40
386000 -- (-1369.369) (-1383.480) [-1345.866] (-1388.208) * (-1390.557) [-1358.621] (-1377.517) (-1348.013) -- 0:02:42
386500 -- [-1355.195] (-1369.409) (-1359.367) (-1374.101) * (-1370.372) (-1373.782) (-1375.368) [-1344.954] -- 0:02:41
387000 -- (-1380.085) (-1374.493) [-1354.048] (-1391.831) * (-1383.380) (-1356.844) (-1373.755) [-1354.229] -- 0:02:41
387500 -- (-1361.305) (-1373.618) [-1359.447] (-1384.293) * (-1369.205) (-1380.147) (-1386.112) [-1350.158] -- 0:02:41
388000 -- (-1363.581) (-1372.943) [-1361.123] (-1377.883) * (-1373.348) [-1344.579] (-1389.242) (-1355.155) -- 0:02:40
388500 -- [-1370.741] (-1383.484) (-1356.746) (-1385.918) * (-1378.023) [-1354.812] (-1381.166) (-1358.927) -- 0:02:40
389000 -- (-1391.429) (-1373.128) [-1356.240] (-1386.264) * (-1388.685) (-1376.345) (-1376.621) [-1351.842] -- 0:02:40
389500 -- (-1367.022) (-1373.569) [-1347.204] (-1380.085) * (-1375.432) (-1389.352) [-1373.136] (-1364.665) -- 0:02:39
390000 -- (-1372.797) (-1361.409) [-1367.727] (-1377.859) * [-1360.832] (-1374.068) (-1385.280) (-1381.776) -- 0:02:41
Average standard deviation of split frequencies: 0.019434
390500 -- (-1360.417) (-1373.571) (-1362.988) [-1364.907] * [-1361.699] (-1374.544) (-1365.299) (-1380.311) -- 0:02:40
391000 -- [-1354.101] (-1375.264) (-1359.901) (-1380.668) * (-1377.262) (-1365.783) [-1365.599] (-1374.703) -- 0:02:40
391500 -- (-1378.464) [-1353.050] (-1381.698) (-1386.928) * (-1367.141) [-1360.714] (-1377.760) (-1377.513) -- 0:02:40
392000 -- (-1390.649) [-1362.576] (-1363.946) (-1377.397) * (-1385.551) (-1363.317) (-1370.860) [-1351.108] -- 0:02:39
392500 -- (-1374.969) [-1360.375] (-1372.539) (-1386.659) * (-1367.961) (-1374.367) (-1370.988) [-1361.569] -- 0:02:39
393000 -- (-1362.919) [-1352.168] (-1379.527) (-1385.538) * (-1375.904) (-1377.058) (-1375.342) [-1372.198] -- 0:02:39
393500 -- [-1371.304] (-1371.242) (-1385.293) (-1382.311) * (-1374.062) (-1387.994) (-1383.572) [-1350.573] -- 0:02:38
394000 -- [-1346.783] (-1385.360) (-1376.403) (-1364.998) * [-1373.909] (-1379.057) (-1383.458) (-1364.612) -- 0:02:39
394500 -- (-1369.434) (-1379.662) (-1377.075) [-1368.774] * (-1383.690) (-1362.506) [-1372.104] (-1349.325) -- 0:02:39
395000 -- [-1359.066] (-1386.373) (-1382.462) (-1373.309) * (-1375.707) [-1372.581] (-1394.320) (-1364.537) -- 0:02:39
Average standard deviation of split frequencies: 0.018608
395500 -- [-1356.986] (-1377.914) (-1381.165) (-1384.255) * (-1368.936) [-1358.136] (-1372.422) (-1385.658) -- 0:02:38
396000 -- [-1348.571] (-1392.019) (-1373.841) (-1376.020) * (-1366.148) (-1369.836) [-1346.537] (-1378.034) -- 0:02:38
396500 -- (-1354.403) [-1358.546] (-1377.078) (-1374.600) * [-1376.135] (-1373.422) (-1360.745) (-1372.394) -- 0:02:38
397000 -- (-1354.475) [-1358.155] (-1384.518) (-1377.312) * [-1374.760] (-1372.043) (-1374.607) (-1371.406) -- 0:02:37
397500 -- [-1363.933] (-1356.834) (-1377.676) (-1373.348) * (-1368.246) (-1389.429) [-1359.242] (-1366.960) -- 0:02:39
398000 -- (-1376.155) (-1373.159) (-1375.399) [-1351.911] * [-1376.355] (-1376.104) (-1379.586) (-1367.533) -- 0:02:38
398500 -- (-1378.312) (-1365.098) (-1372.880) [-1364.094] * [-1367.224] (-1388.503) (-1377.383) (-1373.254) -- 0:02:38
399000 -- (-1377.154) (-1372.701) (-1378.066) [-1363.282] * (-1377.024) (-1388.490) (-1379.891) [-1369.564] -- 0:02:38
399500 -- (-1368.973) (-1381.110) (-1372.590) [-1361.664] * (-1369.004) (-1385.523) [-1360.357] (-1374.675) -- 0:02:37
400000 -- (-1378.351) (-1381.936) (-1367.948) [-1359.131] * (-1370.496) (-1376.132) (-1365.986) [-1367.846] -- 0:02:37
Average standard deviation of split frequencies: 0.018206
400500 -- (-1346.700) (-1385.907) [-1353.238] (-1375.529) * (-1377.552) (-1374.855) (-1373.797) [-1367.697] -- 0:02:37
401000 -- [-1347.476] (-1363.800) (-1382.158) (-1383.074) * (-1364.822) (-1377.874) (-1392.866) [-1365.272] -- 0:02:36
401500 -- (-1345.404) [-1349.871] (-1369.630) (-1375.034) * (-1362.402) (-1372.447) [-1381.965] (-1381.393) -- 0:02:38
402000 -- (-1345.851) [-1350.090] (-1384.194) (-1378.700) * (-1354.876) (-1378.765) (-1372.926) [-1351.112] -- 0:02:37
402500 -- (-1374.317) [-1368.080] (-1392.903) (-1387.376) * [-1362.195] (-1373.751) (-1364.253) (-1366.133) -- 0:02:37
403000 -- (-1378.597) [-1357.638] (-1385.396) (-1392.991) * [-1358.391] (-1371.735) (-1375.691) (-1377.712) -- 0:02:37
403500 -- (-1372.640) (-1378.686) [-1352.752] (-1389.845) * (-1369.410) [-1364.391] (-1387.492) (-1375.404) -- 0:02:36
404000 -- [-1366.364] (-1372.449) (-1367.827) (-1386.110) * [-1357.367] (-1382.169) (-1377.948) (-1343.782) -- 0:02:36
404500 -- (-1382.378) [-1373.681] (-1366.920) (-1375.852) * (-1350.254) (-1385.675) (-1371.923) [-1347.015] -- 0:02:36
405000 -- (-1384.856) (-1379.367) [-1356.529] (-1384.398) * (-1346.450) (-1390.295) (-1379.999) [-1356.053] -- 0:02:35
Average standard deviation of split frequencies: 0.017416
405500 -- (-1384.261) (-1376.695) [-1357.689] (-1375.933) * (-1359.295) (-1369.138) (-1372.535) [-1347.040] -- 0:02:36
406000 -- (-1383.167) [-1361.703] (-1351.752) (-1382.308) * [-1350.800] (-1369.343) (-1378.304) (-1357.004) -- 0:02:36
406500 -- (-1378.167) (-1366.135) (-1381.909) [-1370.664] * [-1361.248] (-1357.550) (-1378.744) (-1365.848) -- 0:02:36
407000 -- (-1386.965) (-1384.271) [-1360.092] (-1362.890) * (-1394.566) (-1371.001) (-1376.656) [-1362.043] -- 0:02:35
407500 -- [-1378.318] (-1382.066) (-1349.315) (-1387.216) * [-1377.372] (-1397.264) (-1377.323) (-1370.110) -- 0:02:35
408000 -- (-1396.928) [-1354.649] (-1355.102) (-1396.350) * (-1381.447) (-1372.674) (-1379.534) [-1355.628] -- 0:02:35
408500 -- (-1365.614) [-1368.259] (-1371.218) (-1377.866) * (-1380.417) (-1374.511) (-1370.798) [-1354.234] -- 0:02:34
409000 -- [-1349.607] (-1354.439) (-1369.230) (-1386.723) * (-1375.720) (-1376.744) (-1373.451) [-1357.805] -- 0:02:36
409500 -- (-1348.676) (-1358.578) [-1368.803] (-1387.590) * (-1363.081) (-1367.478) (-1385.594) [-1359.887] -- 0:02:35
410000 -- [-1339.151] (-1353.921) (-1365.618) (-1379.573) * [-1366.731] (-1364.766) (-1379.365) (-1370.799) -- 0:02:35
Average standard deviation of split frequencies: 0.016675
410500 -- [-1346.688] (-1368.243) (-1367.515) (-1385.559) * (-1386.478) [-1368.597] (-1359.533) (-1384.617) -- 0:02:35
411000 -- [-1352.244] (-1380.367) (-1372.840) (-1379.321) * (-1374.083) [-1358.569] (-1379.135) (-1373.485) -- 0:02:34
411500 -- [-1354.351] (-1378.726) (-1366.121) (-1366.021) * (-1387.326) [-1373.262] (-1382.815) (-1381.040) -- 0:02:34
412000 -- [-1360.264] (-1386.959) (-1361.251) (-1359.202) * (-1381.084) [-1352.512] (-1383.888) (-1370.721) -- 0:02:34
412500 -- [-1366.049] (-1381.621) (-1378.906) (-1369.465) * (-1375.527) (-1371.340) [-1364.344] (-1371.344) -- 0:02:33
413000 -- (-1347.576) (-1393.985) [-1368.782] (-1383.731) * (-1371.416) [-1374.001] (-1381.357) (-1370.708) -- 0:02:34
413500 -- [-1348.613] (-1380.232) (-1369.287) (-1372.152) * (-1375.967) [-1358.420] (-1393.196) (-1355.923) -- 0:02:34
414000 -- [-1349.880] (-1377.572) (-1366.243) (-1363.316) * [-1371.180] (-1377.285) (-1376.318) (-1358.560) -- 0:02:34
414500 -- (-1370.085) [-1362.527] (-1380.125) (-1367.630) * (-1356.198) (-1375.853) (-1389.619) [-1345.930] -- 0:02:33
415000 -- (-1375.699) (-1373.958) (-1375.844) [-1360.905] * (-1363.358) [-1359.442] (-1381.622) (-1358.616) -- 0:02:33
Average standard deviation of split frequencies: 0.016163
415500 -- (-1384.828) [-1368.733] (-1375.645) (-1363.693) * [-1349.890] (-1366.900) (-1382.816) (-1373.332) -- 0:02:33
416000 -- (-1376.310) (-1370.945) (-1377.322) [-1348.024] * (-1358.374) [-1358.894] (-1381.316) (-1376.087) -- 0:02:33
416500 -- (-1383.515) [-1357.324] (-1371.613) (-1377.405) * (-1384.233) [-1372.412] (-1383.620) (-1381.700) -- 0:02:32
417000 -- (-1371.336) (-1367.375) [-1348.942] (-1381.909) * (-1393.621) (-1373.755) [-1363.291] (-1382.691) -- 0:02:33
417500 -- [-1347.223] (-1384.638) (-1366.166) (-1379.707) * (-1385.743) (-1362.437) [-1363.716] (-1384.414) -- 0:02:33
418000 -- [-1364.240] (-1376.995) (-1383.772) (-1385.003) * (-1381.411) [-1376.711] (-1365.245) (-1373.483) -- 0:02:33
418500 -- (-1378.550) (-1385.741) [-1355.481] (-1397.550) * [-1383.806] (-1384.681) (-1363.561) (-1384.085) -- 0:02:32
419000 -- (-1367.323) (-1384.295) [-1351.064] (-1386.111) * (-1379.105) (-1376.344) [-1365.534] (-1362.080) -- 0:02:32
419500 -- (-1392.540) (-1380.341) [-1362.300] (-1379.028) * (-1379.008) (-1390.707) (-1371.690) [-1366.341] -- 0:02:32
420000 -- (-1382.251) (-1381.539) [-1372.436] (-1376.347) * (-1379.774) [-1359.556] (-1372.587) (-1369.439) -- 0:02:31
Average standard deviation of split frequencies: 0.015577
420500 -- (-1386.928) [-1358.452] (-1396.534) (-1367.104) * (-1373.839) (-1365.048) (-1376.756) [-1362.029] -- 0:02:32
421000 -- (-1375.054) (-1368.117) (-1379.770) [-1356.475] * (-1366.159) [-1347.059] (-1381.907) (-1372.026) -- 0:02:32
421500 -- (-1372.369) [-1358.769] (-1386.626) (-1370.096) * (-1365.391) (-1362.550) (-1378.496) [-1351.082] -- 0:02:32
422000 -- [-1358.536] (-1365.024) (-1378.928) (-1380.792) * (-1379.003) (-1365.997) (-1380.045) [-1342.191] -- 0:02:32
422500 -- [-1344.046] (-1383.902) (-1372.511) (-1377.935) * (-1361.446) (-1366.875) (-1381.165) [-1344.250] -- 0:02:31
423000 -- (-1358.407) (-1371.736) [-1369.455] (-1370.668) * (-1377.911) (-1377.002) (-1374.359) [-1346.051] -- 0:02:31
423500 -- (-1378.917) (-1370.930) (-1382.279) [-1372.459] * (-1373.226) [-1365.909] (-1372.488) (-1367.557) -- 0:02:31
424000 -- (-1371.854) (-1373.160) (-1378.812) [-1358.520] * (-1375.405) (-1372.268) [-1356.544] (-1340.749) -- 0:02:30
424500 -- (-1378.086) (-1385.629) (-1367.633) [-1359.541] * (-1378.403) [-1365.664] (-1366.510) (-1371.687) -- 0:02:31
425000 -- (-1381.647) (-1373.526) [-1357.527] (-1369.077) * (-1382.141) [-1364.197] (-1363.883) (-1374.194) -- 0:02:31
Average standard deviation of split frequencies: 0.015271
425500 -- (-1379.927) (-1360.187) (-1374.959) [-1353.544] * (-1384.792) [-1341.197] (-1350.394) (-1380.335) -- 0:02:31
426000 -- (-1392.006) (-1367.463) [-1362.236] (-1382.731) * [-1349.033] (-1347.844) (-1384.240) (-1385.907) -- 0:02:30
426500 -- (-1367.843) (-1389.657) [-1361.658] (-1370.445) * [-1354.203] (-1356.519) (-1363.798) (-1384.183) -- 0:02:30
427000 -- (-1379.575) (-1379.697) (-1371.043) [-1345.469] * [-1340.291] (-1364.249) (-1372.455) (-1385.990) -- 0:02:30
427500 -- (-1366.509) (-1372.285) (-1364.096) [-1360.928] * [-1344.537] (-1362.354) (-1383.799) (-1364.346) -- 0:02:29
428000 -- [-1365.257] (-1381.404) (-1383.749) (-1350.880) * [-1347.287] (-1354.762) (-1383.560) (-1382.478) -- 0:02:29
428500 -- (-1375.651) (-1388.473) (-1368.303) [-1351.379] * (-1385.292) [-1357.338] (-1385.018) (-1377.639) -- 0:02:30
429000 -- (-1375.050) (-1374.396) (-1388.612) [-1361.234] * (-1369.252) [-1346.473] (-1360.041) (-1378.970) -- 0:02:30
429500 -- (-1369.654) (-1377.076) (-1374.879) [-1363.415] * (-1379.888) (-1351.200) (-1379.122) [-1360.063] -- 0:02:30
430000 -- (-1380.780) [-1353.001] (-1376.024) (-1367.465) * (-1375.357) [-1343.796] (-1367.563) (-1379.892) -- 0:02:29
Average standard deviation of split frequencies: 0.015209
430500 -- (-1379.734) [-1356.690] (-1380.226) (-1389.674) * (-1381.966) (-1364.885) [-1355.751] (-1366.402) -- 0:02:29
431000 -- (-1386.159) (-1368.926) (-1379.153) [-1357.603] * (-1382.588) [-1360.138] (-1353.355) (-1379.596) -- 0:02:29
431500 -- (-1382.134) (-1384.696) (-1369.463) [-1353.911] * [-1374.551] (-1379.966) (-1373.541) (-1386.078) -- 0:02:28
432000 -- (-1389.221) (-1369.072) (-1371.709) [-1369.813] * [-1380.905] (-1371.208) (-1365.986) (-1389.586) -- 0:02:29
432500 -- [-1374.545] (-1379.540) (-1369.285) (-1388.493) * (-1370.848) (-1379.960) (-1357.244) [-1359.508] -- 0:02:29
433000 -- (-1372.078) [-1364.962] (-1363.916) (-1371.242) * (-1370.959) (-1376.675) (-1365.439) [-1357.983] -- 0:02:29
433500 -- (-1367.352) (-1382.748) (-1385.706) [-1368.521] * (-1377.351) (-1369.460) [-1347.415] (-1362.338) -- 0:02:28
434000 -- (-1378.075) (-1383.658) [-1364.599] (-1385.741) * (-1382.581) (-1371.566) [-1347.476] (-1389.615) -- 0:02:28
434500 -- (-1374.431) (-1370.116) [-1351.496] (-1385.255) * (-1376.771) [-1374.896] (-1353.691) (-1389.165) -- 0:02:28
435000 -- (-1377.669) (-1383.882) [-1351.710] (-1372.197) * (-1378.974) (-1383.195) (-1369.550) [-1342.066] -- 0:02:28
Average standard deviation of split frequencies: 0.015706
435500 -- (-1370.216) (-1389.953) [-1343.150] (-1373.791) * (-1375.462) (-1371.729) [-1365.391] (-1365.835) -- 0:02:27
436000 -- [-1366.605] (-1389.731) (-1366.482) (-1385.787) * (-1387.709) (-1377.084) [-1352.384] (-1384.906) -- 0:02:28
436500 -- [-1354.455] (-1384.284) (-1380.732) (-1380.421) * [-1362.911] (-1372.942) (-1362.778) (-1372.758) -- 0:02:28
437000 -- (-1368.277) [-1379.149] (-1385.650) (-1380.144) * (-1382.045) (-1384.213) [-1367.686] (-1358.921) -- 0:02:28
437500 -- (-1371.349) [-1365.397] (-1390.643) (-1368.858) * (-1383.968) (-1361.632) (-1372.141) [-1358.744] -- 0:02:27
438000 -- (-1362.943) (-1378.779) (-1391.774) [-1379.939] * (-1382.681) (-1369.434) (-1363.544) [-1360.707] -- 0:02:27
438500 -- (-1371.662) (-1379.000) (-1385.025) [-1365.028] * (-1382.547) (-1378.072) [-1363.662] (-1353.058) -- 0:02:27
439000 -- (-1375.245) (-1371.927) (-1394.467) [-1367.463] * (-1382.935) (-1379.250) [-1344.310] (-1358.554) -- 0:02:26
439500 -- (-1375.918) (-1382.930) (-1379.951) [-1356.226] * (-1377.130) (-1382.010) (-1349.901) [-1353.452] -- 0:02:26
440000 -- (-1379.361) (-1360.472) (-1399.013) [-1350.611] * (-1379.471) (-1394.011) (-1358.551) [-1360.980] -- 0:02:27
Average standard deviation of split frequencies: 0.016103
440500 -- (-1376.906) (-1374.855) (-1383.722) [-1362.820] * (-1375.530) (-1384.373) [-1347.351] (-1373.969) -- 0:02:27
441000 -- (-1379.183) (-1380.293) (-1388.716) [-1359.516] * (-1384.621) (-1388.900) [-1350.786] (-1371.825) -- 0:02:27
441500 -- (-1385.689) (-1373.553) (-1374.732) [-1364.974] * (-1384.507) (-1376.988) [-1361.199] (-1368.988) -- 0:02:26
442000 -- (-1380.602) (-1384.777) (-1382.078) [-1367.847] * (-1378.580) (-1368.149) (-1380.402) [-1374.384] -- 0:02:26
442500 -- (-1370.570) (-1386.132) [-1357.805] (-1364.427) * (-1378.513) (-1377.380) [-1353.650] (-1370.929) -- 0:02:26
443000 -- (-1362.520) (-1369.309) (-1374.382) [-1347.834] * (-1387.348) (-1371.953) (-1361.503) [-1362.303] -- 0:02:25
443500 -- (-1381.470) [-1346.955] (-1377.051) (-1356.746) * (-1377.802) (-1397.291) [-1355.800] (-1364.669) -- 0:02:26
444000 -- (-1374.239) [-1357.015] (-1370.951) (-1378.070) * (-1374.853) (-1372.594) [-1368.114] (-1385.745) -- 0:02:26
444500 -- (-1381.223) [-1351.572] (-1348.975) (-1377.116) * (-1378.640) (-1355.131) [-1373.432] (-1381.941) -- 0:02:26
445000 -- (-1379.333) (-1372.299) [-1351.641] (-1379.387) * (-1387.638) [-1367.369] (-1373.084) (-1377.150) -- 0:02:25
Average standard deviation of split frequencies: 0.016355
445500 -- (-1391.103) (-1346.996) [-1350.261] (-1381.614) * (-1366.681) [-1364.788] (-1387.041) (-1380.405) -- 0:02:25
446000 -- (-1383.770) [-1347.228] (-1356.905) (-1384.012) * (-1384.531) [-1347.521] (-1386.253) (-1384.017) -- 0:02:25
446500 -- (-1366.789) [-1360.695] (-1360.710) (-1390.389) * (-1381.646) [-1358.183] (-1387.731) (-1382.522) -- 0:02:25
447000 -- (-1369.964) [-1358.585] (-1362.679) (-1364.039) * (-1366.356) [-1373.204] (-1383.842) (-1387.080) -- 0:02:24
447500 -- (-1368.179) [-1345.715] (-1382.469) (-1378.112) * (-1375.504) [-1367.966] (-1379.295) (-1379.989) -- 0:02:25
448000 -- (-1381.384) [-1348.969] (-1374.718) (-1376.318) * (-1363.779) [-1344.782] (-1365.081) (-1385.823) -- 0:02:25
448500 -- (-1385.398) (-1347.484) [-1370.162] (-1381.190) * (-1360.405) [-1344.299] (-1368.221) (-1378.275) -- 0:02:25
449000 -- (-1397.348) (-1369.782) [-1377.871] (-1389.062) * (-1381.825) [-1354.749] (-1377.349) (-1363.076) -- 0:02:24
449500 -- (-1358.090) (-1381.960) [-1360.832] (-1386.253) * (-1360.120) [-1341.700] (-1370.256) (-1375.826) -- 0:02:24
450000 -- [-1350.073] (-1381.134) (-1366.912) (-1386.825) * (-1365.485) [-1339.203] (-1375.900) (-1379.351) -- 0:02:24
Average standard deviation of split frequencies: 0.015966
450500 -- [-1351.007] (-1377.717) (-1366.549) (-1389.076) * [-1362.496] (-1357.595) (-1378.933) (-1382.475) -- 0:02:23
451000 -- (-1355.459) [-1365.722] (-1379.033) (-1391.646) * [-1370.422] (-1376.225) (-1390.234) (-1366.823) -- 0:02:23
451500 -- [-1350.353] (-1380.140) (-1358.733) (-1385.128) * (-1374.191) (-1385.196) (-1386.546) [-1348.516] -- 0:02:24
452000 -- (-1366.054) (-1383.762) [-1346.100] (-1383.386) * (-1369.507) (-1395.827) (-1372.441) [-1360.946] -- 0:02:24
452500 -- (-1362.637) (-1377.189) [-1360.922] (-1383.615) * [-1364.519] (-1368.020) (-1373.744) (-1375.513) -- 0:02:23
453000 -- (-1360.083) (-1385.880) [-1355.576] (-1376.351) * [-1352.023] (-1378.646) (-1375.152) (-1375.495) -- 0:02:23
453500 -- [-1372.504] (-1382.020) (-1380.208) (-1381.550) * [-1350.728] (-1343.369) (-1376.463) (-1389.445) -- 0:02:23
454000 -- (-1365.679) (-1393.506) (-1353.096) [-1368.300] * [-1360.508] (-1392.110) (-1374.689) (-1377.328) -- 0:02:23
454500 -- (-1369.583) (-1382.162) [-1357.853] (-1388.511) * (-1370.568) (-1375.646) (-1375.716) [-1350.386] -- 0:02:22
455000 -- [-1352.849] (-1393.779) (-1380.250) (-1378.624) * (-1379.921) (-1379.947) (-1370.469) [-1348.077] -- 0:02:23
Average standard deviation of split frequencies: 0.015888
455500 -- (-1364.335) [-1359.984] (-1383.672) (-1382.133) * (-1378.603) (-1395.855) (-1387.684) [-1353.922] -- 0:02:23
456000 -- [-1352.027] (-1363.592) (-1394.170) (-1375.729) * (-1374.566) [-1373.536] (-1388.361) (-1370.559) -- 0:02:23
456500 -- [-1348.595] (-1362.497) (-1366.590) (-1379.864) * [-1362.259] (-1372.547) (-1387.905) (-1374.495) -- 0:02:22
457000 -- (-1384.793) [-1355.897] (-1371.747) (-1375.862) * [-1354.824] (-1365.864) (-1376.919) (-1374.366) -- 0:02:22
457500 -- (-1373.503) (-1360.217) [-1361.444] (-1391.138) * [-1349.719] (-1364.295) (-1379.099) (-1392.039) -- 0:02:22
458000 -- (-1382.286) (-1382.827) [-1338.876] (-1387.798) * [-1348.074] (-1392.309) (-1380.093) (-1381.983) -- 0:02:22
458500 -- (-1374.835) [-1352.473] (-1365.711) (-1377.703) * (-1369.355) (-1374.218) (-1383.773) [-1378.614] -- 0:02:21
459000 -- [-1358.606] (-1384.477) (-1364.489) (-1376.261) * [-1353.660] (-1380.819) (-1369.677) (-1372.461) -- 0:02:22
459500 -- (-1373.757) (-1381.457) (-1373.426) [-1354.917] * (-1376.033) (-1373.422) (-1374.289) [-1373.145] -- 0:02:22
460000 -- (-1368.129) (-1384.570) (-1380.437) [-1342.776] * [-1368.028] (-1378.761) (-1374.425) (-1382.489) -- 0:02:22
Average standard deviation of split frequencies: 0.015708
460500 -- [-1363.030] (-1380.499) (-1376.754) (-1354.620) * (-1356.479) (-1377.681) (-1380.504) [-1363.051] -- 0:02:21
461000 -- (-1376.151) [-1371.428] (-1376.327) (-1381.431) * [-1349.128] (-1385.994) (-1381.417) (-1372.210) -- 0:02:21
461500 -- [-1369.346] (-1358.167) (-1382.967) (-1389.114) * [-1356.576] (-1375.584) (-1387.839) (-1382.976) -- 0:02:21
462000 -- (-1380.672) [-1359.741] (-1373.861) (-1372.582) * (-1374.221) (-1377.950) [-1376.887] (-1383.113) -- 0:02:20
462500 -- (-1383.004) [-1354.291] (-1378.996) (-1373.930) * [-1352.206] (-1387.415) (-1397.122) (-1378.788) -- 0:02:20
463000 -- [-1367.994] (-1375.993) (-1376.966) (-1384.539) * (-1358.081) [-1350.390] (-1385.739) (-1386.539) -- 0:02:21
463500 -- [-1365.938] (-1355.207) (-1389.053) (-1377.712) * (-1377.210) [-1347.116] (-1379.136) (-1377.109) -- 0:02:21
464000 -- (-1384.745) [-1367.206] (-1379.521) (-1377.073) * (-1372.965) (-1384.583) (-1374.536) [-1350.505] -- 0:02:20
464500 -- (-1383.687) (-1367.755) [-1366.098] (-1365.129) * (-1374.362) [-1371.557] (-1380.077) (-1368.206) -- 0:02:20
465000 -- (-1375.357) [-1348.001] (-1374.239) (-1372.052) * [-1359.302] (-1388.733) (-1377.126) (-1354.192) -- 0:02:20
Average standard deviation of split frequencies: 0.015326
465500 -- (-1373.087) (-1387.881) [-1360.817] (-1351.325) * [-1356.959] (-1368.641) (-1374.900) (-1372.984) -- 0:02:20
466000 -- (-1380.877) (-1379.166) (-1356.143) [-1360.757] * [-1376.435] (-1374.621) (-1374.875) (-1375.078) -- 0:02:19
466500 -- (-1387.249) (-1380.097) [-1353.009] (-1365.530) * [-1359.045] (-1375.833) (-1382.970) (-1383.832) -- 0:02:20
467000 -- (-1382.032) (-1382.199) [-1351.758] (-1366.511) * [-1365.084] (-1368.552) (-1379.634) (-1381.485) -- 0:02:20
467500 -- (-1386.698) (-1391.792) [-1358.993] (-1361.661) * (-1365.268) [-1354.455] (-1375.935) (-1378.599) -- 0:02:20
468000 -- (-1378.697) (-1392.392) (-1378.281) [-1367.249] * [-1356.089] (-1384.395) (-1363.728) (-1376.790) -- 0:02:19
468500 -- (-1394.503) (-1374.542) (-1381.808) [-1350.208] * [-1353.345] (-1377.341) (-1360.281) (-1365.294) -- 0:02:19
469000 -- (-1383.846) (-1386.271) (-1380.152) [-1360.788] * [-1346.161] (-1386.640) (-1367.424) (-1369.242) -- 0:02:19
469500 -- [-1368.726] (-1355.540) (-1374.941) (-1375.406) * [-1347.905] (-1384.264) (-1377.391) (-1375.949) -- 0:02:18
470000 -- (-1370.847) (-1361.697) [-1359.763] (-1385.631) * [-1366.081] (-1377.477) (-1365.761) (-1380.726) -- 0:02:18
Average standard deviation of split frequencies: 0.013822
470500 -- (-1372.165) (-1359.349) [-1349.132] (-1379.709) * (-1394.608) (-1373.577) (-1372.101) [-1377.024] -- 0:02:19
471000 -- (-1382.025) (-1372.483) [-1350.986] (-1388.217) * (-1372.294) [-1353.407] (-1380.374) (-1382.667) -- 0:02:19
471500 -- (-1380.846) [-1340.076] (-1374.063) (-1391.065) * (-1361.856) [-1352.731] (-1381.205) (-1392.373) -- 0:02:18
472000 -- (-1365.217) [-1340.126] (-1376.366) (-1376.748) * [-1356.086] (-1352.051) (-1391.403) (-1379.213) -- 0:02:18
472500 -- (-1355.862) [-1354.025] (-1384.031) (-1384.110) * (-1370.699) [-1357.589] (-1387.183) (-1386.957) -- 0:02:18
473000 -- [-1350.974] (-1352.096) (-1393.232) (-1377.847) * [-1349.634] (-1359.485) (-1385.724) (-1377.564) -- 0:02:18
473500 -- (-1369.303) [-1362.591] (-1390.274) (-1376.788) * [-1374.173] (-1378.101) (-1367.633) (-1379.771) -- 0:02:17
474000 -- [-1366.745] (-1358.865) (-1376.000) (-1374.624) * (-1369.021) (-1375.161) [-1355.679] (-1392.080) -- 0:02:18
474500 -- [-1359.662] (-1384.627) (-1372.904) (-1374.706) * [-1362.197] (-1385.525) (-1376.191) (-1376.299) -- 0:02:18
475000 -- [-1348.098] (-1384.199) (-1374.100) (-1380.792) * [-1344.647] (-1382.798) (-1395.935) (-1356.368) -- 0:02:18
Average standard deviation of split frequencies: 0.014063
475500 -- (-1352.264) (-1379.261) [-1374.423] (-1385.536) * [-1361.457] (-1383.724) (-1381.432) (-1351.320) -- 0:02:17
476000 -- [-1352.562] (-1373.315) (-1382.627) (-1381.160) * (-1382.812) (-1382.477) (-1379.990) [-1350.413] -- 0:02:17
476500 -- (-1379.729) (-1375.779) (-1377.303) [-1365.510] * (-1356.724) (-1384.217) (-1382.766) [-1357.412] -- 0:02:17
477000 -- (-1381.886) (-1368.812) (-1380.798) [-1365.210] * (-1380.999) (-1378.570) (-1373.330) [-1348.682] -- 0:02:17
477500 -- (-1392.324) (-1373.427) (-1372.891) [-1366.004] * [-1362.688] (-1386.604) (-1360.472) (-1373.623) -- 0:02:16
478000 -- (-1371.820) [-1363.459] (-1379.826) (-1364.394) * (-1382.759) (-1375.288) (-1376.156) [-1356.285] -- 0:02:17
478500 -- (-1353.995) [-1352.261] (-1385.729) (-1365.982) * (-1385.412) (-1370.814) [-1355.156] (-1362.383) -- 0:02:17
479000 -- (-1387.342) [-1356.046] (-1377.629) (-1347.823) * (-1377.606) (-1373.949) [-1343.208] (-1380.635) -- 0:02:17
479500 -- (-1368.611) [-1346.460] (-1380.600) (-1365.006) * (-1385.378) (-1364.663) [-1360.415] (-1372.436) -- 0:02:16
480000 -- (-1369.764) [-1347.363] (-1388.392) (-1373.759) * (-1371.710) (-1365.129) [-1373.002] (-1380.191) -- 0:02:16
Average standard deviation of split frequencies: 0.014024
480500 -- (-1377.356) [-1357.484] (-1377.451) (-1355.306) * [-1368.260] (-1373.905) (-1380.352) (-1391.873) -- 0:02:16
481000 -- (-1377.769) (-1375.328) (-1386.556) [-1350.221] * [-1365.064] (-1364.467) (-1377.941) (-1374.510) -- 0:02:15
481500 -- (-1381.946) (-1370.889) (-1370.605) [-1368.299] * (-1376.884) (-1364.988) (-1384.631) [-1374.111] -- 0:02:15
482000 -- (-1385.460) (-1378.947) (-1375.584) [-1355.604] * (-1381.002) [-1373.204] (-1380.408) (-1364.368) -- 0:02:16
482500 -- (-1364.802) (-1376.047) (-1365.777) [-1358.980] * (-1381.072) (-1377.701) (-1361.515) [-1353.493] -- 0:02:16
483000 -- (-1371.895) (-1370.688) [-1359.393] (-1378.839) * (-1384.292) (-1361.956) (-1369.931) [-1346.354] -- 0:02:15
483500 -- (-1381.452) (-1381.777) [-1344.422] (-1377.945) * (-1384.083) (-1354.462) (-1369.903) [-1360.268] -- 0:02:15
484000 -- (-1383.887) [-1360.414] (-1368.398) (-1391.637) * (-1382.457) [-1358.930] (-1367.645) (-1365.648) -- 0:02:15
484500 -- (-1362.210) [-1360.648] (-1381.490) (-1383.420) * (-1381.580) [-1362.582] (-1371.778) (-1375.808) -- 0:02:15
485000 -- (-1373.168) [-1361.752] (-1376.994) (-1368.895) * (-1373.989) [-1356.181] (-1374.316) (-1379.075) -- 0:02:14
Average standard deviation of split frequencies: 0.013631
485500 -- (-1382.346) (-1373.568) [-1361.119] (-1363.304) * [-1354.337] (-1368.602) (-1382.130) (-1373.851) -- 0:02:15
486000 -- (-1382.516) (-1378.927) [-1356.267] (-1375.913) * (-1359.831) (-1375.176) [-1366.015] (-1371.724) -- 0:02:15
486500 -- (-1380.921) (-1382.049) [-1354.184] (-1378.869) * [-1350.639] (-1387.912) (-1372.604) (-1391.264) -- 0:02:15
487000 -- (-1388.773) (-1378.196) (-1377.854) [-1368.384] * [-1347.294] (-1385.696) (-1372.903) (-1381.763) -- 0:02:14
487500 -- (-1366.266) [-1365.687] (-1382.176) (-1369.384) * [-1360.751] (-1389.710) (-1371.316) (-1384.690) -- 0:02:14
488000 -- (-1372.425) (-1376.075) (-1370.422) [-1364.738] * (-1367.278) [-1360.284] (-1367.449) (-1376.481) -- 0:02:14
488500 -- (-1363.770) (-1377.930) (-1373.616) [-1355.983] * (-1358.780) [-1366.042] (-1376.338) (-1380.675) -- 0:02:14
489000 -- [-1357.337] (-1388.421) (-1381.839) (-1360.907) * [-1374.023] (-1361.934) (-1375.180) (-1378.217) -- 0:02:13
489500 -- [-1357.970] (-1374.061) (-1378.584) (-1386.290) * (-1390.632) [-1368.237] (-1371.217) (-1379.350) -- 0:02:14
490000 -- [-1356.641] (-1377.246) (-1387.370) (-1364.811) * (-1366.044) (-1380.646) (-1364.015) [-1373.267] -- 0:02:14
Average standard deviation of split frequencies: 0.013653
490500 -- (-1375.455) (-1379.238) (-1378.638) [-1375.063] * (-1363.449) (-1375.985) (-1370.909) [-1367.199] -- 0:02:13
491000 -- (-1382.905) (-1374.659) (-1372.796) [-1363.235] * (-1359.750) (-1359.525) [-1358.355] (-1384.189) -- 0:02:13
491500 -- (-1372.540) (-1381.329) (-1389.352) [-1364.838] * [-1349.810] (-1369.184) (-1367.068) (-1378.438) -- 0:02:13
492000 -- (-1367.045) [-1370.984] (-1380.262) (-1377.052) * (-1356.256) (-1362.074) [-1356.443] (-1376.831) -- 0:02:13
492500 -- [-1361.278] (-1370.025) (-1367.242) (-1368.237) * (-1362.908) (-1362.760) [-1358.460] (-1381.794) -- 0:02:12
493000 -- (-1361.705) [-1376.255] (-1374.929) (-1377.446) * [-1355.013] (-1365.322) (-1353.957) (-1381.524) -- 0:02:12
493500 -- (-1381.964) (-1376.123) [-1356.233] (-1379.592) * [-1362.902] (-1388.925) (-1387.970) (-1366.370) -- 0:02:13
494000 -- (-1383.704) [-1357.864] (-1364.433) (-1387.034) * [-1343.172] (-1384.168) (-1381.218) (-1386.195) -- 0:02:13
494500 -- (-1376.488) [-1366.068] (-1384.360) (-1377.295) * (-1382.344) [-1363.630] (-1371.899) (-1388.774) -- 0:02:12
495000 -- [-1353.750] (-1369.450) (-1377.595) (-1377.158) * [-1360.850] (-1371.817) (-1388.651) (-1390.118) -- 0:02:12
Average standard deviation of split frequencies: 0.012956
495500 -- (-1380.843) [-1344.479] (-1374.202) (-1378.464) * [-1360.429] (-1369.205) (-1360.476) (-1374.222) -- 0:02:12
496000 -- [-1366.601] (-1362.124) (-1373.026) (-1379.777) * (-1363.273) (-1372.000) [-1366.222] (-1356.782) -- 0:02:12
496500 -- (-1391.332) [-1350.505] (-1376.378) (-1371.914) * [-1365.774] (-1367.391) (-1369.660) (-1358.081) -- 0:02:11
497000 -- (-1377.280) (-1366.610) [-1359.879] (-1383.115) * [-1359.110] (-1376.763) (-1360.770) (-1359.217) -- 0:02:12
497500 -- (-1390.928) (-1375.808) [-1369.792] (-1370.605) * (-1374.945) (-1386.010) [-1361.089] (-1368.792) -- 0:02:12
498000 -- (-1377.636) (-1382.697) [-1375.109] (-1377.833) * (-1365.015) (-1391.000) (-1352.502) [-1363.706] -- 0:02:12
498500 -- (-1384.277) [-1342.957] (-1377.117) (-1388.738) * [-1365.445] (-1378.165) (-1375.869) (-1383.257) -- 0:02:11
499000 -- (-1369.330) [-1343.846] (-1373.806) (-1376.901) * (-1354.479) (-1384.022) [-1340.315] (-1380.012) -- 0:02:11
499500 -- (-1368.306) (-1377.687) (-1377.459) [-1371.223] * (-1365.667) (-1380.495) [-1348.824] (-1387.382) -- 0:02:11
500000 -- (-1381.542) (-1371.491) [-1354.619] (-1351.313) * (-1367.103) (-1379.080) [-1355.245] (-1374.558) -- 0:02:11
Average standard deviation of split frequencies: 0.012934
500500 -- (-1378.518) [-1366.993] (-1380.412) (-1357.602) * (-1383.618) (-1381.093) [-1364.854] (-1380.332) -- 0:02:10
501000 -- (-1385.790) [-1356.204] (-1369.982) (-1350.353) * (-1384.454) (-1372.094) [-1370.937] (-1382.438) -- 0:02:11
501500 -- (-1385.242) (-1384.130) (-1377.116) [-1352.147] * (-1368.280) (-1379.919) [-1348.349] (-1385.327) -- 0:02:11
502000 -- (-1370.789) (-1366.946) (-1365.435) [-1366.428] * (-1382.749) (-1390.384) [-1368.233] (-1390.346) -- 0:02:10
502500 -- [-1367.850] (-1376.204) (-1368.632) (-1386.556) * (-1383.234) (-1381.693) [-1356.499] (-1377.473) -- 0:02:10
503000 -- (-1372.454) [-1349.641] (-1390.399) (-1383.423) * (-1380.918) (-1389.241) [-1363.031] (-1368.292) -- 0:02:10
503500 -- [-1367.988] (-1358.549) (-1382.852) (-1379.859) * (-1381.104) (-1385.100) [-1353.158] (-1367.190) -- 0:02:10
504000 -- (-1378.901) [-1350.631] (-1377.948) (-1377.592) * [-1352.666] (-1384.903) (-1369.360) (-1367.408) -- 0:02:09
504500 -- (-1370.960) [-1348.978] (-1360.099) (-1380.978) * (-1358.680) (-1385.689) (-1373.484) [-1353.778] -- 0:02:10
505000 -- (-1368.481) (-1371.259) [-1353.713] (-1386.168) * (-1367.721) (-1389.409) (-1369.148) [-1360.922] -- 0:02:10
Average standard deviation of split frequencies: 0.013337
505500 -- (-1385.080) (-1369.303) [-1354.747] (-1361.900) * [-1367.804] (-1372.723) (-1381.325) (-1366.194) -- 0:02:10
506000 -- (-1379.605) (-1373.157) (-1358.393) [-1340.035] * (-1376.323) (-1376.734) (-1378.292) [-1372.509] -- 0:02:09
506500 -- (-1372.145) (-1377.898) (-1377.597) [-1355.108] * (-1368.740) (-1377.132) [-1373.078] (-1371.815) -- 0:02:09
507000 -- (-1368.390) (-1377.808) (-1385.366) [-1365.617] * [-1359.156] (-1377.751) (-1379.023) (-1382.167) -- 0:02:09
507500 -- (-1372.275) (-1379.537) (-1373.513) [-1362.940] * (-1362.044) (-1383.029) (-1384.248) [-1362.536] -- 0:02:09
508000 -- [-1359.915] (-1377.930) (-1375.824) (-1382.178) * [-1372.449] (-1374.911) (-1386.303) (-1373.583) -- 0:02:08
508500 -- [-1356.308] (-1373.422) (-1379.423) (-1380.765) * (-1373.716) (-1366.974) (-1390.888) [-1354.447] -- 0:02:09
509000 -- (-1376.157) (-1372.333) (-1375.470) [-1359.542] * (-1373.161) [-1361.741] (-1387.192) (-1357.896) -- 0:02:09
509500 -- (-1380.768) (-1377.859) [-1350.854] (-1357.836) * (-1376.077) [-1350.299] (-1379.695) (-1377.458) -- 0:02:09
510000 -- (-1362.616) (-1381.770) (-1391.229) [-1362.591] * (-1381.783) [-1354.542] (-1373.354) (-1373.253) -- 0:02:08
Average standard deviation of split frequencies: 0.013264
510500 -- (-1366.513) (-1390.681) (-1384.036) [-1350.013] * (-1378.794) [-1375.146] (-1380.272) (-1379.862) -- 0:02:08
511000 -- [-1361.953] (-1376.623) (-1365.450) (-1372.016) * (-1375.323) (-1375.072) [-1351.574] (-1367.841) -- 0:02:08
511500 -- (-1374.453) (-1383.692) (-1365.122) [-1353.261] * (-1360.155) (-1368.748) [-1371.533] (-1380.350) -- 0:02:07
512000 -- [-1349.995] (-1389.100) (-1378.163) (-1355.830) * (-1380.592) [-1352.802] (-1376.170) (-1381.199) -- 0:02:07
512500 -- [-1355.413] (-1371.325) (-1384.656) (-1379.025) * (-1383.560) [-1374.028] (-1378.457) (-1379.326) -- 0:02:08
513000 -- [-1352.967] (-1374.665) (-1387.167) (-1369.906) * (-1378.990) [-1369.518] (-1383.203) (-1368.855) -- 0:02:08
513500 -- [-1360.427] (-1379.306) (-1378.023) (-1384.462) * (-1379.535) (-1362.530) (-1387.758) [-1356.810] -- 0:02:07
514000 -- [-1355.876] (-1373.327) (-1373.914) (-1360.084) * (-1377.990) (-1365.849) (-1380.417) [-1359.487] -- 0:02:07
514500 -- (-1355.007) (-1372.333) (-1389.465) [-1361.086] * (-1358.065) [-1371.681] (-1384.658) (-1377.137) -- 0:02:07
515000 -- [-1355.678] (-1359.974) (-1383.556) (-1375.831) * (-1385.810) [-1356.497] (-1385.386) (-1356.552) -- 0:02:07
Average standard deviation of split frequencies: 0.013511
515500 -- [-1363.391] (-1375.897) (-1367.807) (-1385.977) * (-1373.330) [-1374.548] (-1387.080) (-1356.889) -- 0:02:06
516000 -- (-1387.104) [-1361.261] (-1382.795) (-1383.437) * (-1381.327) (-1385.313) (-1382.156) [-1358.220] -- 0:02:07
516500 -- (-1383.890) [-1375.516] (-1364.782) (-1371.493) * [-1373.812] (-1386.113) (-1382.357) (-1361.313) -- 0:02:07
517000 -- (-1372.022) (-1368.643) (-1374.690) [-1344.679] * (-1380.651) (-1375.136) (-1356.530) [-1367.331] -- 0:02:07
517500 -- (-1383.062) [-1366.994] (-1382.198) (-1373.666) * (-1376.020) (-1369.730) [-1360.021] (-1394.393) -- 0:02:06
518000 -- (-1390.668) (-1360.032) (-1377.837) [-1370.821] * (-1380.925) (-1373.071) [-1353.243] (-1356.890) -- 0:02:06
518500 -- (-1394.502) (-1374.702) (-1357.094) [-1370.467] * (-1381.917) (-1354.492) [-1354.432] (-1362.159) -- 0:02:06
519000 -- (-1393.611) (-1373.952) [-1368.367] (-1371.025) * (-1377.877) (-1379.665) [-1371.010] (-1368.055) -- 0:02:06
519500 -- (-1379.705) (-1352.064) [-1356.484] (-1371.000) * (-1380.748) (-1366.782) [-1369.888] (-1384.015) -- 0:02:05
520000 -- (-1379.382) [-1365.866] (-1358.161) (-1375.432) * (-1369.264) (-1385.932) [-1358.586] (-1380.121) -- 0:02:06
Average standard deviation of split frequencies: 0.012628
520500 -- (-1383.040) [-1354.194] (-1360.189) (-1374.701) * [-1350.664] (-1377.480) (-1376.222) (-1372.592) -- 0:02:06
521000 -- [-1357.269] (-1350.599) (-1361.598) (-1376.025) * (-1376.328) (-1379.966) (-1377.461) [-1372.533] -- 0:02:05
521500 -- (-1369.356) (-1358.525) [-1373.438] (-1351.428) * (-1379.100) [-1356.165] (-1381.713) (-1379.604) -- 0:02:05
522000 -- (-1378.085) [-1348.714] (-1356.021) (-1376.446) * [-1366.822] (-1356.056) (-1381.608) (-1380.778) -- 0:02:05
522500 -- (-1360.845) [-1355.866] (-1381.122) (-1373.196) * (-1349.971) [-1358.234] (-1383.573) (-1374.497) -- 0:02:05
523000 -- (-1353.324) [-1363.854] (-1382.155) (-1383.030) * [-1358.235] (-1366.590) (-1377.986) (-1383.870) -- 0:02:04
523500 -- [-1365.100] (-1358.989) (-1373.548) (-1372.763) * (-1361.086) (-1375.321) [-1362.889] (-1374.901) -- 0:02:04
524000 -- (-1367.779) [-1355.947] (-1367.002) (-1378.985) * (-1380.054) (-1372.492) [-1361.131] (-1376.060) -- 0:02:05
524500 -- (-1355.741) (-1356.565) [-1358.346] (-1380.300) * (-1383.800) (-1389.279) [-1364.958] (-1365.441) -- 0:02:05
525000 -- (-1375.149) [-1352.637] (-1384.676) (-1376.394) * (-1376.606) (-1359.189) (-1370.078) [-1362.385] -- 0:02:04
Average standard deviation of split frequencies: 0.012311
525500 -- (-1386.151) (-1369.718) (-1372.700) [-1377.239] * (-1382.862) [-1352.744] (-1366.896) (-1373.226) -- 0:02:04
526000 -- (-1381.770) (-1379.224) [-1347.580] (-1367.152) * (-1374.272) (-1366.463) (-1378.068) [-1370.431] -- 0:02:04
526500 -- (-1377.500) (-1367.887) [-1348.313] (-1382.957) * (-1378.992) (-1366.415) (-1366.107) [-1357.409] -- 0:02:04
527000 -- [-1352.812] (-1389.760) (-1366.713) (-1373.968) * (-1365.450) (-1383.622) (-1382.105) [-1369.945] -- 0:02:03
527500 -- [-1353.156] (-1383.732) (-1372.767) (-1389.505) * (-1382.231) (-1367.200) (-1381.852) [-1348.308] -- 0:02:04
528000 -- [-1360.390] (-1377.289) (-1363.868) (-1380.919) * (-1389.957) (-1373.657) (-1377.010) [-1380.686] -- 0:02:04
528500 -- [-1348.419] (-1381.671) (-1367.769) (-1385.742) * (-1376.870) [-1367.207] (-1368.735) (-1382.525) -- 0:02:04
529000 -- (-1362.275) (-1378.712) [-1356.578] (-1392.828) * (-1372.887) [-1365.989] (-1366.724) (-1375.469) -- 0:02:03
529500 -- (-1371.446) (-1389.273) [-1367.762] (-1386.576) * (-1379.236) (-1373.182) [-1370.365] (-1381.691) -- 0:02:03
530000 -- (-1380.043) (-1395.597) (-1366.742) [-1366.101] * (-1375.485) [-1369.186] (-1359.373) (-1372.796) -- 0:02:03
Average standard deviation of split frequencies: 0.011876
530500 -- (-1384.319) (-1362.351) (-1377.131) [-1366.046] * (-1379.696) [-1359.124] (-1366.925) (-1380.308) -- 0:02:03
531000 -- (-1390.265) [-1359.083] (-1377.532) (-1367.577) * (-1386.239) (-1371.381) [-1351.334] (-1372.633) -- 0:02:02
531500 -- (-1375.962) (-1353.656) (-1384.546) [-1351.238] * (-1370.104) (-1377.805) (-1364.059) [-1360.088] -- 0:02:03
532000 -- (-1384.891) [-1350.548] (-1371.439) (-1377.648) * (-1373.024) (-1371.459) (-1368.838) [-1367.010] -- 0:02:03
532500 -- (-1371.392) [-1357.642] (-1374.656) (-1392.301) * (-1387.374) (-1367.603) (-1380.113) [-1365.616] -- 0:02:02
533000 -- (-1366.619) (-1380.900) (-1378.855) [-1384.711] * (-1386.304) (-1362.852) (-1383.153) [-1340.176] -- 0:02:02
533500 -- (-1382.615) (-1380.766) (-1377.407) [-1371.229] * [-1353.879] (-1371.673) (-1391.043) (-1353.023) -- 0:02:02
534000 -- (-1378.959) (-1381.622) [-1379.824] (-1388.594) * (-1368.673) (-1370.310) (-1382.834) [-1352.896] -- 0:02:02
534500 -- (-1379.146) (-1378.037) [-1361.800] (-1368.614) * (-1372.150) (-1370.940) (-1382.590) [-1366.357] -- 0:02:01
535000 -- (-1377.980) [-1372.322] (-1358.573) (-1361.578) * (-1375.296) [-1357.665] (-1380.282) (-1347.633) -- 0:02:02
Average standard deviation of split frequencies: 0.011433
535500 -- (-1387.611) [-1352.133] (-1373.779) (-1387.218) * (-1380.899) (-1386.024) (-1391.314) [-1357.136] -- 0:02:02
536000 -- (-1387.879) [-1349.725] (-1360.108) (-1373.467) * [-1363.972] (-1370.961) (-1380.223) (-1376.915) -- 0:02:02
536500 -- (-1387.836) (-1363.058) [-1358.687] (-1385.245) * [-1353.833] (-1373.133) (-1383.617) (-1380.458) -- 0:02:01
537000 -- (-1372.724) [-1378.237] (-1392.450) (-1367.039) * [-1359.979] (-1376.107) (-1385.446) (-1378.734) -- 0:02:01
537500 -- (-1373.129) (-1372.424) [-1369.990] (-1370.503) * [-1358.458] (-1378.607) (-1385.177) (-1346.683) -- 0:02:01
538000 -- (-1383.624) (-1373.072) [-1361.173] (-1373.202) * [-1357.388] (-1373.955) (-1383.835) (-1373.708) -- 0:02:01
538500 -- (-1376.518) [-1344.152] (-1353.622) (-1354.772) * [-1352.204] (-1382.435) (-1355.944) (-1368.573) -- 0:02:00
539000 -- (-1390.849) [-1346.329] (-1363.091) (-1363.607) * (-1382.508) (-1381.548) (-1377.605) [-1370.000] -- 0:02:01
539500 -- (-1375.571) [-1351.340] (-1376.429) (-1372.214) * (-1378.018) (-1372.702) [-1350.638] (-1368.386) -- 0:02:01
540000 -- (-1379.403) (-1370.667) (-1383.482) [-1361.277] * (-1371.378) (-1377.767) [-1349.983] (-1366.918) -- 0:02:00
Average standard deviation of split frequencies: 0.011610
540500 -- (-1372.997) (-1385.134) (-1377.895) [-1364.663] * (-1380.483) [-1362.289] (-1369.963) (-1381.490) -- 0:02:00
541000 -- (-1373.263) (-1390.282) (-1369.117) [-1353.467] * (-1379.514) (-1372.646) [-1359.070] (-1394.254) -- 0:02:00
541500 -- [-1353.085] (-1387.853) (-1364.525) (-1364.547) * [-1349.984] (-1375.116) (-1364.953) (-1382.482) -- 0:02:00
542000 -- [-1356.278] (-1384.368) (-1373.904) (-1365.550) * (-1367.880) (-1370.138) [-1357.521] (-1380.189) -- 0:01:59
542500 -- [-1346.191] (-1377.324) (-1374.863) (-1358.215) * (-1373.978) (-1368.139) [-1361.875] (-1383.958) -- 0:01:59
543000 -- [-1351.287] (-1372.388) (-1374.554) (-1373.866) * (-1382.007) (-1380.713) [-1366.670] (-1365.941) -- 0:02:00
543500 -- [-1348.704] (-1370.954) (-1373.718) (-1380.742) * (-1365.276) (-1380.884) (-1377.342) [-1357.880] -- 0:02:00
544000 -- [-1370.005] (-1367.695) (-1368.541) (-1394.607) * (-1375.667) (-1382.969) (-1377.737) [-1358.852] -- 0:01:59
544500 -- (-1370.741) [-1365.938] (-1361.710) (-1391.186) * (-1365.610) (-1368.642) (-1386.533) [-1334.754] -- 0:01:59
545000 -- (-1387.337) [-1371.712] (-1361.568) (-1387.492) * [-1363.784] (-1376.766) (-1365.746) (-1351.608) -- 0:01:59
Average standard deviation of split frequencies: 0.011769
545500 -- (-1384.295) [-1368.577] (-1363.697) (-1386.315) * (-1373.769) (-1385.589) (-1357.011) [-1347.073] -- 0:01:59
546000 -- (-1394.822) [-1350.573] (-1373.625) (-1394.471) * (-1372.653) (-1376.538) (-1367.116) [-1355.704] -- 0:01:58
546500 -- (-1388.669) [-1367.298] (-1373.252) (-1385.184) * (-1375.571) (-1378.705) (-1361.197) [-1357.897] -- 0:01:59
547000 -- (-1375.744) [-1366.317] (-1374.695) (-1387.889) * (-1373.654) (-1378.693) [-1359.311] (-1360.784) -- 0:01:59
547500 -- (-1363.891) [-1351.746] (-1380.856) (-1389.411) * (-1372.000) (-1371.946) (-1363.711) [-1368.380] -- 0:01:59
548000 -- (-1377.911) [-1352.180] (-1367.019) (-1383.774) * (-1379.100) (-1375.724) (-1358.107) [-1366.605] -- 0:01:58
548500 -- (-1383.382) [-1368.804] (-1381.325) (-1388.190) * (-1377.814) (-1388.992) (-1357.296) [-1346.654] -- 0:01:58
549000 -- (-1386.765) [-1359.761] (-1376.494) (-1382.633) * (-1373.709) (-1377.449) (-1351.456) [-1359.787] -- 0:01:58
549500 -- (-1376.516) [-1350.875] (-1365.249) (-1379.435) * [-1371.126] (-1361.343) (-1352.165) (-1375.229) -- 0:01:58
550000 -- (-1375.826) (-1356.242) [-1356.824] (-1353.178) * (-1367.682) (-1377.250) [-1353.876] (-1378.298) -- 0:01:57
Average standard deviation of split frequencies: 0.011219
550500 -- (-1374.355) (-1374.976) [-1350.970] (-1366.878) * (-1389.746) (-1366.972) [-1360.193] (-1366.389) -- 0:01:58
551000 -- (-1375.897) (-1376.059) (-1388.327) [-1348.254] * (-1382.953) [-1366.061] (-1368.207) (-1356.641) -- 0:01:58
551500 -- (-1372.083) (-1366.715) (-1385.960) [-1360.224] * (-1383.944) (-1367.035) (-1378.343) [-1369.610] -- 0:01:57
552000 -- (-1376.558) (-1367.504) (-1381.135) [-1342.793] * (-1369.380) (-1373.542) [-1359.200] (-1380.087) -- 0:01:57
552500 -- [-1375.925] (-1380.459) (-1373.351) (-1380.982) * [-1366.196] (-1382.840) (-1362.636) (-1370.240) -- 0:01:57
553000 -- (-1376.731) (-1369.229) (-1384.249) [-1348.835] * (-1368.964) (-1371.759) [-1366.041] (-1365.739) -- 0:01:57
553500 -- (-1374.703) [-1359.961] (-1386.659) (-1363.640) * (-1370.844) (-1373.200) [-1366.970] (-1382.010) -- 0:01:56
554000 -- [-1363.220] (-1374.239) (-1378.970) (-1350.156) * (-1381.787) (-1377.169) (-1376.580) [-1362.765] -- 0:01:56
554500 -- (-1376.675) (-1385.709) (-1377.821) [-1349.656] * (-1372.476) (-1372.411) [-1347.372] (-1374.624) -- 0:01:57
555000 -- (-1364.327) (-1373.732) (-1371.419) [-1346.534] * (-1388.145) [-1346.384] (-1386.847) (-1373.631) -- 0:01:57
Average standard deviation of split frequencies: 0.011067
555500 -- [-1356.580] (-1370.007) (-1371.208) (-1370.898) * [-1353.602] (-1351.989) (-1371.421) (-1369.213) -- 0:01:56
556000 -- [-1357.836] (-1367.336) (-1382.014) (-1372.500) * (-1370.721) [-1350.155] (-1372.102) (-1375.318) -- 0:01:56
556500 -- (-1382.360) (-1377.620) [-1353.894] (-1370.487) * (-1370.893) (-1375.395) [-1356.567] (-1384.441) -- 0:01:56
557000 -- (-1386.947) (-1382.096) [-1364.730] (-1371.502) * (-1366.289) (-1362.912) [-1356.670] (-1376.520) -- 0:01:56
557500 -- (-1373.423) (-1360.118) [-1361.954] (-1373.564) * (-1385.358) (-1375.637) [-1373.123] (-1375.398) -- 0:01:55
558000 -- (-1382.709) (-1379.484) [-1361.417] (-1363.474) * (-1379.618) (-1363.025) [-1352.071] (-1373.468) -- 0:01:55
558500 -- (-1381.110) [-1373.876] (-1374.113) (-1364.707) * [-1359.669] (-1362.589) (-1386.613) (-1382.967) -- 0:01:56
559000 -- (-1390.693) (-1376.073) [-1354.034] (-1363.926) * (-1347.790) [-1361.666] (-1368.434) (-1379.791) -- 0:01:55
559500 -- (-1378.985) (-1376.036) [-1347.651] (-1357.871) * (-1354.830) (-1373.883) [-1365.296] (-1387.446) -- 0:01:55
560000 -- (-1385.109) (-1380.726) [-1360.308] (-1363.934) * (-1354.314) (-1386.792) (-1371.058) [-1375.748] -- 0:01:55
Average standard deviation of split frequencies: 0.012486
560500 -- (-1386.984) (-1371.300) [-1367.792] (-1371.340) * [-1353.351] (-1382.123) (-1382.817) (-1374.808) -- 0:01:55
561000 -- (-1385.569) (-1388.446) [-1351.998] (-1367.761) * [-1363.064] (-1373.779) (-1376.630) (-1377.329) -- 0:01:55
561500 -- (-1381.806) (-1381.435) [-1350.811] (-1370.290) * [-1360.688] (-1364.728) (-1388.445) (-1370.395) -- 0:01:54
562000 -- (-1377.391) (-1364.681) [-1352.512] (-1364.735) * (-1365.728) (-1384.742) (-1384.932) [-1375.355] -- 0:01:55
562500 -- (-1374.472) (-1378.738) (-1378.516) [-1362.555] * (-1340.601) (-1388.654) (-1390.114) [-1356.310] -- 0:01:55
563000 -- (-1363.888) (-1372.602) (-1381.643) [-1342.075] * [-1369.205] (-1383.470) (-1389.782) (-1376.444) -- 0:01:54
563500 -- (-1360.706) (-1388.054) (-1371.030) [-1339.968] * [-1364.014] (-1383.539) (-1369.907) (-1388.134) -- 0:01:54
564000 -- (-1362.902) [-1373.598] (-1383.026) (-1349.175) * (-1371.434) [-1358.575] (-1389.621) (-1364.621) -- 0:01:54
564500 -- (-1357.448) (-1382.331) (-1374.655) [-1349.084] * [-1357.673] (-1395.992) (-1368.766) (-1341.806) -- 0:01:54
565000 -- [-1357.074] (-1389.001) (-1377.926) (-1356.520) * (-1361.969) (-1380.223) (-1365.481) [-1346.575] -- 0:01:53
Average standard deviation of split frequencies: 0.012410
565500 -- (-1362.886) (-1380.989) (-1363.957) [-1342.907] * (-1373.272) (-1383.071) [-1372.156] (-1370.304) -- 0:01:53
566000 -- [-1368.801] (-1385.166) (-1373.126) (-1368.359) * [-1345.489] (-1373.977) (-1381.956) (-1358.678) -- 0:01:54
566500 -- (-1367.968) (-1384.680) [-1365.589] (-1367.272) * (-1380.511) (-1372.433) (-1374.372) [-1356.260] -- 0:01:54
567000 -- (-1363.579) (-1379.751) [-1353.060] (-1377.406) * (-1375.857) (-1356.174) (-1372.703) [-1345.739] -- 0:01:53
567500 -- (-1358.629) (-1388.446) [-1354.737] (-1377.848) * (-1383.922) (-1350.184) (-1380.918) [-1352.996] -- 0:01:53
568000 -- (-1385.307) (-1376.051) (-1386.218) [-1354.232] * (-1390.339) [-1353.675] (-1359.102) (-1348.224) -- 0:01:53
568500 -- (-1391.828) (-1368.189) (-1375.683) [-1341.434] * (-1369.745) (-1369.451) (-1379.488) [-1359.544] -- 0:01:53
569000 -- (-1373.263) (-1375.543) (-1368.305) [-1360.358] * (-1381.708) [-1376.136] (-1383.769) (-1367.783) -- 0:01:52
569500 -- (-1385.759) (-1382.581) (-1393.412) [-1346.487] * [-1372.598] (-1375.812) (-1382.117) (-1365.193) -- 0:01:53
570000 -- (-1384.352) [-1348.188] (-1386.828) (-1351.177) * (-1379.461) [-1372.248] (-1372.945) (-1374.036) -- 0:01:53
Average standard deviation of split frequencies: 0.011482
570500 -- (-1385.502) [-1346.771] (-1396.846) (-1370.174) * (-1383.994) (-1378.927) (-1392.308) [-1373.512] -- 0:01:52
571000 -- (-1394.679) (-1380.013) [-1364.130] (-1372.198) * [-1358.490] (-1379.503) (-1365.981) (-1374.770) -- 0:01:52
571500 -- (-1398.333) [-1363.276] (-1379.259) (-1363.593) * [-1349.900] (-1369.794) (-1374.684) (-1379.580) -- 0:01:52
572000 -- (-1374.020) [-1358.602] (-1378.252) (-1377.570) * (-1369.816) [-1359.524] (-1382.071) (-1379.817) -- 0:01:52
572500 -- (-1358.772) [-1364.179] (-1395.869) (-1384.031) * [-1355.086] (-1368.852) (-1374.342) (-1383.472) -- 0:01:52
573000 -- (-1358.352) [-1368.189] (-1383.710) (-1384.840) * (-1369.085) (-1377.501) [-1357.301] (-1383.007) -- 0:01:51
573500 -- (-1379.066) (-1377.741) (-1367.307) [-1374.726] * [-1357.939] (-1374.133) (-1371.865) (-1386.282) -- 0:01:52
574000 -- [-1369.734] (-1378.800) (-1355.884) (-1389.432) * (-1375.295) [-1354.554] (-1381.947) (-1373.715) -- 0:01:52
574500 -- (-1374.989) (-1380.894) [-1352.966] (-1380.924) * (-1369.140) (-1364.427) (-1398.076) [-1359.063] -- 0:01:51
575000 -- (-1394.602) (-1386.472) [-1356.952] (-1384.044) * [-1361.213] (-1384.561) (-1380.255) (-1381.075) -- 0:01:51
Average standard deviation of split frequencies: 0.010926
575500 -- (-1389.004) (-1372.556) (-1356.124) [-1359.509] * (-1364.382) (-1361.158) (-1373.320) [-1364.587] -- 0:01:51
576000 -- (-1374.685) (-1358.401) [-1351.152] (-1372.296) * (-1356.676) (-1379.232) (-1376.830) [-1366.433] -- 0:01:51
576500 -- (-1369.553) [-1366.024] (-1362.467) (-1360.752) * (-1365.112) (-1376.911) (-1384.592) [-1362.089] -- 0:01:50
577000 -- (-1365.362) (-1363.084) (-1389.619) [-1354.048] * [-1359.747] (-1368.255) (-1379.293) (-1376.706) -- 0:01:50
577500 -- (-1383.488) (-1375.845) (-1380.153) [-1346.631] * (-1376.554) [-1355.393] (-1381.953) (-1366.831) -- 0:01:51
578000 -- (-1357.556) (-1386.014) (-1387.955) [-1360.942] * (-1367.155) [-1352.835] (-1383.718) (-1373.142) -- 0:01:50
578500 -- (-1377.854) (-1362.838) (-1396.595) [-1359.014] * (-1379.893) [-1350.555] (-1377.986) (-1373.812) -- 0:01:50
579000 -- [-1368.012] (-1353.394) (-1379.372) (-1360.895) * (-1392.438) (-1350.247) [-1362.090] (-1380.407) -- 0:01:50
579500 -- [-1371.492] (-1385.637) (-1378.178) (-1372.660) * (-1387.092) [-1345.934] (-1368.781) (-1375.881) -- 0:01:50
580000 -- (-1389.734) [-1366.526] (-1373.596) (-1376.868) * (-1377.611) [-1348.256] (-1375.653) (-1380.895) -- 0:01:50
Average standard deviation of split frequencies: 0.009998
580500 -- (-1386.027) (-1354.882) (-1363.604) [-1360.309] * (-1377.634) [-1346.370] (-1384.499) (-1377.987) -- 0:01:49
581000 -- (-1364.751) (-1373.857) [-1351.750] (-1380.012) * (-1371.598) [-1341.797] (-1376.775) (-1384.840) -- 0:01:50
581500 -- [-1368.642] (-1381.299) (-1376.577) (-1379.333) * (-1372.705) [-1347.243] (-1377.567) (-1355.737) -- 0:01:50
582000 -- [-1354.717] (-1380.788) (-1354.898) (-1370.226) * (-1365.947) (-1364.345) (-1382.755) [-1345.706] -- 0:01:49
582500 -- [-1370.296] (-1388.111) (-1374.095) (-1364.533) * (-1381.893) [-1351.554] (-1386.551) (-1379.044) -- 0:01:49
583000 -- (-1360.496) (-1387.528) [-1338.177] (-1380.429) * (-1383.273) [-1348.119] (-1371.436) (-1381.789) -- 0:01:49
583500 -- (-1360.292) (-1380.543) [-1360.175] (-1371.881) * (-1396.848) [-1357.279] (-1363.461) (-1380.523) -- 0:01:49
584000 -- (-1360.563) (-1391.772) [-1364.615] (-1374.423) * (-1361.404) [-1362.880] (-1372.416) (-1385.002) -- 0:01:48
584500 -- [-1355.366] (-1373.618) (-1354.553) (-1380.562) * (-1374.750) [-1352.112] (-1390.712) (-1385.703) -- 0:01:48
585000 -- (-1364.299) [-1364.058] (-1357.914) (-1378.821) * (-1366.831) [-1351.815] (-1379.444) (-1374.341) -- 0:01:49
Average standard deviation of split frequencies: 0.010161
585500 -- (-1354.369) (-1365.319) [-1360.033] (-1380.294) * [-1366.612] (-1368.755) (-1379.676) (-1381.849) -- 0:01:49
586000 -- [-1345.417] (-1364.329) (-1369.129) (-1381.963) * (-1358.640) [-1374.074] (-1376.244) (-1387.193) -- 0:01:48
586500 -- [-1355.225] (-1352.524) (-1363.089) (-1376.513) * (-1362.361) (-1380.267) [-1362.019] (-1382.737) -- 0:01:48
587000 -- (-1375.924) (-1371.582) [-1362.608] (-1377.178) * [-1359.899] (-1384.188) (-1386.885) (-1385.435) -- 0:01:48
587500 -- (-1389.096) (-1365.781) [-1340.121] (-1366.644) * (-1366.780) (-1379.422) [-1381.477] (-1379.884) -- 0:01:48
588000 -- (-1382.071) (-1363.748) [-1355.441] (-1376.227) * [-1351.687] (-1382.231) (-1371.572) (-1388.939) -- 0:01:47
588500 -- (-1388.644) [-1363.056] (-1372.436) (-1387.384) * (-1365.142) (-1375.436) (-1383.040) [-1379.656] -- 0:01:48
589000 -- (-1383.319) (-1370.857) (-1385.476) [-1370.691] * (-1367.301) (-1373.675) (-1383.256) [-1355.482] -- 0:01:48
589500 -- (-1381.605) (-1372.218) (-1367.350) [-1365.238] * [-1368.529] (-1375.631) (-1386.459) (-1359.835) -- 0:01:47
590000 -- (-1381.752) (-1373.879) (-1377.125) [-1353.985] * (-1362.643) (-1372.062) (-1385.399) [-1355.327] -- 0:01:47
Average standard deviation of split frequencies: 0.010711
590500 -- (-1386.904) [-1361.776] (-1372.891) (-1384.085) * [-1361.646] (-1382.697) (-1378.708) (-1369.918) -- 0:01:47
591000 -- (-1372.038) [-1371.017] (-1379.459) (-1374.519) * (-1360.845) (-1382.792) (-1386.922) [-1375.820] -- 0:01:47
591500 -- (-1375.192) (-1377.378) [-1358.262] (-1380.712) * [-1368.776] (-1367.787) (-1384.467) (-1386.283) -- 0:01:47
592000 -- (-1371.524) [-1373.238] (-1371.199) (-1365.326) * [-1367.535] (-1372.210) (-1381.905) (-1382.148) -- 0:01:46
592500 -- [-1353.560] (-1368.372) (-1379.040) (-1385.554) * (-1381.457) (-1378.618) (-1366.705) [-1371.342] -- 0:01:47
593000 -- [-1347.916] (-1368.951) (-1371.517) (-1386.817) * [-1361.994] (-1368.224) (-1374.861) (-1381.344) -- 0:01:47
593500 -- (-1372.942) [-1363.771] (-1370.458) (-1388.908) * [-1357.629] (-1377.282) (-1365.735) (-1374.012) -- 0:01:46
594000 -- (-1385.319) [-1349.799] (-1378.529) (-1384.336) * [-1357.929] (-1373.314) (-1366.438) (-1390.791) -- 0:01:46
594500 -- [-1361.969] (-1366.029) (-1366.619) (-1374.405) * (-1369.272) (-1378.738) [-1370.232] (-1391.940) -- 0:01:46
595000 -- (-1360.498) (-1363.824) (-1373.450) [-1357.174] * [-1368.635] (-1385.659) (-1376.778) (-1372.590) -- 0:01:46
Average standard deviation of split frequencies: 0.010876
595500 -- (-1377.613) (-1345.798) [-1363.197] (-1375.315) * [-1363.632] (-1379.886) (-1357.897) (-1379.928) -- 0:01:45
596000 -- [-1378.559] (-1367.802) (-1359.175) (-1371.925) * [-1358.761] (-1374.135) (-1381.192) (-1372.493) -- 0:01:45
596500 -- (-1368.859) [-1347.593] (-1374.997) (-1376.303) * [-1351.744] (-1367.336) (-1383.369) (-1378.364) -- 0:01:46
597000 -- (-1400.586) [-1351.956] (-1365.345) (-1385.093) * [-1356.269] (-1357.907) (-1388.097) (-1372.375) -- 0:01:45
597500 -- (-1386.919) (-1373.100) [-1356.630] (-1372.200) * [-1358.147] (-1385.526) (-1381.064) (-1359.152) -- 0:01:45
598000 -- (-1392.931) (-1375.546) [-1352.168] (-1370.556) * (-1368.626) (-1375.413) (-1381.941) [-1350.617] -- 0:01:45
598500 -- (-1379.327) (-1368.250) [-1345.369] (-1381.408) * (-1385.527) (-1363.028) (-1378.334) [-1353.086] -- 0:01:45
599000 -- (-1379.287) (-1367.284) (-1365.753) [-1364.327] * (-1383.246) (-1375.054) (-1381.328) [-1362.947] -- 0:01:45
599500 -- (-1365.733) (-1378.010) (-1363.830) [-1364.049] * (-1379.498) (-1364.545) (-1368.228) [-1359.285] -- 0:01:44
600000 -- (-1386.177) (-1394.967) [-1360.700] (-1367.694) * (-1385.531) [-1359.656] (-1367.362) (-1383.923) -- 0:01:45
Average standard deviation of split frequencies: 0.011029
600500 -- (-1380.535) (-1384.660) [-1353.378] (-1365.834) * (-1373.855) (-1361.801) [-1348.687] (-1382.057) -- 0:01:45
601000 -- (-1389.965) (-1388.850) [-1358.536] (-1365.267) * (-1373.830) [-1352.448] (-1375.952) (-1381.132) -- 0:01:44
601500 -- (-1383.588) (-1381.313) (-1364.611) [-1360.197] * [-1366.395] (-1360.722) (-1380.980) (-1379.687) -- 0:01:44
602000 -- (-1372.635) (-1386.592) (-1378.685) [-1355.910] * [-1359.731] (-1357.409) (-1374.878) (-1380.402) -- 0:01:44
602500 -- [-1372.048] (-1383.509) (-1376.535) (-1372.659) * [-1364.132] (-1370.194) (-1385.417) (-1375.016) -- 0:01:44
603000 -- [-1368.604] (-1368.224) (-1380.329) (-1372.838) * (-1368.050) (-1361.429) (-1380.279) [-1368.110] -- 0:01:44
603500 -- (-1386.682) [-1357.261] (-1377.110) (-1381.905) * [-1362.485] (-1367.150) (-1372.180) (-1384.379) -- 0:01:43
604000 -- (-1386.163) [-1364.744] (-1360.536) (-1406.652) * (-1381.299) (-1364.040) [-1365.885] (-1386.986) -- 0:01:44
604500 -- (-1392.915) (-1375.354) [-1364.560] (-1385.280) * [-1372.368] (-1371.101) (-1380.084) (-1382.575) -- 0:01:44
605000 -- (-1377.132) (-1370.966) [-1355.752] (-1381.243) * (-1386.392) (-1380.484) [-1369.925] (-1372.835) -- 0:01:43
Average standard deviation of split frequencies: 0.010190
605500 -- (-1364.794) (-1377.173) (-1383.211) [-1372.634] * (-1379.480) (-1365.329) [-1364.478] (-1369.619) -- 0:01:43
606000 -- [-1365.319] (-1391.753) (-1383.439) (-1379.581) * [-1364.636] (-1373.710) (-1367.141) (-1377.653) -- 0:01:43
606500 -- (-1366.906) (-1386.103) [-1367.808] (-1390.411) * (-1382.815) (-1369.542) (-1383.249) [-1357.545] -- 0:01:43
607000 -- [-1351.269] (-1382.973) (-1366.953) (-1377.106) * (-1366.466) [-1363.418] (-1378.315) (-1376.783) -- 0:01:42
607500 -- (-1378.698) [-1373.410] (-1336.387) (-1367.821) * (-1368.725) (-1366.277) [-1368.752] (-1390.046) -- 0:01:43
608000 -- [-1361.687] (-1375.792) (-1371.145) (-1379.542) * (-1371.953) [-1352.640] (-1380.324) (-1384.779) -- 0:01:43
608500 -- (-1374.350) (-1365.057) (-1361.505) [-1379.345] * (-1364.579) [-1356.819] (-1376.969) (-1363.333) -- 0:01:42
609000 -- [-1363.732] (-1378.502) (-1366.987) (-1396.695) * (-1379.887) [-1365.355] (-1376.916) (-1361.541) -- 0:01:42
609500 -- (-1356.789) (-1387.035) [-1374.675] (-1377.172) * [-1361.315] (-1361.168) (-1363.186) (-1372.735) -- 0:01:42
610000 -- (-1371.400) (-1378.488) [-1364.346] (-1366.899) * (-1379.681) (-1368.577) (-1371.940) [-1364.767] -- 0:01:42
Average standard deviation of split frequencies: 0.010198
610500 -- (-1367.743) (-1387.594) [-1348.750] (-1365.297) * (-1368.141) (-1343.247) (-1371.226) [-1348.059] -- 0:01:42
611000 -- [-1360.490] (-1374.051) (-1353.303) (-1378.925) * (-1382.655) (-1357.609) (-1371.499) [-1348.428] -- 0:01:41
611500 -- (-1369.247) (-1389.832) [-1357.746] (-1377.101) * (-1388.530) (-1375.253) (-1374.023) [-1355.286] -- 0:01:42
612000 -- (-1377.014) [-1381.414] (-1364.067) (-1378.292) * (-1369.739) (-1359.138) (-1382.315) [-1346.752] -- 0:01:42
612500 -- (-1376.838) (-1377.026) [-1357.572] (-1392.023) * (-1377.251) [-1351.965] (-1392.485) (-1364.365) -- 0:01:41
613000 -- (-1376.260) (-1384.170) [-1341.477] (-1376.550) * (-1382.120) (-1346.630) (-1373.250) [-1342.680] -- 0:01:41
613500 -- (-1378.478) (-1383.071) (-1353.379) [-1364.486] * (-1360.196) [-1345.442] (-1383.491) (-1360.667) -- 0:01:41
614000 -- [-1366.287] (-1377.258) (-1376.707) (-1383.208) * (-1369.402) (-1366.480) (-1378.450) [-1350.905] -- 0:01:41
614500 -- [-1372.512] (-1375.448) (-1378.705) (-1366.648) * [-1353.647] (-1369.596) (-1389.866) (-1370.719) -- 0:01:41
615000 -- [-1369.492] (-1373.723) (-1376.559) (-1373.192) * (-1355.983) (-1374.387) (-1389.761) [-1373.488] -- 0:01:40
Average standard deviation of split frequencies: 0.009787
615500 -- [-1363.527] (-1369.899) (-1380.849) (-1375.086) * [-1356.589] (-1379.218) (-1388.123) (-1364.505) -- 0:01:41
616000 -- (-1362.667) (-1366.233) [-1373.611] (-1383.282) * (-1359.606) (-1393.878) (-1388.742) [-1341.475] -- 0:01:40
616500 -- [-1370.316] (-1365.633) (-1378.741) (-1378.973) * [-1361.718] (-1387.550) (-1375.830) (-1357.026) -- 0:01:40
617000 -- [-1362.226] (-1369.323) (-1382.299) (-1385.434) * (-1381.517) [-1366.503] (-1380.019) (-1368.598) -- 0:01:40
617500 -- (-1377.402) [-1372.832] (-1382.788) (-1372.821) * (-1372.024) (-1384.067) (-1387.941) [-1349.693] -- 0:01:40
618000 -- (-1391.169) [-1352.198] (-1376.310) (-1389.029) * (-1375.520) (-1374.969) (-1377.236) [-1354.132] -- 0:01:40
618500 -- (-1375.431) [-1342.571] (-1367.792) (-1371.314) * (-1372.510) (-1385.420) [-1371.519] (-1347.842) -- 0:01:39
619000 -- (-1383.464) [-1359.430] (-1359.868) (-1360.782) * (-1363.791) (-1386.741) (-1372.889) [-1362.115] -- 0:01:39
619500 -- (-1384.215) (-1350.295) (-1377.764) [-1363.358] * [-1357.468] (-1383.690) (-1376.466) (-1375.487) -- 0:01:40
620000 -- (-1379.637) [-1347.620] (-1381.209) (-1373.816) * (-1369.766) (-1381.354) [-1367.459] (-1374.968) -- 0:01:39
Average standard deviation of split frequencies: 0.009914
620500 -- [-1380.815] (-1371.339) (-1395.870) (-1377.438) * [-1362.643] (-1374.627) (-1370.381) (-1363.891) -- 0:01:39
621000 -- (-1382.831) [-1355.155] (-1379.022) (-1373.653) * (-1372.141) [-1369.611] (-1365.578) (-1352.794) -- 0:01:39
621500 -- (-1381.967) [-1360.638] (-1381.322) (-1385.794) * (-1383.060) (-1356.534) (-1360.576) [-1356.659] -- 0:01:39
622000 -- (-1388.260) [-1350.105] (-1382.846) (-1368.935) * (-1368.054) (-1372.712) (-1354.066) [-1348.992] -- 0:01:39
622500 -- (-1386.285) [-1357.108] (-1370.273) (-1376.187) * (-1383.071) (-1351.751) [-1369.304] (-1373.643) -- 0:01:38
623000 -- (-1378.979) [-1365.195] (-1368.222) (-1373.762) * (-1383.609) [-1344.288] (-1370.813) (-1363.151) -- 0:01:39
623500 -- (-1390.497) [-1363.047] (-1367.940) (-1380.652) * (-1362.381) [-1361.432] (-1372.477) (-1378.646) -- 0:01:39
624000 -- [-1369.612] (-1370.961) (-1367.248) (-1379.265) * [-1353.596] (-1355.693) (-1376.868) (-1373.853) -- 0:01:38
624500 -- [-1373.913] (-1378.785) (-1372.718) (-1393.351) * [-1355.679] (-1363.097) (-1371.641) (-1395.351) -- 0:01:38
625000 -- (-1370.228) (-1377.796) [-1375.069] (-1393.363) * (-1391.782) [-1358.214] (-1390.045) (-1365.353) -- 0:01:38
Average standard deviation of split frequencies: 0.009413
625500 -- [-1371.694] (-1379.250) (-1376.062) (-1377.463) * (-1381.580) [-1354.008] (-1368.673) (-1388.691) -- 0:01:38
626000 -- [-1348.433] (-1375.892) (-1383.034) (-1369.192) * (-1381.334) [-1376.601] (-1387.780) (-1360.504) -- 0:01:37
626500 -- (-1365.674) [-1361.295] (-1382.847) (-1351.911) * (-1378.530) (-1375.954) (-1383.210) [-1362.542] -- 0:01:37
627000 -- (-1387.890) (-1359.638) (-1376.930) [-1351.064] * (-1385.641) [-1363.346] (-1374.982) (-1361.888) -- 0:01:38
627500 -- (-1382.823) (-1348.862) (-1374.719) [-1355.944] * (-1386.724) (-1376.388) [-1348.265] (-1373.545) -- 0:01:37
628000 -- (-1390.111) (-1365.740) (-1376.636) [-1356.981] * [-1342.173] (-1363.555) (-1390.010) (-1371.895) -- 0:01:37
628500 -- (-1378.904) (-1370.448) (-1378.237) [-1365.603] * [-1358.993] (-1357.594) (-1375.371) (-1370.204) -- 0:01:37
629000 -- (-1387.869) (-1382.198) (-1381.034) [-1361.994] * [-1366.947] (-1365.950) (-1378.240) (-1376.772) -- 0:01:37
629500 -- (-1370.186) (-1377.343) (-1381.542) [-1352.531] * [-1350.675] (-1371.953) (-1371.403) (-1380.619) -- 0:01:37
630000 -- (-1389.334) (-1378.884) (-1388.360) [-1352.804] * [-1351.889] (-1362.405) (-1378.600) (-1386.111) -- 0:01:36
Average standard deviation of split frequencies: 0.009343
630500 -- (-1375.749) (-1374.454) (-1383.165) [-1365.273] * [-1356.521] (-1356.175) (-1392.731) (-1376.910) -- 0:01:37
631000 -- (-1361.078) (-1368.632) (-1383.248) [-1361.252] * [-1356.712] (-1380.573) (-1369.592) (-1382.036) -- 0:01:37
631500 -- [-1369.486] (-1367.514) (-1391.377) (-1378.943) * [-1358.053] (-1380.696) (-1385.174) (-1375.705) -- 0:01:36
632000 -- (-1376.906) [-1367.945] (-1395.336) (-1382.419) * (-1373.825) [-1358.299] (-1372.197) (-1392.742) -- 0:01:36
632500 -- (-1369.717) [-1353.318] (-1377.303) (-1381.043) * (-1368.673) [-1361.185] (-1363.079) (-1391.160) -- 0:01:36
633000 -- [-1362.739] (-1359.455) (-1371.310) (-1386.261) * (-1378.819) (-1376.077) [-1360.022] (-1371.989) -- 0:01:36
633500 -- (-1377.644) [-1355.989] (-1357.310) (-1386.529) * (-1371.968) (-1355.795) (-1364.477) [-1363.042] -- 0:01:36
634000 -- (-1376.685) (-1355.816) [-1362.386] (-1390.120) * (-1388.271) [-1367.732] (-1367.591) (-1379.767) -- 0:01:35
634500 -- (-1388.359) [-1362.474] (-1375.673) (-1387.300) * (-1382.477) (-1378.118) [-1366.470] (-1373.181) -- 0:01:36
635000 -- (-1376.774) (-1364.530) [-1353.673] (-1387.937) * (-1381.995) (-1390.095) [-1362.368] (-1346.797) -- 0:01:35
Average standard deviation of split frequencies: 0.008931
635500 -- (-1379.929) (-1350.991) (-1390.460) [-1370.319] * (-1383.652) (-1381.910) [-1358.753] (-1343.450) -- 0:01:35
636000 -- (-1388.419) [-1362.266] (-1380.617) (-1364.296) * (-1392.102) (-1368.361) (-1377.931) [-1366.300] -- 0:01:35
636500 -- (-1382.143) (-1365.463) [-1373.943] (-1366.443) * (-1386.501) (-1373.729) (-1363.550) [-1340.868] -- 0:01:35
637000 -- (-1372.242) (-1373.331) (-1370.863) [-1363.806] * (-1389.219) (-1383.675) (-1376.189) [-1349.348] -- 0:01:35
637500 -- [-1350.560] (-1394.570) (-1366.479) (-1375.430) * (-1392.152) (-1385.310) (-1360.710) [-1351.579] -- 0:01:34
638000 -- (-1357.474) (-1377.032) [-1361.720] (-1381.911) * (-1377.030) (-1381.083) (-1366.749) [-1356.898] -- 0:01:34
638500 -- [-1357.503] (-1379.037) (-1374.089) (-1384.567) * (-1378.969) (-1388.408) (-1368.871) [-1354.669] -- 0:01:35
639000 -- [-1365.279] (-1384.035) (-1362.771) (-1373.230) * (-1391.271) [-1367.456] (-1387.286) (-1358.067) -- 0:01:34
639500 -- (-1361.548) (-1378.446) (-1360.755) [-1348.678] * (-1375.320) (-1366.632) (-1375.472) [-1362.446] -- 0:01:34
640000 -- [-1364.046] (-1369.758) (-1376.667) (-1367.078) * [-1367.219] (-1387.831) (-1377.509) (-1385.270) -- 0:01:34
Average standard deviation of split frequencies: 0.008425
640500 -- (-1368.827) [-1354.231] (-1371.717) (-1362.399) * [-1346.074] (-1375.375) (-1388.168) (-1380.341) -- 0:01:34
641000 -- (-1363.066) [-1367.810] (-1384.793) (-1385.598) * [-1352.775] (-1376.066) (-1369.451) (-1389.073) -- 0:01:34
641500 -- (-1358.365) (-1370.953) (-1372.162) [-1375.883] * [-1355.083] (-1378.717) (-1373.625) (-1373.388) -- 0:01:33
642000 -- [-1346.868] (-1364.252) (-1383.532) (-1380.887) * (-1357.666) (-1373.717) [-1363.556] (-1383.020) -- 0:01:34
642500 -- (-1345.037) [-1359.917] (-1381.137) (-1377.584) * [-1368.897] (-1362.251) (-1371.818) (-1389.102) -- 0:01:34
643000 -- [-1347.736] (-1367.971) (-1366.197) (-1391.925) * (-1361.990) (-1364.406) [-1360.016] (-1382.082) -- 0:01:33
643500 -- [-1351.680] (-1367.680) (-1375.356) (-1384.651) * (-1372.030) [-1362.957] (-1365.306) (-1383.101) -- 0:01:33
644000 -- (-1351.637) [-1361.028] (-1374.316) (-1382.646) * (-1373.991) (-1376.951) [-1381.439] (-1382.011) -- 0:01:33
644500 -- [-1341.298] (-1360.274) (-1384.860) (-1377.769) * (-1387.243) (-1358.340) [-1355.063] (-1386.955) -- 0:01:33
645000 -- [-1357.389] (-1375.660) (-1386.998) (-1372.590) * (-1378.507) (-1366.235) [-1358.786] (-1374.806) -- 0:01:33
Average standard deviation of split frequencies: 0.008428
645500 -- [-1364.077] (-1372.646) (-1379.774) (-1358.843) * [-1364.926] (-1377.387) (-1374.983) (-1371.721) -- 0:01:32
646000 -- (-1367.097) (-1376.204) (-1384.452) [-1358.566] * (-1368.077) (-1377.609) [-1352.570] (-1385.953) -- 0:01:33
646500 -- [-1349.145] (-1386.204) (-1373.966) (-1371.660) * (-1382.526) (-1369.716) [-1348.663] (-1379.185) -- 0:01:32
647000 -- (-1373.169) (-1382.471) [-1350.998] (-1392.640) * (-1378.284) (-1385.918) [-1347.769] (-1383.182) -- 0:01:32
647500 -- (-1366.530) (-1370.984) [-1349.511] (-1388.215) * (-1376.272) (-1381.389) [-1348.931] (-1381.838) -- 0:01:32
648000 -- (-1369.530) (-1368.137) [-1359.203] (-1390.867) * (-1382.498) (-1377.674) (-1347.455) [-1343.262] -- 0:01:32
648500 -- [-1344.971] (-1368.744) (-1365.256) (-1380.076) * [-1362.356] (-1378.486) (-1350.793) (-1373.706) -- 0:01:32
649000 -- [-1352.167] (-1389.514) (-1366.805) (-1377.446) * (-1373.739) (-1383.463) [-1373.685] (-1361.457) -- 0:01:31
649500 -- [-1371.610] (-1375.092) (-1361.879) (-1378.463) * (-1378.949) (-1384.757) (-1375.243) [-1354.692] -- 0:01:31
650000 -- [-1368.653] (-1375.678) (-1369.123) (-1386.073) * (-1382.522) (-1379.926) (-1372.275) [-1348.252] -- 0:01:32
Average standard deviation of split frequencies: 0.008875
650500 -- [-1358.663] (-1373.508) (-1374.688) (-1367.646) * (-1375.130) [-1349.927] (-1362.411) (-1374.410) -- 0:01:31
651000 -- [-1361.417] (-1393.329) (-1371.530) (-1381.735) * (-1375.015) [-1355.603] (-1346.875) (-1381.015) -- 0:01:31
651500 -- [-1346.019] (-1395.715) (-1381.423) (-1375.800) * (-1365.047) (-1370.545) [-1367.214] (-1386.277) -- 0:01:31
652000 -- [-1344.173] (-1376.621) (-1387.171) (-1385.183) * (-1362.123) (-1370.433) [-1362.773] (-1384.007) -- 0:01:31
652500 -- [-1344.474] (-1384.995) (-1381.921) (-1375.836) * (-1367.970) (-1383.260) (-1386.129) [-1363.523] -- 0:01:31
653000 -- [-1353.312] (-1391.922) (-1379.616) (-1371.269) * [-1354.381] (-1363.526) (-1378.055) (-1356.169) -- 0:01:30
653500 -- (-1359.643) (-1377.413) (-1391.999) [-1358.306] * [-1363.543] (-1368.352) (-1375.540) (-1364.719) -- 0:01:31
654000 -- (-1369.582) (-1371.345) (-1385.795) [-1365.143] * (-1386.964) (-1377.878) (-1375.968) [-1357.109] -- 0:01:30
654500 -- (-1374.543) [-1359.204] (-1387.549) (-1366.607) * (-1366.108) [-1365.387] (-1386.199) (-1368.851) -- 0:01:30
655000 -- (-1377.846) (-1365.875) (-1369.177) [-1359.520] * (-1387.551) [-1360.595] (-1379.431) (-1369.941) -- 0:01:30
Average standard deviation of split frequencies: 0.007905
655500 -- (-1374.240) [-1368.007] (-1372.990) (-1371.815) * (-1359.963) [-1351.822] (-1370.226) (-1364.960) -- 0:01:30
656000 -- (-1376.029) [-1360.948] (-1376.550) (-1354.871) * [-1354.143] (-1366.252) (-1379.587) (-1375.619) -- 0:01:30
656500 -- (-1377.482) (-1361.254) (-1369.846) [-1369.984] * [-1347.196] (-1372.885) (-1381.392) (-1371.041) -- 0:01:29
657000 -- [-1372.795] (-1376.631) (-1368.519) (-1372.252) * (-1362.239) (-1385.926) (-1388.050) [-1358.387] -- 0:01:29
657500 -- (-1377.978) (-1371.322) [-1349.017] (-1374.646) * (-1357.421) [-1377.622] (-1370.222) (-1360.884) -- 0:01:30
658000 -- (-1388.062) (-1376.129) [-1352.123] (-1364.688) * (-1367.466) (-1380.015) (-1379.158) [-1356.927] -- 0:01:29
658500 -- (-1386.095) (-1387.401) [-1363.057] (-1380.655) * (-1364.312) (-1383.055) (-1379.915) [-1376.095] -- 0:01:29
659000 -- [-1368.780] (-1392.262) (-1348.388) (-1380.021) * [-1374.172] (-1387.180) (-1366.299) (-1373.284) -- 0:01:29
659500 -- [-1368.374] (-1389.786) (-1370.399) (-1364.672) * (-1365.047) (-1375.544) [-1352.327] (-1381.545) -- 0:01:29
660000 -- (-1383.959) (-1364.768) (-1365.231) [-1356.213] * (-1377.014) (-1379.457) [-1346.359] (-1385.501) -- 0:01:29
Average standard deviation of split frequencies: 0.007706
660500 -- (-1373.583) (-1370.268) [-1359.585] (-1374.720) * (-1371.290) (-1380.457) [-1349.537] (-1378.240) -- 0:01:28
661000 -- (-1379.041) (-1359.851) [-1372.645] (-1377.192) * [-1373.228] (-1367.134) (-1362.119) (-1397.386) -- 0:01:29
661500 -- (-1386.188) (-1361.113) [-1354.838] (-1373.902) * (-1374.958) (-1365.782) [-1346.895] (-1383.754) -- 0:01:29
662000 -- (-1378.911) (-1361.077) [-1351.380] (-1377.518) * (-1371.361) (-1376.713) [-1348.159] (-1386.393) -- 0:01:28
662500 -- (-1368.332) [-1360.084] (-1355.830) (-1370.781) * (-1372.571) (-1364.022) [-1351.886] (-1379.724) -- 0:01:28
663000 -- (-1372.236) (-1378.155) [-1362.055] (-1398.272) * (-1373.941) [-1367.171] (-1372.395) (-1381.412) -- 0:01:28
663500 -- (-1373.855) (-1367.265) [-1348.723] (-1376.706) * (-1364.983) [-1373.519] (-1370.971) (-1378.835) -- 0:01:28
664000 -- (-1392.844) (-1353.041) [-1353.075] (-1385.804) * (-1384.195) (-1366.539) [-1355.396] (-1384.202) -- 0:01:28
664500 -- (-1384.009) (-1376.915) [-1343.888] (-1380.185) * [-1356.956] (-1383.514) (-1351.261) (-1379.196) -- 0:01:27
665000 -- (-1372.384) (-1383.541) [-1360.918] (-1394.634) * (-1372.658) (-1390.606) [-1355.452] (-1388.796) -- 0:01:28
Average standard deviation of split frequencies: 0.007467
665500 -- [-1355.229] (-1377.021) (-1383.504) (-1390.745) * (-1368.572) [-1370.450] (-1396.636) (-1381.918) -- 0:01:27
666000 -- [-1348.315] (-1372.650) (-1367.016) (-1385.106) * [-1354.748] (-1359.028) (-1376.139) (-1381.301) -- 0:01:27
666500 -- [-1352.353] (-1382.200) (-1375.720) (-1387.619) * [-1343.981] (-1372.707) (-1363.143) (-1375.309) -- 0:01:27
667000 -- (-1351.123) (-1377.415) [-1373.320] (-1375.252) * [-1355.037] (-1353.173) (-1374.913) (-1377.149) -- 0:01:27
667500 -- [-1348.647] (-1383.631) (-1383.931) (-1380.611) * [-1371.290] (-1356.997) (-1379.034) (-1383.942) -- 0:01:27
668000 -- [-1370.266] (-1382.756) (-1383.609) (-1375.063) * (-1389.579) [-1358.531] (-1375.435) (-1383.240) -- 0:01:26
668500 -- [-1367.744] (-1380.809) (-1380.574) (-1356.924) * (-1382.536) (-1379.770) (-1362.537) [-1361.480] -- 0:01:26
669000 -- [-1359.954] (-1379.781) (-1356.734) (-1362.329) * (-1371.399) (-1386.178) (-1354.429) [-1375.695] -- 0:01:27
669500 -- (-1368.992) (-1380.847) (-1353.762) [-1357.881] * (-1370.844) (-1373.525) [-1368.313] (-1381.309) -- 0:01:26
670000 -- (-1376.203) (-1381.674) (-1358.952) [-1352.390] * [-1360.726] (-1377.412) (-1371.291) (-1369.029) -- 0:01:26
Average standard deviation of split frequencies: 0.007661
670500 -- (-1379.069) (-1366.101) (-1360.610) [-1369.869] * (-1381.294) (-1379.174) (-1365.946) [-1349.362] -- 0:01:26
671000 -- (-1359.151) (-1371.122) [-1348.680] (-1385.519) * (-1389.872) [-1363.764] (-1383.003) (-1361.244) -- 0:01:26
671500 -- [-1349.122] (-1359.082) (-1373.490) (-1387.150) * (-1366.261) (-1382.879) (-1377.300) [-1351.896] -- 0:01:26
672000 -- (-1358.643) (-1378.016) [-1358.637] (-1376.736) * (-1370.973) (-1370.200) (-1373.974) [-1347.505] -- 0:01:25
672500 -- [-1345.803] (-1371.921) (-1358.631) (-1387.952) * [-1356.188] (-1378.340) (-1358.388) (-1369.101) -- 0:01:26
673000 -- (-1367.298) (-1378.186) [-1368.625] (-1393.671) * (-1383.301) (-1359.149) [-1358.908] (-1388.876) -- 0:01:26
673500 -- [-1352.281] (-1382.029) (-1348.727) (-1388.875) * (-1384.371) (-1364.552) [-1352.801] (-1379.530) -- 0:01:25
674000 -- [-1352.788] (-1371.381) (-1364.376) (-1387.193) * (-1372.103) (-1374.149) [-1352.069] (-1375.346) -- 0:01:25
674500 -- [-1369.586] (-1356.972) (-1384.924) (-1382.047) * (-1381.835) (-1366.323) [-1360.698] (-1366.486) -- 0:01:25
675000 -- (-1380.431) [-1356.642] (-1363.623) (-1387.634) * (-1358.657) (-1348.602) [-1352.219] (-1367.371) -- 0:01:25
Average standard deviation of split frequencies: 0.007566
675500 -- (-1359.617) (-1358.925) [-1359.160] (-1387.172) * (-1368.191) (-1363.187) (-1378.911) [-1370.732] -- 0:01:25
676000 -- [-1362.422] (-1368.138) (-1375.717) (-1377.474) * (-1369.899) [-1356.708] (-1371.002) (-1372.070) -- 0:01:24
676500 -- [-1354.267] (-1382.158) (-1379.895) (-1370.942) * (-1377.783) [-1366.820] (-1381.868) (-1389.669) -- 0:01:25
677000 -- [-1357.849] (-1391.454) (-1386.280) (-1380.898) * (-1373.676) [-1362.904] (-1380.398) (-1389.641) -- 0:01:24
677500 -- (-1377.535) [-1376.469] (-1385.643) (-1376.944) * [-1359.227] (-1375.107) (-1378.690) (-1391.512) -- 0:01:24
678000 -- [-1372.328] (-1362.520) (-1382.224) (-1371.794) * [-1362.269] (-1366.873) (-1370.430) (-1383.309) -- 0:01:24
678500 -- (-1379.296) (-1361.363) (-1376.609) [-1365.982] * (-1383.420) [-1355.202] (-1370.019) (-1374.626) -- 0:01:24
679000 -- (-1374.067) (-1346.693) (-1389.385) [-1348.502] * (-1374.913) (-1381.214) [-1367.853] (-1367.401) -- 0:01:24
679500 -- (-1370.859) [-1375.921] (-1382.634) (-1369.403) * (-1353.624) (-1389.783) (-1374.384) [-1354.910] -- 0:01:23
680000 -- (-1354.239) (-1382.573) (-1379.967) [-1349.586] * (-1367.533) (-1390.500) (-1387.727) [-1357.940] -- 0:01:23
Average standard deviation of split frequencies: 0.008103
680500 -- [-1362.453] (-1386.656) (-1381.653) (-1365.039) * (-1360.668) (-1386.069) (-1374.563) [-1351.641] -- 0:01:24
681000 -- (-1381.539) (-1390.569) [-1362.510] (-1375.219) * (-1350.272) (-1384.511) (-1380.934) [-1347.603] -- 0:01:23
681500 -- (-1373.857) (-1379.073) [-1356.388] (-1367.014) * [-1353.326] (-1387.864) (-1367.957) (-1363.114) -- 0:01:23
682000 -- (-1381.154) [-1359.958] (-1386.039) (-1357.409) * [-1359.810] (-1374.271) (-1370.068) (-1385.331) -- 0:01:23
682500 -- [-1370.376] (-1375.349) (-1376.819) (-1382.261) * (-1370.125) (-1374.796) [-1367.612] (-1379.500) -- 0:01:23
683000 -- (-1383.422) [-1370.033] (-1386.614) (-1374.251) * (-1381.057) (-1381.329) [-1360.243] (-1380.103) -- 0:01:23
683500 -- (-1384.853) [-1357.177] (-1375.095) (-1385.513) * [-1369.081] (-1381.633) (-1364.092) (-1385.960) -- 0:01:22
684000 -- (-1391.664) [-1367.745] (-1382.325) (-1371.828) * (-1369.192) (-1390.355) [-1349.376] (-1377.241) -- 0:01:22
684500 -- (-1356.437) (-1369.693) (-1383.715) [-1363.906] * (-1378.623) (-1385.482) [-1367.868] (-1382.716) -- 0:01:22
685000 -- (-1372.162) [-1366.717] (-1387.062) (-1375.027) * [-1351.648] (-1368.037) (-1384.781) (-1376.741) -- 0:01:22
Average standard deviation of split frequencies: 0.008177
685500 -- [-1364.478] (-1375.122) (-1397.851) (-1373.943) * (-1368.207) [-1368.405] (-1382.216) (-1371.867) -- 0:01:22
686000 -- [-1347.909] (-1380.918) (-1385.675) (-1385.169) * (-1365.180) [-1356.121] (-1369.217) (-1382.713) -- 0:01:22
686500 -- (-1373.053) (-1388.458) [-1363.021] (-1385.132) * (-1359.396) (-1361.773) [-1375.169] (-1374.370) -- 0:01:22
687000 -- [-1373.309] (-1377.441) (-1359.972) (-1384.231) * [-1359.174] (-1366.761) (-1367.357) (-1379.340) -- 0:01:22
687500 -- (-1372.969) (-1385.882) [-1350.326] (-1375.121) * (-1376.657) [-1361.227] (-1377.558) (-1382.457) -- 0:01:21
688000 -- (-1370.792) (-1390.503) [-1353.570] (-1382.532) * (-1375.089) (-1361.223) (-1390.400) [-1363.920] -- 0:01:22
688500 -- (-1367.831) (-1368.560) [-1344.549] (-1388.073) * (-1374.092) (-1381.299) (-1384.789) [-1342.854] -- 0:01:21
689000 -- (-1384.160) [-1343.743] (-1357.703) (-1379.586) * (-1365.992) (-1378.367) (-1381.682) [-1347.512] -- 0:01:21
689500 -- (-1384.222) (-1383.318) [-1359.076] (-1369.185) * (-1386.359) (-1373.400) (-1370.390) [-1371.460] -- 0:01:21
690000 -- (-1374.719) (-1387.363) [-1347.273] (-1365.584) * (-1380.679) (-1386.420) [-1362.108] (-1379.940) -- 0:01:21
Average standard deviation of split frequencies: 0.008600
690500 -- (-1377.738) (-1385.341) [-1342.800] (-1348.332) * (-1380.272) (-1401.360) (-1365.118) [-1356.628] -- 0:01:21
691000 -- (-1384.063) (-1356.873) (-1383.224) [-1333.394] * (-1375.632) [-1370.030] (-1367.772) (-1361.650) -- 0:01:20
691500 -- (-1384.974) (-1366.034) [-1364.646] (-1365.777) * (-1373.267) (-1389.645) (-1361.826) [-1363.878] -- 0:01:20
692000 -- (-1374.135) [-1364.637] (-1376.751) (-1364.886) * [-1368.208] (-1388.131) (-1370.224) (-1374.900) -- 0:01:21
692500 -- (-1382.341) (-1384.400) (-1347.946) [-1354.773] * (-1390.030) (-1381.444) (-1364.601) [-1369.001] -- 0:01:20
693000 -- (-1380.750) (-1365.002) [-1346.283] (-1366.941) * (-1376.695) (-1387.993) (-1361.267) [-1363.896] -- 0:01:20
693500 -- (-1379.712) (-1371.653) [-1362.037] (-1379.229) * (-1374.376) (-1385.521) [-1353.622] (-1380.314) -- 0:01:20
694000 -- (-1378.804) (-1378.668) [-1370.169] (-1368.855) * (-1384.655) (-1361.004) [-1350.431] (-1393.691) -- 0:01:20
694500 -- (-1373.296) (-1377.499) [-1353.441] (-1373.270) * (-1383.760) [-1380.692] (-1379.946) (-1386.052) -- 0:01:20
695000 -- (-1367.491) (-1387.705) [-1348.426] (-1377.418) * (-1373.306) (-1378.746) [-1356.615] (-1381.029) -- 0:01:19
Average standard deviation of split frequencies: 0.008805
695500 -- (-1349.468) (-1381.489) [-1352.519] (-1385.569) * (-1372.797) [-1360.308] (-1377.037) (-1381.827) -- 0:01:19
696000 -- [-1351.186] (-1379.108) (-1382.102) (-1378.139) * (-1366.966) (-1371.812) [-1351.052] (-1379.782) -- 0:01:19
696500 -- [-1363.221] (-1362.161) (-1383.190) (-1380.764) * [-1350.979] (-1365.405) (-1367.948) (-1372.135) -- 0:01:19
697000 -- [-1347.520] (-1361.875) (-1385.473) (-1374.336) * [-1340.405] (-1359.463) (-1383.755) (-1383.239) -- 0:01:19
697500 -- (-1364.214) [-1353.233] (-1387.062) (-1370.379) * (-1345.522) [-1358.988] (-1383.113) (-1363.399) -- 0:01:19
698000 -- [-1348.751] (-1375.235) (-1385.965) (-1355.624) * (-1368.324) [-1348.332] (-1383.203) (-1370.795) -- 0:01:19
698500 -- [-1353.029] (-1386.871) (-1385.544) (-1367.613) * (-1372.245) [-1356.075] (-1388.407) (-1377.384) -- 0:01:18
699000 -- [-1353.920] (-1372.187) (-1380.649) (-1372.341) * (-1379.795) (-1354.776) (-1385.621) [-1361.886] -- 0:01:18
699500 -- [-1357.961] (-1360.890) (-1378.079) (-1361.759) * (-1363.683) [-1356.613] (-1380.109) (-1373.282) -- 0:01:19
700000 -- [-1347.699] (-1387.976) (-1368.224) (-1371.845) * (-1360.026) [-1348.274] (-1391.384) (-1377.736) -- 0:01:18
Average standard deviation of split frequencies: 0.009116
700500 -- (-1349.461) [-1365.538] (-1382.083) (-1379.777) * [-1350.349] (-1357.547) (-1393.633) (-1367.376) -- 0:01:18
701000 -- [-1351.094] (-1374.647) (-1372.118) (-1372.516) * (-1365.615) [-1342.270] (-1380.587) (-1383.874) -- 0:01:18
701500 -- [-1341.136] (-1369.633) (-1371.915) (-1385.930) * [-1349.603] (-1367.195) (-1378.673) (-1380.823) -- 0:01:18
702000 -- [-1365.233] (-1385.437) (-1377.928) (-1366.099) * [-1361.902] (-1359.231) (-1377.166) (-1378.690) -- 0:01:18
702500 -- (-1355.089) [-1356.141] (-1384.647) (-1380.808) * [-1353.187] (-1364.858) (-1391.294) (-1373.265) -- 0:01:17
703000 -- [-1353.602] (-1371.778) (-1375.181) (-1376.025) * [-1349.402] (-1370.033) (-1384.777) (-1380.486) -- 0:01:17
703500 -- [-1367.106] (-1362.303) (-1385.421) (-1388.068) * [-1345.003] (-1362.937) (-1381.840) (-1400.953) -- 0:01:17
704000 -- [-1352.066] (-1375.985) (-1390.439) (-1373.735) * [-1344.585] (-1373.149) (-1382.649) (-1370.997) -- 0:01:17
704500 -- (-1356.302) (-1373.641) (-1382.050) [-1351.059] * [-1347.886] (-1382.669) (-1371.353) (-1382.938) -- 0:01:17
705000 -- (-1359.207) [-1370.408] (-1393.129) (-1364.583) * [-1352.507] (-1372.958) (-1386.787) (-1369.299) -- 0:01:17
Average standard deviation of split frequencies: 0.009415
705500 -- [-1349.168] (-1354.422) (-1394.393) (-1379.890) * [-1345.092] (-1376.460) (-1381.747) (-1367.896) -- 0:01:17
706000 -- (-1360.117) [-1356.273] (-1377.004) (-1379.072) * (-1362.305) (-1372.828) (-1375.394) [-1371.020] -- 0:01:17
706500 -- (-1374.179) [-1350.947] (-1377.049) (-1383.744) * [-1356.080] (-1376.973) (-1369.706) (-1377.018) -- 0:01:16
707000 -- (-1372.910) (-1352.022) [-1369.050] (-1371.443) * (-1372.012) (-1379.375) [-1354.873] (-1378.198) -- 0:01:16
707500 -- (-1378.050) [-1370.181] (-1372.316) (-1384.255) * [-1353.073] (-1379.172) (-1377.626) (-1377.413) -- 0:01:16
708000 -- [-1363.856] (-1387.317) (-1370.893) (-1386.129) * [-1367.126] (-1368.809) (-1391.887) (-1376.106) -- 0:01:16
708500 -- (-1375.935) [-1376.122] (-1363.760) (-1382.602) * [-1370.767] (-1372.348) (-1377.434) (-1375.098) -- 0:01:16
709000 -- (-1362.658) [-1365.944] (-1371.366) (-1378.710) * (-1380.181) [-1356.563] (-1363.248) (-1376.764) -- 0:01:16
709500 -- [-1358.470] (-1364.669) (-1383.774) (-1369.250) * (-1391.179) (-1346.146) [-1347.138] (-1383.148) -- 0:01:16
710000 -- (-1376.070) (-1379.713) (-1381.799) [-1355.049] * (-1379.399) (-1378.400) [-1355.944] (-1375.562) -- 0:01:15
Average standard deviation of split frequencies: 0.009419
710500 -- (-1378.337) (-1388.744) (-1372.633) [-1354.364] * (-1380.145) (-1379.048) [-1357.080] (-1364.613) -- 0:01:15
711000 -- [-1367.868] (-1372.143) (-1390.802) (-1360.633) * (-1379.155) (-1376.178) (-1363.340) [-1360.887] -- 0:01:15
711500 -- (-1365.100) (-1374.700) (-1377.446) [-1359.368] * (-1378.745) (-1373.168) (-1374.456) [-1356.390] -- 0:01:15
712000 -- (-1372.626) (-1389.417) (-1371.000) [-1354.065] * (-1375.044) (-1383.612) (-1375.834) [-1358.364] -- 0:01:15
712500 -- (-1370.292) (-1377.359) (-1377.831) [-1354.568] * [-1364.435] (-1383.655) (-1387.326) (-1372.142) -- 0:01:15
713000 -- (-1378.158) (-1374.869) [-1345.369] (-1355.331) * (-1364.890) (-1388.544) [-1378.072] (-1360.564) -- 0:01:15
713500 -- (-1379.437) (-1355.326) (-1385.734) [-1347.932] * (-1384.209) (-1355.583) [-1353.635] (-1377.575) -- 0:01:15
714000 -- (-1397.657) [-1351.147] (-1383.377) (-1349.209) * (-1378.275) (-1351.030) [-1363.882] (-1373.534) -- 0:01:14
714500 -- (-1382.625) [-1358.654] (-1383.805) (-1368.036) * (-1383.285) (-1368.168) [-1356.589] (-1404.885) -- 0:01:14
715000 -- (-1388.174) (-1368.790) (-1375.113) [-1353.001] * (-1377.933) (-1357.265) [-1348.710] (-1381.409) -- 0:01:14
Average standard deviation of split frequencies: 0.009250
715500 -- [-1365.321] (-1361.443) (-1381.395) (-1352.022) * (-1388.411) (-1371.020) (-1362.418) [-1356.298] -- 0:01:14
716000 -- (-1361.178) [-1359.452] (-1370.700) (-1354.400) * (-1387.612) (-1380.250) (-1375.734) [-1351.397] -- 0:01:14
716500 -- (-1364.182) [-1358.452] (-1382.452) (-1368.633) * (-1381.105) (-1373.140) (-1374.692) [-1350.821] -- 0:01:14
717000 -- (-1359.810) [-1347.709] (-1373.992) (-1353.620) * (-1383.517) [-1371.662] (-1380.337) (-1354.239) -- 0:01:14
717500 -- (-1359.208) [-1352.039] (-1374.553) (-1365.039) * (-1381.623) (-1370.574) (-1377.784) [-1368.043] -- 0:01:14
718000 -- (-1390.233) (-1359.213) (-1371.640) [-1349.461] * (-1373.951) (-1379.659) [-1364.648] (-1368.792) -- 0:01:13
718500 -- (-1385.543) (-1351.812) (-1379.445) [-1341.206] * (-1372.894) (-1383.675) [-1348.403] (-1360.748) -- 0:01:13
719000 -- (-1379.250) (-1359.841) (-1388.303) [-1351.029] * (-1374.975) (-1383.633) [-1340.871] (-1369.699) -- 0:01:13
719500 -- (-1383.816) (-1344.425) (-1383.396) [-1358.622] * (-1384.600) (-1378.503) [-1347.436] (-1370.331) -- 0:01:13
720000 -- (-1387.868) [-1345.311] (-1378.864) (-1352.223) * (-1384.053) (-1388.873) (-1375.033) [-1347.300] -- 0:01:13
Average standard deviation of split frequencies: 0.009158
720500 -- (-1355.831) (-1351.397) (-1380.172) [-1355.262] * (-1380.505) (-1387.997) [-1352.398] (-1367.743) -- 0:01:13
721000 -- [-1370.937] (-1368.883) (-1384.555) (-1342.472) * (-1368.125) (-1373.953) [-1351.569] (-1371.155) -- 0:01:13
721500 -- (-1366.249) (-1400.731) (-1365.581) [-1346.391] * (-1364.736) (-1378.277) [-1355.832] (-1385.729) -- 0:01:12
722000 -- (-1353.117) (-1372.730) (-1367.796) [-1355.433] * [-1360.894] (-1374.913) (-1362.236) (-1370.274) -- 0:01:12
722500 -- (-1367.944) (-1377.427) (-1389.717) [-1367.036] * (-1359.953) (-1393.939) [-1355.079] (-1377.625) -- 0:01:12
723000 -- (-1369.771) (-1388.462) (-1378.639) [-1354.155] * [-1355.731] (-1383.092) (-1357.697) (-1382.961) -- 0:01:12
723500 -- (-1373.096) (-1374.740) [-1366.262] (-1371.938) * [-1368.278] (-1380.535) (-1391.336) (-1366.580) -- 0:01:12
724000 -- (-1381.135) [-1370.291] (-1396.054) (-1372.761) * (-1374.193) (-1382.615) (-1372.885) [-1350.332] -- 0:01:12
724500 -- [-1357.594] (-1367.542) (-1381.266) (-1379.448) * (-1375.816) (-1384.443) (-1366.091) [-1355.407] -- 0:01:12
725000 -- (-1365.058) [-1359.060] (-1386.559) (-1370.127) * (-1354.313) (-1368.228) (-1373.983) [-1352.472] -- 0:01:12
Average standard deviation of split frequencies: 0.009415
725500 -- (-1369.441) (-1383.782) (-1392.285) [-1354.078] * (-1354.474) (-1375.987) [-1371.688] (-1379.358) -- 0:01:11
726000 -- [-1359.713] (-1369.567) (-1386.468) (-1368.935) * (-1363.446) (-1383.340) [-1369.769] (-1383.936) -- 0:01:11
726500 -- [-1352.743] (-1372.500) (-1379.684) (-1367.357) * (-1357.661) (-1377.287) [-1362.390] (-1385.454) -- 0:01:11
727000 -- (-1377.192) (-1387.197) (-1386.159) [-1356.281] * [-1352.427] (-1373.179) (-1365.147) (-1378.458) -- 0:01:11
727500 -- (-1382.359) (-1382.761) (-1363.334) [-1363.493] * (-1361.805) (-1373.985) (-1376.637) [-1361.309] -- 0:01:11
728000 -- (-1385.531) (-1381.384) [-1352.556] (-1365.289) * (-1349.381) [-1365.209] (-1373.626) (-1350.246) -- 0:01:11
728500 -- (-1383.825) [-1368.100] (-1366.333) (-1368.391) * [-1359.153] (-1387.809) (-1381.611) (-1365.372) -- 0:01:11
729000 -- (-1385.949) (-1393.642) [-1354.783] (-1381.772) * [-1343.937] (-1378.813) (-1383.053) (-1377.603) -- 0:01:11
729500 -- [-1376.067] (-1407.090) (-1350.716) (-1379.487) * [-1358.179] (-1373.038) (-1380.425) (-1381.382) -- 0:01:10
730000 -- (-1363.042) (-1400.273) [-1360.420] (-1373.523) * (-1356.961) (-1386.178) [-1370.001] (-1365.110) -- 0:01:10
Average standard deviation of split frequencies: 0.008710
730500 -- (-1344.521) (-1388.745) [-1349.033] (-1382.963) * [-1367.483] (-1381.588) (-1374.154) (-1385.244) -- 0:01:10
731000 -- [-1355.237] (-1387.966) (-1369.858) (-1373.573) * (-1373.971) [-1353.642] (-1370.397) (-1384.765) -- 0:01:10
731500 -- [-1348.728] (-1395.315) (-1363.343) (-1350.855) * (-1359.764) (-1351.682) [-1373.015] (-1389.054) -- 0:01:10
732000 -- [-1359.821] (-1380.248) (-1374.766) (-1367.122) * (-1357.801) [-1361.740] (-1381.352) (-1394.996) -- 0:01:10
732500 -- (-1354.122) (-1390.018) (-1373.626) [-1351.678] * [-1364.292] (-1365.562) (-1389.541) (-1384.267) -- 0:01:10
733000 -- (-1360.787) (-1385.923) (-1382.688) [-1357.862] * (-1364.739) [-1363.323] (-1379.139) (-1374.743) -- 0:01:09
733500 -- (-1360.285) (-1377.148) (-1374.355) [-1347.096] * (-1386.590) (-1375.836) (-1379.001) [-1372.924] -- 0:01:09
734000 -- (-1375.563) (-1367.293) (-1368.512) [-1354.247] * (-1397.102) [-1360.124] (-1376.908) (-1367.511) -- 0:01:09
734500 -- (-1356.521) (-1371.588) (-1382.394) [-1350.657] * (-1372.659) [-1365.925] (-1367.274) (-1374.319) -- 0:01:09
735000 -- [-1358.852] (-1383.410) (-1375.047) (-1385.305) * [-1348.872] (-1367.145) (-1362.975) (-1377.020) -- 0:01:09
Average standard deviation of split frequencies: 0.008679
735500 -- [-1355.366] (-1379.540) (-1353.454) (-1381.310) * (-1360.912) (-1386.643) [-1385.581] (-1373.708) -- 0:01:09
736000 -- (-1374.276) (-1378.368) [-1347.503] (-1372.878) * (-1372.668) [-1350.737] (-1372.412) (-1373.987) -- 0:01:09
736500 -- (-1375.393) (-1382.300) [-1360.986] (-1366.628) * (-1369.284) (-1370.554) (-1377.677) [-1377.777] -- 0:01:09
737000 -- (-1382.467) (-1357.631) [-1349.424] (-1376.194) * [-1365.903] (-1371.388) (-1371.369) (-1381.276) -- 0:01:08
737500 -- (-1385.596) [-1368.704] (-1359.367) (-1379.123) * [-1373.798] (-1373.058) (-1387.270) (-1380.283) -- 0:01:08
738000 -- (-1380.341) [-1354.368] (-1380.958) (-1382.729) * (-1383.651) (-1364.637) [-1357.613] (-1382.757) -- 0:01:08
738500 -- (-1368.057) [-1363.581] (-1394.737) (-1363.624) * (-1383.046) [-1349.868] (-1354.112) (-1378.345) -- 0:01:08
739000 -- [-1359.875] (-1376.351) (-1390.462) (-1357.681) * (-1372.766) (-1353.485) [-1354.577] (-1371.527) -- 0:01:08
739500 -- (-1373.637) (-1377.688) (-1395.374) [-1359.959] * (-1393.360) [-1360.628] (-1362.634) (-1375.617) -- 0:01:08
740000 -- (-1373.474) [-1342.628] (-1391.909) (-1362.616) * (-1373.374) (-1367.994) [-1354.420] (-1378.509) -- 0:01:08
Average standard deviation of split frequencies: 0.009070
740500 -- (-1384.176) (-1362.321) (-1377.243) [-1361.543] * (-1366.194) (-1381.382) [-1366.191] (-1387.120) -- 0:01:07
741000 -- (-1380.210) [-1368.118] (-1375.981) (-1375.007) * [-1368.422] (-1354.058) (-1375.516) (-1366.862) -- 0:01:07
741500 -- (-1373.802) [-1348.432] (-1370.331) (-1371.704) * (-1382.171) [-1351.529] (-1378.026) (-1368.521) -- 0:01:07
742000 -- (-1379.680) (-1341.821) (-1377.163) [-1361.467] * [-1369.576] (-1360.508) (-1380.011) (-1377.200) -- 0:01:07
742500 -- (-1382.029) [-1347.777] (-1383.887) (-1360.048) * (-1370.790) [-1357.216] (-1380.871) (-1373.828) -- 0:01:07
743000 -- (-1395.516) (-1356.128) (-1367.933) [-1375.083] * (-1386.669) (-1357.597) (-1378.480) [-1369.026] -- 0:01:07
743500 -- (-1383.003) [-1352.910] (-1368.820) (-1381.012) * (-1368.722) [-1361.164] (-1372.336) (-1372.604) -- 0:01:07
744000 -- (-1384.313) [-1358.651] (-1380.810) (-1383.767) * [-1355.439] (-1360.103) (-1372.063) (-1375.519) -- 0:01:07
744500 -- (-1373.366) (-1370.272) [-1367.672] (-1392.373) * (-1342.912) [-1366.931] (-1383.517) (-1387.160) -- 0:01:06
745000 -- (-1368.333) (-1375.502) [-1374.104] (-1383.369) * [-1335.038] (-1379.980) (-1384.467) (-1382.959) -- 0:01:06
Average standard deviation of split frequencies: 0.008657
745500 -- (-1359.507) (-1382.795) [-1363.840] (-1385.564) * [-1348.069] (-1371.905) (-1377.868) (-1387.656) -- 0:01:06
746000 -- (-1374.976) (-1377.074) [-1350.397] (-1376.979) * [-1363.870] (-1362.833) (-1376.701) (-1377.367) -- 0:01:06
746500 -- (-1384.287) (-1376.412) [-1355.092] (-1361.884) * (-1377.733) [-1364.375] (-1385.809) (-1370.735) -- 0:01:06
747000 -- (-1376.121) (-1370.967) (-1374.088) [-1357.785] * (-1395.793) [-1362.164] (-1389.181) (-1362.910) -- 0:01:06
747500 -- (-1380.531) [-1352.214] (-1364.448) (-1387.266) * (-1379.664) (-1389.319) (-1369.802) [-1347.838] -- 0:01:06
748000 -- (-1381.681) (-1368.302) (-1388.863) [-1367.159] * (-1377.043) (-1375.695) (-1373.770) [-1344.751] -- 0:01:06
748500 -- [-1368.621] (-1342.198) (-1387.620) (-1377.723) * (-1377.587) (-1387.665) [-1358.178] (-1361.561) -- 0:01:05
749000 -- (-1379.755) [-1357.890] (-1381.895) (-1374.091) * [-1381.106] (-1369.921) (-1373.199) (-1373.637) -- 0:01:05
749500 -- (-1368.037) [-1349.830] (-1372.279) (-1370.976) * (-1377.104) [-1352.493] (-1367.633) (-1360.064) -- 0:01:05
750000 -- (-1377.196) [-1350.364] (-1374.380) (-1375.982) * (-1379.804) [-1358.534] (-1381.016) (-1367.609) -- 0:01:05
Average standard deviation of split frequencies: 0.009231
750500 -- (-1378.174) [-1352.462] (-1385.149) (-1380.763) * (-1383.343) (-1371.280) (-1379.675) [-1366.243] -- 0:01:05
751000 -- (-1380.174) [-1353.582] (-1378.818) (-1370.903) * [-1372.315] (-1372.220) (-1386.848) (-1380.323) -- 0:01:05
751500 -- (-1375.525) [-1353.869] (-1371.807) (-1377.452) * [-1355.396] (-1375.153) (-1373.435) (-1377.296) -- 0:01:05
752000 -- (-1373.306) [-1343.738] (-1358.336) (-1383.242) * [-1358.633] (-1381.393) (-1379.495) (-1370.184) -- 0:01:04
752500 -- (-1378.702) (-1368.592) (-1381.621) [-1352.699] * (-1388.956) [-1371.917] (-1374.181) (-1375.550) -- 0:01:04
753000 -- (-1376.536) (-1370.336) (-1373.198) [-1358.373] * (-1394.234) [-1350.341] (-1372.765) (-1382.427) -- 0:01:04
753500 -- (-1366.070) [-1363.422] (-1386.789) (-1371.567) * (-1373.993) (-1355.857) (-1380.109) [-1365.282] -- 0:01:04
754000 -- (-1379.680) [-1356.509] (-1386.772) (-1353.579) * (-1364.308) [-1348.365] (-1383.755) (-1380.037) -- 0:01:04
754500 -- (-1368.584) (-1384.937) (-1382.411) [-1352.085] * (-1368.714) (-1354.709) (-1375.552) [-1355.313] -- 0:01:04
755000 -- (-1379.167) (-1396.595) (-1376.127) [-1350.940] * (-1358.837) (-1351.467) (-1383.574) [-1371.816] -- 0:01:04
Average standard deviation of split frequencies: 0.009104
755500 -- (-1378.133) (-1388.261) (-1369.938) [-1346.495] * (-1375.045) [-1360.780] (-1373.377) (-1362.481) -- 0:01:04
756000 -- (-1379.925) (-1391.749) (-1381.352) [-1356.041] * (-1362.312) [-1338.157] (-1382.854) (-1380.030) -- 0:01:03
756500 -- [-1379.865] (-1391.578) (-1376.139) (-1347.501) * (-1365.091) [-1356.470] (-1371.537) (-1387.139) -- 0:01:03
757000 -- (-1363.802) (-1389.524) (-1382.251) [-1352.979] * (-1368.434) [-1358.376] (-1387.818) (-1378.471) -- 0:01:03
757500 -- (-1365.925) (-1385.928) (-1369.049) [-1359.246] * [-1362.758] (-1384.821) (-1376.518) (-1381.307) -- 0:01:03
758000 -- (-1357.769) (-1370.953) (-1379.901) [-1368.010] * [-1356.109] (-1359.832) (-1399.129) (-1381.630) -- 0:01:03
758500 -- (-1362.745) [-1364.569] (-1391.023) (-1375.843) * (-1389.471) [-1349.868] (-1371.636) (-1373.577) -- 0:01:03
759000 -- (-1377.179) (-1372.252) [-1385.179] (-1372.840) * (-1387.285) (-1357.647) (-1381.686) [-1360.117] -- 0:01:03
759500 -- (-1371.673) (-1361.084) [-1374.673] (-1365.830) * (-1389.229) (-1355.961) [-1355.383] (-1382.873) -- 0:01:03
760000 -- (-1359.212) (-1369.212) (-1390.729) [-1357.250] * (-1392.153) (-1374.738) (-1358.903) [-1357.759] -- 0:01:02
Average standard deviation of split frequencies: 0.008862
760500 -- (-1352.474) [-1342.007] (-1371.341) (-1375.680) * (-1385.400) [-1362.833] (-1371.949) (-1370.482) -- 0:01:02
761000 -- [-1353.726] (-1380.874) (-1357.685) (-1380.458) * (-1383.723) (-1370.303) [-1370.597] (-1367.662) -- 0:01:02
761500 -- (-1376.234) (-1399.425) (-1371.108) [-1372.319] * (-1368.724) (-1370.488) (-1377.235) [-1361.004] -- 0:01:02
762000 -- [-1353.882] (-1392.371) (-1375.884) (-1377.867) * (-1375.921) (-1386.932) [-1372.633] (-1378.429) -- 0:01:02
762500 -- [-1350.450] (-1379.510) (-1376.860) (-1376.622) * (-1376.715) (-1385.441) [-1352.907] (-1383.561) -- 0:01:02
763000 -- (-1366.336) (-1375.027) [-1363.798] (-1371.062) * (-1375.243) (-1380.565) [-1348.893] (-1368.666) -- 0:01:02
763500 -- [-1352.576] (-1370.330) (-1359.952) (-1385.204) * (-1382.387) (-1372.733) [-1362.338] (-1377.213) -- 0:01:01
764000 -- (-1339.425) (-1381.919) [-1368.834] (-1381.129) * (-1388.855) (-1371.400) [-1359.217] (-1378.679) -- 0:01:01
764500 -- [-1347.056] (-1379.314) (-1379.190) (-1385.804) * (-1387.624) (-1372.939) [-1349.424] (-1380.861) -- 0:01:01
765000 -- [-1349.642] (-1387.801) (-1380.004) (-1378.146) * (-1385.660) (-1370.961) [-1360.907] (-1377.829) -- 0:01:01
Average standard deviation of split frequencies: 0.009108
765500 -- [-1352.523] (-1376.448) (-1371.268) (-1380.381) * (-1377.568) (-1362.987) [-1367.610] (-1374.170) -- 0:01:01
766000 -- [-1346.697] (-1371.394) (-1367.615) (-1372.658) * (-1376.870) [-1354.470] (-1351.509) (-1360.622) -- 0:01:01
766500 -- [-1365.915] (-1380.368) (-1367.449) (-1375.378) * (-1384.134) (-1374.589) [-1365.415] (-1372.747) -- 0:01:01
767000 -- [-1361.948] (-1374.638) (-1372.630) (-1368.399) * (-1383.745) [-1364.956] (-1376.417) (-1352.872) -- 0:01:01
767500 -- [-1354.786] (-1376.489) (-1359.397) (-1378.592) * (-1388.265) [-1354.815] (-1382.868) (-1349.488) -- 0:01:00
768000 -- (-1359.024) (-1380.414) [-1370.812] (-1355.012) * (-1380.922) [-1358.367] (-1377.259) (-1370.497) -- 0:01:00
768500 -- (-1365.342) (-1393.688) (-1377.208) [-1351.625] * (-1384.112) [-1360.158] (-1375.959) (-1381.769) -- 0:01:00
769000 -- (-1372.998) (-1384.460) (-1388.080) [-1351.566] * (-1382.151) (-1363.483) [-1366.840] (-1374.919) -- 0:01:00
769500 -- (-1375.609) (-1372.852) (-1373.777) [-1347.176] * (-1382.613) (-1357.236) [-1364.699] (-1386.710) -- 0:01:00
770000 -- (-1360.381) [-1371.093] (-1378.145) (-1361.196) * [-1381.489] (-1374.686) (-1361.887) (-1377.395) -- 0:01:00
Average standard deviation of split frequencies: 0.008533
770500 -- (-1379.407) (-1381.592) (-1370.070) [-1371.620] * (-1376.400) (-1378.595) (-1352.072) [-1371.189] -- 0:01:00
771000 -- [-1349.146] (-1379.954) (-1385.963) (-1352.491) * (-1375.201) (-1387.033) [-1358.494] (-1378.574) -- 0:00:59
771500 -- [-1345.846] (-1379.599) (-1379.401) (-1380.533) * (-1378.593) (-1384.565) [-1349.886] (-1381.644) -- 0:00:59
772000 -- [-1345.362] (-1355.411) (-1383.257) (-1384.203) * (-1372.940) (-1367.655) [-1355.431] (-1372.524) -- 0:00:59
772500 -- (-1377.054) (-1365.275) [-1370.578] (-1379.688) * (-1389.971) (-1377.184) [-1356.283] (-1362.047) -- 0:00:59
773000 -- (-1368.279) [-1341.510] (-1385.927) (-1378.901) * (-1386.628) (-1366.834) [-1362.029] (-1376.490) -- 0:00:59
773500 -- (-1361.595) [-1361.816] (-1387.319) (-1388.333) * (-1372.105) (-1353.488) (-1380.279) [-1363.851] -- 0:00:59
774000 -- (-1375.863) (-1364.294) (-1371.745) [-1371.359] * (-1384.710) [-1369.858] (-1380.585) (-1379.962) -- 0:00:59
774500 -- [-1359.172] (-1366.495) (-1350.677) (-1393.651) * (-1379.087) (-1358.269) (-1372.481) [-1381.536] -- 0:00:59
775000 -- [-1358.974] (-1378.713) (-1373.777) (-1389.884) * (-1384.447) [-1359.568] (-1370.819) (-1383.770) -- 0:00:58
Average standard deviation of split frequencies: 0.008808
775500 -- (-1361.048) (-1381.414) (-1376.428) [-1381.636] * [-1365.261] (-1380.979) (-1381.389) (-1377.683) -- 0:00:58
776000 -- [-1365.384] (-1379.847) (-1373.692) (-1376.309) * [-1361.199] (-1385.010) (-1390.643) (-1366.885) -- 0:00:58
776500 -- (-1373.670) [-1363.912] (-1364.808) (-1377.950) * [-1356.907] (-1385.312) (-1392.894) (-1359.184) -- 0:00:58
777000 -- (-1388.731) [-1360.431] (-1365.257) (-1374.293) * (-1351.196) (-1376.344) (-1373.361) [-1350.759] -- 0:00:58
777500 -- (-1380.426) [-1370.681] (-1364.631) (-1381.705) * (-1352.164) (-1377.380) (-1386.395) [-1368.064] -- 0:00:58
778000 -- (-1368.214) [-1345.719] (-1374.933) (-1375.338) * (-1358.146) (-1376.534) (-1379.573) [-1363.112] -- 0:00:58
778500 -- (-1374.758) (-1371.396) (-1381.419) [-1358.961] * (-1359.286) (-1373.605) (-1379.173) [-1363.346] -- 0:00:58
779000 -- (-1363.527) (-1370.380) (-1383.948) [-1360.183] * [-1355.023] (-1382.850) (-1369.664) (-1376.692) -- 0:00:57
779500 -- (-1354.779) (-1389.549) (-1376.051) [-1347.903] * [-1360.559] (-1383.726) (-1378.307) (-1363.805) -- 0:00:57
780000 -- (-1356.118) [-1380.607] (-1385.704) (-1374.146) * [-1362.470] (-1371.827) (-1380.748) (-1366.304) -- 0:00:57
Average standard deviation of split frequencies: 0.008665
780500 -- (-1376.307) (-1355.744) (-1377.766) [-1361.506] * [-1360.348] (-1376.720) (-1384.619) (-1381.133) -- 0:00:57
781000 -- (-1391.351) [-1354.116] (-1358.334) (-1369.304) * [-1347.797] (-1390.705) (-1379.173) (-1389.147) -- 0:00:57
781500 -- (-1385.036) (-1350.538) [-1363.638] (-1387.212) * [-1352.413] (-1382.328) (-1380.785) (-1374.673) -- 0:00:57
782000 -- (-1362.230) [-1352.183] (-1356.254) (-1383.811) * [-1357.034] (-1384.675) (-1386.580) (-1377.930) -- 0:00:57
782500 -- [-1351.437] (-1359.018) (-1381.343) (-1379.010) * [-1366.090] (-1372.806) (-1376.950) (-1356.647) -- 0:00:57
783000 -- [-1352.582] (-1364.588) (-1371.737) (-1368.668) * (-1384.521) (-1377.623) (-1377.097) [-1347.773] -- 0:00:57
783500 -- [-1346.014] (-1373.521) (-1379.550) (-1365.119) * (-1383.819) (-1374.976) (-1380.159) [-1360.422] -- 0:00:56
784000 -- [-1366.107] (-1371.910) (-1378.333) (-1372.495) * (-1384.673) [-1359.614] (-1384.270) (-1364.328) -- 0:00:56
784500 -- (-1381.906) (-1385.193) (-1381.285) [-1362.707] * (-1385.947) (-1371.340) [-1350.491] (-1370.723) -- 0:00:56
785000 -- [-1357.350] (-1378.436) (-1388.573) (-1362.834) * (-1373.309) [-1360.950] (-1369.174) (-1376.593) -- 0:00:56
Average standard deviation of split frequencies: 0.008696
785500 -- [-1345.608] (-1378.325) (-1378.780) (-1359.797) * (-1391.180) (-1360.584) (-1382.737) [-1372.017] -- 0:00:56
786000 -- (-1353.471) (-1376.849) (-1382.252) [-1345.319] * (-1370.819) (-1383.639) (-1377.742) [-1366.425] -- 0:00:56
786500 -- (-1357.391) (-1386.940) (-1368.416) [-1358.152] * (-1385.222) (-1380.936) [-1375.330] (-1356.253) -- 0:00:56
787000 -- (-1359.549) (-1382.527) (-1374.013) [-1355.271] * (-1374.746) (-1379.443) (-1369.507) [-1352.176] -- 0:00:56
787500 -- [-1350.716] (-1389.405) (-1369.958) (-1366.449) * (-1384.657) [-1359.713] (-1379.084) (-1354.417) -- 0:00:55
788000 -- (-1376.460) (-1374.142) (-1367.682) [-1356.023] * (-1379.480) (-1377.718) [-1369.175] (-1365.376) -- 0:00:55
788500 -- (-1382.138) (-1384.504) (-1363.395) [-1359.434] * (-1383.817) (-1370.690) [-1369.991] (-1359.604) -- 0:00:55
789000 -- (-1386.619) (-1377.644) [-1347.895] (-1373.010) * (-1380.139) (-1377.094) (-1378.549) [-1369.225] -- 0:00:55
789500 -- (-1380.298) (-1376.585) [-1343.341] (-1357.548) * (-1375.664) (-1353.757) (-1378.254) [-1364.869] -- 0:00:55
790000 -- (-1380.970) (-1377.204) [-1356.715] (-1380.573) * (-1366.613) (-1379.280) (-1385.767) [-1350.253] -- 0:00:55
Average standard deviation of split frequencies: 0.008556
790500 -- (-1378.516) (-1352.488) [-1341.752] (-1378.830) * (-1379.590) (-1377.901) (-1372.302) [-1355.832] -- 0:00:55
791000 -- (-1385.092) [-1361.476] (-1358.143) (-1373.572) * (-1376.574) [-1382.150] (-1381.917) (-1368.327) -- 0:00:54
791500 -- (-1380.647) (-1359.731) [-1360.503] (-1370.492) * (-1386.622) (-1381.966) (-1379.192) [-1352.845] -- 0:00:54
792000 -- (-1378.077) [-1364.516] (-1368.481) (-1389.376) * (-1382.141) (-1389.060) (-1377.797) [-1353.745] -- 0:00:54
792500 -- (-1382.728) (-1359.484) [-1360.011] (-1387.093) * (-1375.155) (-1376.734) (-1377.101) [-1349.538] -- 0:00:54
793000 -- (-1387.007) (-1364.954) [-1353.123] (-1377.986) * (-1372.560) (-1379.280) (-1375.853) [-1361.582] -- 0:00:54
793500 -- [-1371.458] (-1365.604) (-1379.267) (-1377.159) * (-1372.784) (-1368.621) (-1374.972) [-1351.108] -- 0:00:54
794000 -- (-1378.434) (-1370.973) (-1357.202) [-1364.499] * (-1370.277) [-1346.203] (-1376.784) (-1353.784) -- 0:00:54
794500 -- (-1390.293) (-1380.128) (-1352.315) [-1345.877] * [-1356.996] (-1370.992) (-1378.567) (-1356.794) -- 0:00:54
795000 -- (-1386.436) (-1368.878) [-1345.248] (-1375.593) * [-1369.419] (-1366.096) (-1381.473) (-1348.570) -- 0:00:53
Average standard deviation of split frequencies: 0.008558
795500 -- (-1368.646) [-1378.377] (-1372.475) (-1382.250) * (-1384.157) (-1377.761) (-1375.744) [-1363.703] -- 0:00:53
796000 -- (-1370.832) [-1355.991] (-1381.965) (-1370.550) * (-1367.895) (-1381.191) (-1379.756) [-1352.229] -- 0:00:53
796500 -- [-1362.346] (-1376.742) (-1390.452) (-1383.921) * (-1369.697) (-1383.840) (-1380.813) [-1359.920] -- 0:00:53
797000 -- [-1350.914] (-1378.690) (-1383.966) (-1371.612) * (-1378.183) (-1394.160) (-1374.197) [-1353.228] -- 0:00:53
797500 -- (-1378.993) (-1371.466) (-1356.214) [-1347.138] * (-1378.687) (-1389.999) (-1376.953) [-1350.334] -- 0:00:53
798000 -- (-1364.856) (-1382.975) (-1376.534) [-1349.436] * [-1377.445] (-1394.183) (-1377.188) (-1374.056) -- 0:00:53
798500 -- (-1384.124) (-1370.033) (-1367.318) [-1349.709] * (-1378.285) (-1383.432) (-1373.683) [-1355.424] -- 0:00:52
799000 -- (-1374.921) (-1371.336) [-1366.496] (-1385.988) * [-1359.285] (-1387.298) (-1384.422) (-1371.045) -- 0:00:52
799500 -- (-1369.612) (-1361.578) [-1364.775] (-1384.089) * [-1353.351] (-1387.177) (-1379.739) (-1383.526) -- 0:00:52
800000 -- (-1384.458) (-1369.676) [-1343.012] (-1383.386) * (-1365.665) (-1384.276) [-1379.705] (-1362.416) -- 0:00:52
Average standard deviation of split frequencies: 0.008302
800500 -- (-1367.857) [-1348.982] (-1366.544) (-1379.015) * (-1376.483) (-1387.445) [-1388.509] (-1368.646) -- 0:00:52
801000 -- (-1366.914) [-1363.246] (-1371.654) (-1363.820) * [-1358.468] (-1378.818) (-1390.238) (-1359.622) -- 0:00:52
801500 -- (-1372.129) [-1353.283] (-1375.516) (-1385.088) * (-1391.382) (-1376.426) (-1374.695) [-1353.099] -- 0:00:52
802000 -- [-1366.206] (-1362.092) (-1377.536) (-1386.950) * (-1378.349) (-1370.820) [-1360.229] (-1371.381) -- 0:00:52
802500 -- (-1366.807) [-1360.082] (-1376.793) (-1384.590) * (-1374.524) (-1366.644) [-1357.572] (-1371.195) -- 0:00:51
803000 -- [-1367.013] (-1376.541) (-1382.075) (-1377.845) * (-1376.107) (-1385.580) [-1355.586] (-1364.669) -- 0:00:51
803500 -- (-1347.173) (-1368.644) [-1361.482] (-1370.400) * (-1375.714) (-1384.364) (-1371.591) [-1372.723] -- 0:00:51
804000 -- (-1396.168) (-1372.593) [-1370.577] (-1377.848) * (-1373.044) [-1376.492] (-1374.100) (-1375.549) -- 0:00:51
804500 -- (-1387.485) (-1385.739) (-1365.416) [-1374.664] * [-1370.786] (-1361.748) (-1386.278) (-1375.242) -- 0:00:51
805000 -- (-1376.948) (-1379.611) (-1365.647) [-1375.737] * (-1359.478) (-1386.070) (-1382.574) [-1347.489] -- 0:00:51
Average standard deviation of split frequencies: 0.007925
805500 -- (-1358.521) [-1350.183] (-1375.687) (-1374.355) * [-1350.099] (-1381.970) (-1372.281) (-1371.936) -- 0:00:51
806000 -- (-1361.157) [-1376.373] (-1371.081) (-1392.560) * (-1370.523) (-1370.341) [-1351.188] (-1376.877) -- 0:00:51
806500 -- [-1369.077] (-1372.922) (-1370.575) (-1377.564) * [-1369.655] (-1384.080) (-1358.501) (-1377.089) -- 0:00:50
807000 -- (-1381.260) [-1355.891] (-1368.880) (-1385.607) * (-1376.041) [-1349.470] (-1353.583) (-1362.395) -- 0:00:50
807500 -- (-1398.818) (-1372.721) [-1355.464] (-1380.083) * (-1380.028) (-1374.059) (-1377.378) [-1355.083] -- 0:00:50
808000 -- (-1380.255) [-1366.200] (-1373.093) (-1381.139) * (-1389.264) (-1370.501) (-1388.192) [-1366.394] -- 0:00:50
808500 -- (-1386.151) [-1358.101] (-1369.802) (-1361.557) * (-1382.936) [-1373.388] (-1385.470) (-1363.965) -- 0:00:50
809000 -- (-1386.409) [-1349.985] (-1361.704) (-1379.060) * (-1380.238) (-1379.599) (-1381.902) [-1363.689] -- 0:00:50
809500 -- (-1379.526) [-1357.100] (-1378.821) (-1375.132) * (-1368.474) (-1372.798) (-1371.704) [-1364.986] -- 0:00:50
810000 -- (-1383.081) [-1347.172] (-1383.779) (-1386.300) * (-1369.651) (-1380.673) (-1378.490) [-1344.279] -- 0:00:49
Average standard deviation of split frequencies: 0.007647
810500 -- (-1381.754) [-1350.304] (-1387.078) (-1376.451) * (-1379.571) (-1370.941) (-1387.269) [-1359.963] -- 0:00:49
811000 -- (-1360.648) [-1343.516] (-1377.679) (-1367.536) * (-1383.155) [-1376.182] (-1382.590) (-1372.769) -- 0:00:49
811500 -- (-1361.489) [-1345.262] (-1379.523) (-1365.620) * (-1380.717) (-1371.884) (-1379.831) [-1366.690] -- 0:00:49
812000 -- (-1385.455) [-1350.274] (-1362.381) (-1389.004) * (-1393.194) (-1376.405) [-1362.692] (-1358.371) -- 0:00:49
812500 -- (-1377.918) [-1362.769] (-1367.620) (-1376.839) * (-1371.567) (-1375.842) [-1358.400] (-1348.489) -- 0:00:49
813000 -- (-1380.285) [-1365.391] (-1380.778) (-1362.471) * (-1383.748) (-1385.694) (-1388.473) [-1348.001] -- 0:00:49
813500 -- (-1378.391) (-1371.426) (-1381.626) [-1362.411] * (-1374.880) [-1369.408] (-1353.608) (-1370.764) -- 0:00:49
814000 -- [-1351.459] (-1384.024) (-1368.398) (-1354.041) * (-1373.477) (-1372.095) [-1347.191] (-1367.202) -- 0:00:48
814500 -- (-1366.430) (-1384.471) (-1376.009) [-1350.237] * (-1377.291) (-1376.862) (-1364.746) [-1368.493] -- 0:00:48
815000 -- (-1371.500) (-1368.487) (-1380.047) [-1349.659] * (-1376.074) (-1378.701) [-1388.059] (-1364.081) -- 0:00:48
Average standard deviation of split frequencies: 0.007308
815500 -- (-1366.915) (-1371.052) (-1386.643) [-1354.599] * (-1378.125) [-1370.029] (-1380.987) (-1379.625) -- 0:00:48
816000 -- (-1381.660) (-1369.392) (-1379.824) [-1347.503] * (-1382.396) (-1381.288) (-1382.434) [-1359.477] -- 0:00:48
816500 -- (-1366.825) (-1373.972) (-1377.253) [-1358.351] * (-1378.501) (-1372.751) (-1385.294) [-1364.100] -- 0:00:48
817000 -- (-1370.534) (-1350.217) (-1377.794) [-1354.877] * (-1380.469) [-1367.388] (-1373.474) (-1375.948) -- 0:00:48
817500 -- (-1366.364) [-1358.854] (-1380.896) (-1372.064) * (-1384.222) (-1380.310) (-1380.395) [-1360.568] -- 0:00:47
818000 -- (-1382.887) [-1359.314] (-1385.075) (-1365.953) * (-1371.655) (-1383.463) (-1379.766) [-1360.146] -- 0:00:47
818500 -- (-1363.564) [-1357.817] (-1369.862) (-1363.567) * (-1364.351) (-1374.000) (-1388.727) [-1362.447] -- 0:00:47
819000 -- (-1381.778) (-1361.864) (-1373.845) [-1365.640] * [-1353.148] (-1368.717) (-1384.225) (-1360.634) -- 0:00:47
819500 -- (-1367.483) (-1369.492) (-1384.731) [-1356.492] * [-1354.168] (-1379.242) (-1384.992) (-1377.012) -- 0:00:47
820000 -- (-1370.616) (-1354.046) (-1376.925) [-1362.330] * [-1356.309] (-1380.173) (-1382.925) (-1370.508) -- 0:00:47
Average standard deviation of split frequencies: 0.007439
820500 -- (-1363.550) (-1385.034) [-1356.766] (-1365.156) * [-1363.601] (-1387.362) (-1392.608) (-1371.036) -- 0:00:47
821000 -- (-1377.042) (-1379.914) (-1363.810) [-1357.499] * (-1371.971) (-1382.100) (-1383.480) [-1345.214] -- 0:00:47
821500 -- (-1378.675) (-1389.332) (-1359.556) [-1356.202] * (-1374.681) (-1378.773) (-1383.585) [-1346.609] -- 0:00:46
822000 -- (-1371.258) (-1383.777) (-1378.233) [-1352.012] * [-1347.437] (-1388.012) (-1372.968) (-1371.098) -- 0:00:46
822500 -- [-1358.909] (-1383.275) (-1381.027) (-1380.255) * [-1363.811] (-1379.172) (-1382.870) (-1366.821) -- 0:00:46
823000 -- [-1360.728] (-1379.951) (-1397.741) (-1370.201) * (-1383.968) (-1375.735) [-1361.617] (-1353.815) -- 0:00:46
823500 -- [-1364.419] (-1374.200) (-1357.300) (-1375.207) * (-1380.014) (-1371.551) (-1374.163) [-1363.150] -- 0:00:46
824000 -- (-1364.553) (-1377.313) [-1353.013] (-1360.922) * (-1382.559) [-1352.302] (-1369.124) (-1377.854) -- 0:00:46
824500 -- (-1383.746) (-1368.955) (-1360.871) [-1354.712] * (-1375.632) (-1387.732) [-1361.948] (-1379.943) -- 0:00:46
825000 -- (-1390.972) (-1368.567) [-1366.656] (-1373.584) * (-1362.845) (-1376.445) [-1351.905] (-1375.722) -- 0:00:46
Average standard deviation of split frequencies: 0.007733
825500 -- (-1384.177) (-1370.355) [-1354.493] (-1359.849) * (-1356.191) (-1372.585) [-1355.966] (-1382.636) -- 0:00:45
826000 -- (-1393.331) (-1372.698) [-1345.708] (-1387.791) * (-1365.901) (-1400.999) [-1346.705] (-1370.658) -- 0:00:45
826500 -- (-1392.469) [-1357.968] (-1347.520) (-1378.987) * (-1355.503) (-1393.042) [-1353.425] (-1384.326) -- 0:00:45
827000 -- (-1378.969) [-1365.018] (-1357.637) (-1379.861) * (-1351.289) (-1389.301) [-1361.773] (-1371.958) -- 0:00:45
827500 -- (-1372.015) [-1363.016] (-1363.185) (-1373.794) * (-1387.978) (-1391.050) [-1362.246] (-1367.190) -- 0:00:45
828000 -- (-1366.715) [-1358.771] (-1371.282) (-1375.861) * (-1379.503) (-1385.299) (-1379.477) [-1354.049] -- 0:00:45
828500 -- (-1384.448) (-1378.361) [-1360.286] (-1374.346) * [-1370.531] (-1390.974) (-1375.109) (-1370.914) -- 0:00:45
829000 -- (-1372.291) (-1385.688) [-1345.363] (-1377.420) * (-1363.092) (-1367.016) (-1368.876) [-1353.225] -- 0:00:44
829500 -- [-1372.037] (-1377.837) (-1348.487) (-1380.792) * (-1366.501) (-1379.494) (-1362.327) [-1345.451] -- 0:00:44
830000 -- (-1367.698) (-1359.451) [-1340.570] (-1361.699) * [-1359.437] (-1382.246) (-1378.391) (-1352.764) -- 0:00:44
Average standard deviation of split frequencies: 0.008257
830500 -- (-1379.489) (-1360.258) (-1366.797) [-1366.083] * [-1358.045] (-1380.896) (-1373.037) (-1370.804) -- 0:00:44
831000 -- (-1380.489) (-1373.028) [-1358.877] (-1368.879) * (-1370.098) (-1377.057) (-1378.842) [-1348.183] -- 0:00:44
831500 -- (-1390.353) [-1359.376] (-1364.648) (-1364.613) * (-1369.885) (-1383.515) (-1366.071) [-1372.824] -- 0:00:44
832000 -- (-1378.616) [-1356.850] (-1384.130) (-1369.066) * (-1362.124) (-1383.507) (-1370.172) [-1376.342] -- 0:00:44
832500 -- (-1386.876) (-1364.168) (-1389.323) [-1361.497] * (-1379.267) (-1373.539) [-1361.773] (-1366.143) -- 0:00:44
833000 -- (-1381.577) [-1354.222] (-1382.034) (-1369.522) * (-1353.375) [-1363.992] (-1376.135) (-1398.598) -- 0:00:43
833500 -- (-1378.292) [-1357.122] (-1383.615) (-1368.108) * (-1371.353) [-1356.681] (-1377.216) (-1393.179) -- 0:00:43
834000 -- (-1381.697) [-1356.364] (-1389.254) (-1383.407) * (-1369.487) [-1365.798] (-1373.984) (-1394.011) -- 0:00:43
834500 -- [-1344.935] (-1369.827) (-1378.231) (-1375.898) * [-1354.643] (-1375.397) (-1380.481) (-1378.362) -- 0:00:43
835000 -- (-1375.401) [-1361.661] (-1384.139) (-1385.059) * [-1359.263] (-1362.945) (-1377.757) (-1376.980) -- 0:00:43
Average standard deviation of split frequencies: 0.007838
835500 -- (-1375.807) [-1351.483] (-1381.803) (-1364.093) * [-1369.075] (-1366.977) (-1366.674) (-1381.528) -- 0:00:43
836000 -- (-1381.361) [-1356.674] (-1382.829) (-1367.758) * (-1372.322) [-1357.931] (-1372.015) (-1380.645) -- 0:00:43
836500 -- (-1373.073) [-1344.903] (-1376.786) (-1381.017) * [-1365.276] (-1383.264) (-1385.185) (-1383.214) -- 0:00:43
837000 -- (-1362.652) [-1356.693] (-1380.488) (-1377.166) * [-1357.111] (-1369.393) (-1380.452) (-1364.076) -- 0:00:42
837500 -- (-1381.741) [-1371.039] (-1392.216) (-1378.720) * (-1359.842) (-1369.274) (-1389.831) [-1342.544] -- 0:00:42
838000 -- (-1370.728) [-1343.861] (-1385.070) (-1365.425) * (-1368.555) (-1374.345) (-1383.591) [-1350.192] -- 0:00:42
838500 -- (-1383.977) [-1346.011] (-1387.571) (-1358.298) * (-1378.045) (-1372.632) (-1382.328) [-1343.913] -- 0:00:42
839000 -- (-1364.069) [-1360.906] (-1379.595) (-1369.215) * [-1363.403] (-1374.994) (-1388.846) (-1367.835) -- 0:00:42
839500 -- (-1372.960) [-1348.169] (-1370.789) (-1382.014) * (-1361.937) (-1375.695) (-1381.747) [-1366.314] -- 0:00:42
840000 -- (-1383.607) [-1363.482] (-1382.702) (-1374.323) * (-1362.047) (-1383.691) [-1359.491] (-1376.373) -- 0:00:42
Average standard deviation of split frequencies: 0.008019
840500 -- (-1374.835) (-1368.657) [-1358.237] (-1369.297) * (-1375.655) (-1387.890) [-1346.260] (-1368.976) -- 0:00:41
841000 -- (-1374.068) (-1357.933) [-1355.870] (-1381.359) * (-1375.247) (-1378.759) [-1351.058] (-1361.365) -- 0:00:41
841500 -- [-1347.645] (-1369.990) (-1371.857) (-1382.400) * (-1392.681) (-1379.400) (-1351.582) [-1365.480] -- 0:00:41
842000 -- [-1357.612] (-1375.432) (-1360.018) (-1378.830) * (-1386.108) (-1376.403) [-1348.020] (-1367.986) -- 0:00:41
842500 -- (-1374.115) (-1376.662) [-1358.694] (-1379.435) * (-1368.221) [-1370.072] (-1374.319) (-1389.911) -- 0:00:41
843000 -- [-1361.763] (-1380.035) (-1365.884) (-1371.710) * (-1376.396) (-1374.518) (-1389.318) [-1371.298] -- 0:00:41
843500 -- [-1354.113] (-1377.148) (-1357.550) (-1373.449) * [-1373.582] (-1377.712) (-1378.765) (-1361.143) -- 0:00:41
844000 -- [-1336.312] (-1369.325) (-1364.476) (-1376.996) * [-1360.269] (-1389.098) (-1376.560) (-1366.984) -- 0:00:41
844500 -- [-1337.701] (-1379.036) (-1370.021) (-1359.726) * (-1364.405) (-1378.615) (-1382.062) [-1363.643] -- 0:00:40
845000 -- [-1341.028] (-1377.618) (-1365.828) (-1361.770) * (-1370.523) (-1390.426) (-1375.287) [-1348.518] -- 0:00:40
Average standard deviation of split frequencies: 0.007634
845500 -- (-1367.350) (-1373.617) (-1369.559) [-1360.499] * (-1362.781) (-1380.623) (-1379.873) [-1368.489] -- 0:00:40
846000 -- [-1342.474] (-1375.835) (-1375.761) (-1369.824) * (-1351.896) (-1385.841) [-1380.449] (-1379.567) -- 0:00:40
846500 -- (-1366.940) (-1375.126) [-1372.161] (-1363.675) * (-1362.017) (-1378.992) (-1380.018) [-1367.758] -- 0:00:40
847000 -- (-1370.319) (-1369.381) (-1388.907) [-1351.955] * [-1356.974] (-1383.201) (-1375.108) (-1369.741) -- 0:00:40
847500 -- (-1359.124) [-1346.624] (-1378.398) (-1377.080) * [-1359.163] (-1377.444) (-1371.691) (-1368.200) -- 0:00:40
848000 -- [-1345.701] (-1357.199) (-1376.902) (-1371.857) * (-1368.697) (-1379.443) (-1370.914) [-1364.077] -- 0:00:39
848500 -- [-1358.771] (-1361.625) (-1377.093) (-1372.988) * [-1350.914] (-1382.297) (-1388.348) (-1366.401) -- 0:00:39
849000 -- (-1378.320) (-1370.147) (-1385.835) [-1362.818] * [-1348.553] (-1380.249) (-1382.544) (-1363.950) -- 0:00:39
849500 -- (-1387.948) [-1344.703] (-1391.273) (-1382.957) * (-1354.724) [-1364.757] (-1386.844) (-1380.958) -- 0:00:39
850000 -- (-1386.660) (-1362.935) (-1379.510) [-1366.221] * (-1364.631) (-1371.468) (-1391.804) [-1357.557] -- 0:00:39
Average standard deviation of split frequencies: 0.007592
850500 -- (-1379.859) [-1349.915] (-1368.079) (-1369.130) * (-1383.962) (-1367.851) [-1381.089] (-1367.740) -- 0:00:39
851000 -- (-1380.713) (-1370.991) (-1383.509) [-1360.946] * [-1357.885] (-1355.642) (-1394.560) (-1376.001) -- 0:00:39
851500 -- (-1375.285) [-1356.616] (-1355.007) (-1365.116) * (-1377.415) [-1355.990] (-1391.086) (-1355.291) -- 0:00:39
852000 -- (-1366.837) (-1367.979) [-1354.712] (-1391.579) * (-1369.967) [-1348.904] (-1368.345) (-1364.013) -- 0:00:38
852500 -- (-1377.511) [-1356.074] (-1355.694) (-1369.097) * (-1371.624) [-1345.694] (-1383.638) (-1363.743) -- 0:00:38
853000 -- (-1371.101) [-1361.326] (-1355.010) (-1381.510) * (-1384.751) (-1358.748) [-1376.788] (-1363.305) -- 0:00:38
853500 -- (-1374.245) [-1368.875] (-1369.711) (-1375.632) * (-1377.450) [-1351.164] (-1358.184) (-1374.947) -- 0:00:38
854000 -- (-1373.873) [-1364.710] (-1375.150) (-1372.053) * (-1383.499) (-1360.556) [-1354.951] (-1364.808) -- 0:00:38
854500 -- [-1362.334] (-1356.969) (-1382.532) (-1370.881) * (-1381.639) (-1367.790) (-1374.403) [-1363.585] -- 0:00:38
855000 -- (-1365.161) (-1376.894) [-1368.654] (-1384.223) * [-1350.475] (-1371.440) (-1373.070) (-1375.280) -- 0:00:38
Average standard deviation of split frequencies: 0.007682
855500 -- (-1378.696) (-1382.840) (-1370.858) [-1361.360] * [-1361.143] (-1382.869) (-1381.358) (-1373.785) -- 0:00:38
856000 -- (-1375.997) [-1360.176] (-1362.250) (-1371.608) * (-1381.505) (-1387.842) (-1363.337) [-1371.588] -- 0:00:37
856500 -- (-1382.617) (-1357.872) [-1363.535] (-1379.164) * (-1379.235) (-1378.219) [-1353.742] (-1360.161) -- 0:00:37
857000 -- (-1370.881) [-1346.172] (-1365.321) (-1376.676) * (-1385.388) (-1377.882) (-1356.566) [-1356.503] -- 0:00:37
857500 -- [-1349.131] (-1355.962) (-1375.662) (-1388.621) * (-1379.109) (-1382.016) [-1355.066] (-1365.079) -- 0:00:37
858000 -- [-1351.186] (-1371.291) (-1388.789) (-1352.165) * (-1383.372) (-1369.110) [-1362.451] (-1392.139) -- 0:00:37
858500 -- (-1384.322) [-1352.366] (-1377.247) (-1368.597) * (-1376.933) [-1352.757] (-1377.538) (-1382.584) -- 0:00:37
859000 -- [-1362.757] (-1367.175) (-1384.359) (-1369.812) * (-1385.121) [-1348.786] (-1369.485) (-1369.088) -- 0:00:37
859500 -- [-1344.532] (-1364.441) (-1386.646) (-1375.921) * (-1393.758) [-1360.746] (-1357.529) (-1382.805) -- 0:00:36
860000 -- [-1351.341] (-1369.293) (-1376.566) (-1381.505) * (-1380.414) (-1351.913) [-1343.033] (-1372.889) -- 0:00:36
Average standard deviation of split frequencies: 0.007367
860500 -- [-1359.097] (-1363.132) (-1376.516) (-1389.977) * (-1382.107) (-1371.130) (-1352.532) [-1373.213] -- 0:00:36
861000 -- [-1353.048] (-1369.691) (-1381.850) (-1382.450) * (-1385.181) (-1379.753) [-1353.844] (-1381.657) -- 0:00:36
861500 -- (-1378.975) [-1351.135] (-1379.350) (-1386.507) * (-1383.155) (-1385.400) [-1358.995] (-1371.985) -- 0:00:36
862000 -- (-1366.418) (-1370.873) [-1359.311] (-1388.625) * (-1381.995) (-1381.733) [-1381.966] (-1366.274) -- 0:00:36
862500 -- (-1375.381) (-1377.312) [-1353.424] (-1386.216) * (-1386.544) (-1385.784) (-1387.228) [-1371.585] -- 0:00:36
863000 -- (-1380.567) [-1363.073] (-1383.203) (-1350.321) * (-1379.930) (-1380.732) (-1395.770) [-1346.408] -- 0:00:36
863500 -- (-1377.706) (-1367.520) (-1373.922) [-1360.515] * (-1382.208) [-1375.608] (-1377.600) (-1352.035) -- 0:00:35
864000 -- [-1367.566] (-1377.497) (-1383.915) (-1367.452) * [-1369.393] (-1374.324) (-1362.103) (-1374.685) -- 0:00:35
864500 -- [-1344.634] (-1382.812) (-1364.168) (-1369.661) * (-1374.392) [-1353.825] (-1385.768) (-1374.455) -- 0:00:35
865000 -- (-1372.985) (-1384.311) [-1354.839] (-1369.604) * (-1375.999) [-1356.297] (-1382.575) (-1384.404) -- 0:00:35
Average standard deviation of split frequencies: 0.007485
865500 -- (-1377.876) (-1385.942) (-1369.375) [-1345.189] * [-1362.818] (-1366.301) (-1380.819) (-1384.045) -- 0:00:35
866000 -- (-1365.093) (-1391.369) (-1373.815) [-1348.974] * [-1351.115] (-1363.170) (-1382.810) (-1387.343) -- 0:00:35
866500 -- [-1352.015] (-1381.505) (-1378.841) (-1351.541) * [-1364.321] (-1371.224) (-1381.605) (-1383.166) -- 0:00:35
867000 -- (-1370.024) (-1386.350) (-1362.161) [-1347.102] * (-1380.193) [-1352.319] (-1369.559) (-1387.006) -- 0:00:34
867500 -- (-1375.556) (-1385.691) (-1369.856) [-1351.524] * (-1367.461) [-1360.417] (-1376.699) (-1388.152) -- 0:00:34
868000 -- (-1363.149) (-1375.771) (-1376.724) [-1373.216] * (-1384.450) [-1353.456] (-1357.165) (-1379.200) -- 0:00:34
868500 -- [-1346.365] (-1384.710) (-1371.679) (-1368.539) * (-1384.486) (-1369.856) (-1354.406) [-1375.373] -- 0:00:34
869000 -- (-1370.209) (-1370.427) (-1381.622) [-1350.804] * (-1380.305) (-1353.701) [-1362.348] (-1383.595) -- 0:00:34
869500 -- (-1359.245) (-1381.011) (-1371.569) [-1364.371] * (-1382.136) (-1363.624) [-1354.808] (-1383.582) -- 0:00:34
870000 -- (-1357.188) (-1383.070) [-1355.732] (-1370.947) * (-1371.947) [-1350.604] (-1373.889) (-1358.193) -- 0:00:34
Average standard deviation of split frequencies: 0.007580
870500 -- [-1363.853] (-1381.968) (-1371.407) (-1356.429) * [-1356.668] (-1355.712) (-1391.802) (-1361.191) -- 0:00:34
871000 -- (-1348.169) (-1384.126) (-1374.741) [-1363.910] * (-1396.471) (-1352.575) (-1381.747) [-1355.183] -- 0:00:33
871500 -- [-1351.037] (-1371.839) (-1374.760) (-1349.510) * (-1366.396) (-1351.657) (-1394.923) [-1338.572] -- 0:00:33
872000 -- (-1374.493) (-1371.528) (-1353.234) [-1363.791] * (-1352.437) (-1376.621) (-1389.835) [-1345.619] -- 0:00:33
872500 -- [-1368.496] (-1376.363) (-1374.375) (-1362.071) * [-1356.059] (-1373.940) (-1383.876) (-1359.127) -- 0:00:33
873000 -- (-1369.726) [-1356.638] (-1372.249) (-1365.779) * (-1347.875) (-1373.041) [-1377.499] (-1368.025) -- 0:00:33
873500 -- (-1382.560) (-1378.661) (-1386.166) [-1362.207] * (-1380.105) [-1369.750] (-1390.630) (-1361.954) -- 0:00:33
874000 -- (-1381.227) (-1375.963) (-1373.529) [-1356.304] * (-1361.880) (-1371.695) (-1383.870) [-1344.516] -- 0:00:33
874500 -- [-1369.918] (-1382.829) (-1370.512) (-1364.120) * (-1377.885) (-1371.054) (-1381.077) [-1350.766] -- 0:00:33
875000 -- [-1364.074] (-1360.821) (-1361.970) (-1374.858) * (-1379.462) [-1364.263] (-1381.074) (-1361.187) -- 0:00:32
Average standard deviation of split frequencies: 0.007050
875500 -- (-1359.983) [-1373.019] (-1381.161) (-1379.820) * (-1378.903) [-1357.270] (-1369.743) (-1372.038) -- 0:00:32
876000 -- (-1372.959) (-1384.293) (-1379.218) [-1363.809] * (-1398.858) [-1356.927] (-1361.555) (-1369.822) -- 0:00:32
876500 -- (-1376.052) (-1388.302) (-1367.471) [-1345.879] * (-1390.212) (-1373.307) (-1375.667) [-1365.358] -- 0:00:32
877000 -- (-1372.854) (-1385.663) (-1375.781) [-1347.450] * (-1379.064) (-1382.816) (-1368.885) [-1366.412] -- 0:00:32
877500 -- (-1378.674) (-1382.415) (-1371.774) [-1360.450] * (-1381.440) [-1370.386] (-1368.682) (-1377.436) -- 0:00:32
878000 -- (-1378.786) (-1369.780) (-1367.896) [-1372.748] * (-1381.974) [-1353.228] (-1369.641) (-1393.034) -- 0:00:32
878500 -- (-1384.875) (-1374.678) (-1368.260) [-1358.456] * (-1382.356) [-1360.925] (-1374.860) (-1372.663) -- 0:00:31
879000 -- (-1371.091) (-1371.895) [-1351.500] (-1356.517) * (-1382.735) (-1356.321) [-1370.807] (-1386.548) -- 0:00:31
879500 -- (-1375.316) (-1372.696) [-1359.581] (-1368.759) * (-1376.547) [-1367.260] (-1374.826) (-1385.159) -- 0:00:31
880000 -- (-1380.961) (-1355.438) [-1345.934] (-1374.721) * (-1392.932) [-1365.295] (-1369.805) (-1387.977) -- 0:00:31
Average standard deviation of split frequencies: 0.007307
880500 -- (-1367.340) [-1367.585] (-1367.323) (-1380.482) * (-1388.225) (-1376.328) [-1361.377] (-1376.289) -- 0:00:31
881000 -- (-1395.356) (-1368.324) (-1384.039) [-1366.806] * (-1389.101) (-1355.812) [-1363.069] (-1380.709) -- 0:00:31
881500 -- (-1368.445) [-1353.837] (-1379.447) (-1372.274) * (-1379.258) [-1358.620] (-1366.978) (-1384.694) -- 0:00:31
882000 -- (-1365.177) [-1363.935] (-1384.601) (-1377.996) * (-1372.608) [-1368.908] (-1377.671) (-1383.820) -- 0:00:31
882500 -- [-1356.083] (-1355.892) (-1376.664) (-1390.188) * (-1387.595) (-1380.500) [-1357.596] (-1383.418) -- 0:00:30
883000 -- (-1367.832) [-1352.928] (-1381.917) (-1377.782) * (-1367.544) (-1380.864) (-1383.102) [-1368.276] -- 0:00:30
883500 -- (-1376.572) [-1355.580] (-1383.148) (-1391.020) * (-1388.790) (-1376.608) [-1370.946] (-1378.436) -- 0:00:30
884000 -- [-1356.481] (-1371.504) (-1387.982) (-1373.652) * [-1352.897] (-1381.514) (-1373.617) (-1385.059) -- 0:00:30
884500 -- [-1355.655] (-1378.418) (-1384.275) (-1378.491) * (-1358.795) (-1385.836) [-1357.244] (-1379.670) -- 0:00:30
885000 -- (-1378.907) (-1361.728) (-1379.829) [-1356.474] * [-1360.009] (-1381.195) (-1373.598) (-1387.819) -- 0:00:30
Average standard deviation of split frequencies: 0.006943
885500 -- [-1364.597] (-1376.178) (-1386.644) (-1375.392) * [-1348.590] (-1370.038) (-1365.121) (-1375.231) -- 0:00:30
886000 -- [-1358.792] (-1374.556) (-1378.243) (-1373.617) * [-1350.728] (-1375.849) (-1380.200) (-1377.055) -- 0:00:29
886500 -- (-1369.860) [-1360.544] (-1374.276) (-1375.095) * [-1345.207] (-1375.622) (-1372.277) (-1374.397) -- 0:00:29
887000 -- (-1381.692) [-1364.308] (-1374.064) (-1379.777) * [-1350.332] (-1366.979) (-1382.286) (-1382.011) -- 0:00:29
887500 -- (-1372.921) (-1367.345) (-1385.875) [-1366.993] * [-1347.610] (-1362.628) (-1385.300) (-1369.630) -- 0:00:29
888000 -- (-1360.293) (-1363.601) [-1357.622] (-1375.818) * [-1347.415] (-1378.762) (-1367.520) (-1365.185) -- 0:00:29
888500 -- [-1365.161] (-1376.794) (-1356.490) (-1385.192) * (-1367.259) [-1372.826] (-1378.378) (-1388.688) -- 0:00:29
889000 -- [-1366.228] (-1357.878) (-1358.632) (-1378.938) * [-1344.038] (-1359.628) (-1385.031) (-1371.598) -- 0:00:29
889500 -- (-1380.127) (-1381.872) [-1358.502] (-1360.557) * (-1354.817) [-1345.294] (-1377.458) (-1382.626) -- 0:00:29
890000 -- (-1383.336) (-1371.108) (-1368.272) [-1352.803] * (-1379.679) (-1363.728) (-1375.915) [-1353.554] -- 0:00:28
Average standard deviation of split frequencies: 0.006431
890500 -- (-1384.185) (-1368.557) [-1370.472] (-1378.244) * (-1381.061) (-1354.897) (-1383.162) [-1359.712] -- 0:00:28
891000 -- (-1384.767) (-1372.298) [-1352.966] (-1373.812) * (-1358.641) (-1360.533) (-1385.532) [-1356.546] -- 0:00:28
891500 -- (-1388.913) (-1385.322) [-1365.086] (-1378.604) * (-1379.959) (-1372.451) (-1372.843) [-1360.049] -- 0:00:28
892000 -- (-1383.707) (-1373.154) [-1351.773] (-1380.265) * [-1360.040] (-1374.154) (-1377.582) (-1375.390) -- 0:00:28
892500 -- (-1380.768) (-1384.183) [-1357.456] (-1377.613) * [-1343.443] (-1374.958) (-1386.609) (-1384.391) -- 0:00:28
893000 -- (-1380.550) [-1361.653] (-1348.915) (-1375.528) * [-1340.189] (-1361.066) (-1375.902) (-1389.152) -- 0:00:28
893500 -- (-1359.399) (-1381.190) [-1350.432] (-1387.321) * [-1356.683] (-1361.365) (-1380.972) (-1377.197) -- 0:00:28
894000 -- (-1374.289) (-1368.976) [-1352.805] (-1382.693) * (-1366.214) [-1363.746] (-1366.305) (-1375.544) -- 0:00:27
894500 -- (-1385.660) (-1391.355) [-1367.651] (-1369.102) * (-1377.053) (-1374.042) [-1358.566] (-1354.141) -- 0:00:27
895000 -- [-1371.962] (-1370.490) (-1357.558) (-1376.574) * (-1377.423) (-1376.516) (-1376.673) [-1367.280] -- 0:00:27
Average standard deviation of split frequencies: 0.006287
895500 -- [-1360.437] (-1383.103) (-1373.641) (-1379.003) * (-1371.853) [-1350.551] (-1384.342) (-1349.991) -- 0:00:27
896000 -- [-1349.462] (-1376.175) (-1366.708) (-1379.891) * (-1379.767) (-1371.233) (-1389.569) [-1356.289] -- 0:00:27
896500 -- [-1352.389] (-1369.853) (-1380.699) (-1373.504) * (-1368.860) (-1373.968) (-1368.558) [-1359.401] -- 0:00:27
897000 -- (-1362.045) (-1377.724) [-1355.793] (-1362.393) * (-1369.866) [-1357.307] (-1393.963) (-1378.703) -- 0:00:27
897500 -- (-1374.463) [-1361.751] (-1365.356) (-1365.133) * [-1369.414] (-1372.636) (-1377.576) (-1377.050) -- 0:00:26
898000 -- (-1365.618) (-1382.231) (-1353.351) [-1352.603] * (-1369.222) [-1361.941] (-1385.713) (-1388.680) -- 0:00:26
898500 -- (-1372.338) (-1380.272) (-1381.638) [-1353.824] * (-1380.503) [-1355.223] (-1396.995) (-1372.448) -- 0:00:26
899000 -- (-1382.449) (-1376.701) (-1387.150) [-1354.514] * (-1378.946) (-1371.588) (-1386.940) [-1354.869] -- 0:00:26
899500 -- (-1367.713) [-1375.825] (-1393.702) (-1368.906) * (-1378.725) [-1372.387] (-1385.452) (-1372.796) -- 0:00:26
900000 -- (-1375.848) (-1379.851) [-1375.168] (-1383.645) * (-1373.219) (-1378.083) (-1383.271) [-1364.888] -- 0:00:26
Average standard deviation of split frequencies: 0.006385
900500 -- (-1380.774) (-1368.615) (-1379.742) [-1378.706] * [-1372.668] (-1383.718) (-1380.158) (-1378.823) -- 0:00:26
901000 -- (-1359.676) (-1371.054) [-1362.271] (-1373.931) * [-1357.267] (-1377.884) (-1391.099) (-1371.318) -- 0:00:26
901500 -- (-1376.704) (-1372.710) [-1364.809] (-1362.705) * [-1344.954] (-1371.524) (-1382.447) (-1369.000) -- 0:00:25
902000 -- [-1356.526] (-1377.885) (-1359.370) (-1383.962) * (-1347.102) (-1373.320) (-1382.433) [-1372.312] -- 0:00:25
902500 -- (-1370.223) (-1378.812) [-1351.948] (-1372.216) * [-1361.174] (-1385.495) (-1380.088) (-1370.499) -- 0:00:25
903000 -- [-1350.033] (-1362.394) (-1367.619) (-1385.398) * (-1388.019) (-1379.671) (-1370.864) [-1357.053] -- 0:00:25
903500 -- [-1372.795] (-1373.588) (-1382.976) (-1373.074) * (-1377.152) [-1370.121] (-1372.314) (-1353.841) -- 0:00:25
904000 -- (-1379.413) [-1361.319] (-1376.725) (-1372.470) * (-1383.313) (-1369.052) [-1351.523] (-1366.852) -- 0:00:25
904500 -- (-1375.005) [-1350.172] (-1366.536) (-1376.252) * (-1383.969) [-1349.758] (-1360.427) (-1372.751) -- 0:00:25
905000 -- (-1377.413) [-1358.564] (-1362.899) (-1378.213) * (-1375.327) [-1371.572] (-1367.918) (-1380.501) -- 0:00:24
Average standard deviation of split frequencies: 0.006478
905500 -- (-1375.468) [-1361.517] (-1367.963) (-1372.384) * (-1380.166) [-1362.669] (-1377.065) (-1383.091) -- 0:00:24
906000 -- (-1363.600) (-1386.028) [-1362.540] (-1392.712) * [-1367.553] (-1369.786) (-1385.430) (-1381.747) -- 0:00:24
906500 -- (-1370.250) (-1375.625) [-1361.171] (-1377.953) * (-1372.143) (-1359.173) [-1367.524] (-1398.073) -- 0:00:24
907000 -- [-1353.059] (-1371.992) (-1369.522) (-1381.316) * (-1388.508) (-1343.097) [-1364.362] (-1377.704) -- 0:00:24
907500 -- [-1367.949] (-1370.443) (-1372.538) (-1387.665) * (-1371.208) [-1373.832] (-1350.259) (-1379.855) -- 0:00:24
908000 -- [-1362.785] (-1376.031) (-1369.823) (-1380.987) * (-1353.449) (-1374.859) [-1342.756] (-1390.827) -- 0:00:24
908500 -- (-1372.145) (-1385.555) (-1376.651) [-1369.420] * [-1351.975] (-1382.819) (-1362.881) (-1373.772) -- 0:00:24
909000 -- [-1364.299] (-1385.863) (-1379.315) (-1364.782) * [-1364.346] (-1372.417) (-1378.761) (-1383.279) -- 0:00:23
909500 -- (-1371.989) (-1381.733) (-1359.386) [-1358.742] * [-1358.140] (-1383.139) (-1388.782) (-1376.597) -- 0:00:23
910000 -- (-1360.102) (-1383.678) [-1352.340] (-1361.227) * [-1351.119] (-1390.086) (-1387.831) (-1367.352) -- 0:00:23
Average standard deviation of split frequencies: 0.006652
910500 -- (-1376.376) (-1395.470) (-1369.077) [-1352.098] * [-1357.712] (-1380.984) (-1384.222) (-1372.956) -- 0:00:23
911000 -- [-1379.560] (-1389.934) (-1381.308) (-1378.841) * [-1362.341] (-1375.718) (-1390.975) (-1380.457) -- 0:00:23
911500 -- [-1357.619] (-1379.903) (-1381.000) (-1374.667) * (-1374.884) [-1366.015] (-1387.890) (-1374.519) -- 0:00:23
912000 -- (-1365.227) (-1390.567) (-1380.011) [-1361.548] * [-1369.986] (-1373.303) (-1380.219) (-1383.717) -- 0:00:23
912500 -- [-1353.423] (-1381.853) (-1387.047) (-1378.824) * [-1369.918] (-1378.594) (-1385.226) (-1370.067) -- 0:00:23
913000 -- [-1356.211] (-1372.133) (-1376.534) (-1364.026) * [-1369.523] (-1376.440) (-1373.766) (-1371.415) -- 0:00:22
913500 -- (-1370.033) [-1368.100] (-1350.545) (-1384.134) * (-1368.849) (-1374.060) (-1386.240) [-1371.898] -- 0:00:22
914000 -- [-1375.121] (-1383.562) (-1395.887) (-1368.567) * (-1377.154) (-1383.546) [-1351.790] (-1370.557) -- 0:00:22
914500 -- (-1377.725) (-1379.206) (-1361.795) [-1355.634] * (-1371.850) (-1374.424) (-1373.457) [-1375.176] -- 0:00:22
915000 -- [-1364.985] (-1380.308) (-1391.311) (-1369.029) * [-1366.902] (-1378.953) (-1381.921) (-1377.935) -- 0:00:22
Average standard deviation of split frequencies: 0.006279
915500 -- [-1350.424] (-1392.539) (-1386.754) (-1383.858) * (-1373.097) (-1385.619) (-1379.485) [-1367.442] -- 0:00:22
916000 -- [-1352.497] (-1387.117) (-1374.802) (-1367.616) * (-1366.265) (-1382.284) [-1371.769] (-1373.031) -- 0:00:22
916500 -- [-1365.759] (-1377.042) (-1379.898) (-1372.387) * (-1370.017) (-1362.470) [-1356.590] (-1376.716) -- 0:00:21
917000 -- [-1367.893] (-1382.443) (-1366.092) (-1374.836) * (-1382.245) (-1365.293) [-1354.196] (-1366.798) -- 0:00:21
917500 -- (-1362.672) (-1369.614) [-1361.838] (-1390.894) * (-1368.994) [-1366.279] (-1358.125) (-1372.330) -- 0:00:21
918000 -- [-1350.225] (-1383.907) (-1355.310) (-1386.670) * (-1380.455) (-1370.413) [-1350.694] (-1382.846) -- 0:00:21
918500 -- [-1347.381] (-1370.139) (-1376.138) (-1381.806) * (-1380.422) [-1384.749] (-1374.374) (-1384.234) -- 0:00:21
919000 -- (-1377.796) [-1373.762] (-1390.946) (-1367.466) * (-1372.038) (-1379.984) [-1356.771] (-1371.020) -- 0:00:21
919500 -- (-1375.716) [-1371.415] (-1378.468) (-1364.438) * (-1369.382) (-1376.053) [-1365.618] (-1365.998) -- 0:00:21
920000 -- (-1401.509) (-1372.728) (-1380.918) [-1360.074] * (-1366.729) (-1374.972) [-1358.082] (-1370.621) -- 0:00:21
Average standard deviation of split frequencies: 0.005965
920500 -- (-1395.699) [-1368.057] (-1374.499) (-1371.970) * [-1365.675] (-1380.407) (-1362.557) (-1377.590) -- 0:00:20
921000 -- (-1388.608) (-1374.507) (-1375.693) [-1352.442] * (-1376.442) [-1364.375] (-1377.492) (-1369.548) -- 0:00:20
921500 -- (-1388.131) (-1384.589) (-1374.447) [-1358.563] * (-1375.955) (-1364.263) (-1382.108) [-1364.189] -- 0:00:20
922000 -- (-1368.301) (-1380.438) (-1381.645) [-1375.145] * (-1385.579) (-1363.011) [-1348.327] (-1385.922) -- 0:00:20
922500 -- [-1355.743] (-1385.352) (-1368.224) (-1377.659) * (-1382.233) (-1378.025) [-1354.961] (-1386.550) -- 0:00:20
923000 -- (-1359.700) (-1378.708) (-1369.376) [-1361.451] * [-1363.551] (-1382.931) (-1362.686) (-1376.243) -- 0:00:20
923500 -- (-1368.241) (-1381.563) (-1369.323) [-1362.595] * (-1378.093) (-1388.494) (-1366.323) [-1352.799] -- 0:00:20
924000 -- (-1376.556) (-1381.597) [-1357.071] (-1359.181) * (-1383.419) [-1359.796] (-1362.358) (-1360.101) -- 0:00:19
924500 -- (-1377.681) (-1379.667) [-1357.510] (-1367.687) * (-1371.155) (-1346.315) [-1364.939] (-1365.122) -- 0:00:19
925000 -- (-1382.082) (-1376.095) [-1362.607] (-1393.601) * (-1369.167) (-1391.634) (-1371.875) [-1344.840] -- 0:00:19
Average standard deviation of split frequencies: 0.005982
925500 -- (-1381.985) (-1388.618) [-1365.337] (-1400.654) * (-1380.727) (-1383.135) [-1361.465] (-1364.781) -- 0:00:19
926000 -- [-1350.187] (-1375.051) (-1370.303) (-1370.995) * (-1375.858) [-1361.132] (-1369.907) (-1380.620) -- 0:00:19
926500 -- [-1343.377] (-1375.727) (-1375.150) (-1373.474) * (-1366.580) [-1346.392] (-1381.308) (-1357.874) -- 0:00:19
927000 -- (-1365.093) [-1364.117] (-1361.037) (-1364.800) * (-1375.613) (-1367.024) (-1378.719) [-1354.594] -- 0:00:19
927500 -- (-1355.877) (-1363.226) (-1371.688) [-1371.502] * (-1371.738) [-1353.152] (-1380.119) (-1376.590) -- 0:00:19
928000 -- (-1370.342) [-1356.056] (-1381.546) (-1372.831) * (-1373.858) [-1369.543] (-1374.966) (-1371.611) -- 0:00:18
928500 -- (-1382.047) [-1354.549] (-1384.597) (-1360.101) * (-1361.957) (-1367.728) [-1377.248] (-1372.186) -- 0:00:18
929000 -- (-1381.278) (-1349.750) (-1381.009) [-1358.866] * (-1376.871) [-1360.307] (-1377.372) (-1385.677) -- 0:00:18
929500 -- (-1382.113) [-1340.612] (-1370.574) (-1372.580) * (-1384.906) (-1371.132) (-1384.379) [-1367.402] -- 0:00:18
930000 -- (-1380.518) [-1350.646] (-1378.557) (-1356.182) * (-1390.662) (-1378.638) (-1395.965) [-1356.652] -- 0:00:18
Average standard deviation of split frequencies: 0.005724
930500 -- (-1382.770) [-1367.381] (-1379.442) (-1362.741) * (-1385.410) (-1379.430) (-1372.552) [-1349.885] -- 0:00:18
931000 -- (-1381.104) (-1385.135) (-1377.124) [-1371.210] * (-1380.240) (-1363.151) (-1386.988) [-1358.152] -- 0:00:18
931500 -- (-1369.095) (-1390.535) (-1364.313) [-1348.211] * (-1380.398) [-1371.354] (-1378.944) (-1363.364) -- 0:00:18
932000 -- (-1384.212) (-1385.475) [-1361.745] (-1352.174) * (-1391.873) (-1366.362) (-1371.149) [-1349.691] -- 0:00:17
932500 -- (-1375.928) (-1357.130) (-1370.735) [-1355.120] * (-1390.247) [-1359.370] (-1369.727) (-1358.401) -- 0:00:17
933000 -- (-1375.180) [-1357.881] (-1362.599) (-1364.850) * (-1383.548) (-1373.945) (-1362.368) [-1380.710] -- 0:00:17
933500 -- (-1378.704) (-1356.353) (-1381.521) [-1343.995] * (-1386.019) (-1368.821) [-1355.331] (-1372.799) -- 0:00:17
934000 -- (-1371.371) (-1369.517) (-1386.633) [-1356.158] * (-1378.251) (-1368.061) (-1365.541) [-1351.374] -- 0:00:17
934500 -- (-1350.688) (-1365.299) (-1382.006) [-1362.128] * (-1387.630) (-1383.931) (-1387.302) [-1349.020] -- 0:00:17
935000 -- (-1363.674) (-1371.277) (-1391.938) [-1360.182] * (-1371.569) [-1372.774] (-1383.739) (-1371.108) -- 0:00:17
Average standard deviation of split frequencies: 0.006044
935500 -- [-1372.003] (-1359.599) (-1377.613) (-1376.840) * (-1368.064) (-1381.280) (-1375.707) [-1359.813] -- 0:00:16
936000 -- [-1374.189] (-1357.190) (-1373.039) (-1375.470) * [-1354.821] (-1384.738) (-1371.375) (-1356.303) -- 0:00:16
936500 -- (-1378.313) (-1367.975) (-1386.682) [-1368.908] * (-1364.872) (-1361.967) (-1382.602) [-1361.226] -- 0:00:16
937000 -- (-1383.106) (-1377.578) (-1375.934) [-1351.347] * (-1379.049) (-1377.144) (-1371.945) [-1361.148] -- 0:00:16
937500 -- (-1380.727) (-1371.092) [-1360.158] (-1365.736) * [-1351.766] (-1367.499) (-1375.491) (-1348.292) -- 0:00:16
938000 -- (-1382.703) [-1357.130] (-1348.735) (-1390.491) * [-1360.075] (-1368.687) (-1383.759) (-1352.244) -- 0:00:16
938500 -- (-1366.412) [-1356.794] (-1378.018) (-1379.085) * [-1370.095] (-1372.920) (-1374.374) (-1375.028) -- 0:00:16
939000 -- (-1400.934) (-1360.293) (-1368.269) [-1359.770] * (-1364.555) [-1370.340] (-1373.965) (-1374.928) -- 0:00:16
939500 -- (-1380.777) [-1361.569] (-1369.820) (-1367.747) * [-1367.671] (-1362.017) (-1388.134) (-1371.122) -- 0:00:15
940000 -- (-1365.673) [-1346.944] (-1388.478) (-1350.875) * (-1354.484) [-1359.007] (-1375.606) (-1356.873) -- 0:00:15
Average standard deviation of split frequencies: 0.006364
940500 -- (-1361.776) [-1367.245] (-1376.736) (-1371.114) * [-1357.506] (-1379.184) (-1370.903) (-1374.091) -- 0:00:15
941000 -- [-1356.266] (-1373.186) (-1377.881) (-1368.934) * (-1361.467) (-1355.816) [-1365.866] (-1376.324) -- 0:00:15
941500 -- (-1381.902) (-1378.949) (-1374.165) [-1364.213] * [-1375.771] (-1381.866) (-1374.492) (-1366.144) -- 0:00:15
942000 -- (-1390.830) [-1376.170] (-1373.947) (-1353.580) * (-1367.824) (-1383.635) (-1378.246) [-1361.392] -- 0:00:15
942500 -- (-1378.122) [-1367.226] (-1373.932) (-1368.001) * [-1358.159] (-1374.707) (-1380.676) (-1370.249) -- 0:00:15
943000 -- [-1354.578] (-1368.868) (-1390.468) (-1375.213) * [-1353.507] (-1383.722) (-1373.727) (-1374.504) -- 0:00:14
943500 -- [-1352.597] (-1378.688) (-1376.671) (-1387.355) * [-1344.345] (-1382.786) (-1375.546) (-1376.946) -- 0:00:14
944000 -- [-1363.778] (-1371.279) (-1383.358) (-1379.228) * (-1342.463) (-1388.298) [-1370.190] (-1391.166) -- 0:00:14
944500 -- [-1366.929] (-1385.122) (-1382.530) (-1387.204) * [-1368.283] (-1387.809) (-1373.848) (-1374.432) -- 0:00:14
945000 -- (-1376.411) (-1367.985) [-1342.424] (-1378.275) * (-1367.390) (-1393.909) [-1368.372] (-1378.446) -- 0:00:14
Average standard deviation of split frequencies: 0.006528
945500 -- (-1385.418) (-1357.103) [-1365.888] (-1372.181) * (-1372.553) (-1382.391) (-1366.958) [-1363.105] -- 0:00:14
946000 -- (-1374.930) [-1365.174] (-1380.168) (-1386.018) * (-1388.731) (-1379.914) (-1382.740) [-1365.933] -- 0:00:14
946500 -- [-1373.495] (-1362.002) (-1367.031) (-1379.345) * (-1364.723) (-1363.455) (-1375.119) [-1358.022] -- 0:00:14
947000 -- [-1363.715] (-1370.136) (-1379.311) (-1383.976) * (-1379.024) (-1371.942) [-1364.294] (-1371.364) -- 0:00:13
947500 -- [-1357.144] (-1378.608) (-1370.201) (-1383.851) * (-1382.848) (-1383.306) [-1355.530] (-1375.813) -- 0:00:13
948000 -- (-1355.263) [-1349.435] (-1371.520) (-1375.767) * (-1378.515) (-1364.178) (-1363.303) [-1363.040] -- 0:00:13
948500 -- [-1355.414] (-1358.007) (-1374.601) (-1382.672) * [-1354.959] (-1376.960) (-1386.724) (-1373.919) -- 0:00:13
949000 -- (-1376.404) (-1381.549) (-1354.787) [-1370.976] * (-1384.509) (-1378.404) [-1363.435] (-1389.372) -- 0:00:13
949500 -- (-1377.327) (-1375.117) (-1385.264) [-1355.137] * (-1370.419) [-1354.469] (-1374.568) (-1394.083) -- 0:00:13
950000 -- (-1377.303) [-1356.807] (-1374.766) (-1358.519) * [-1367.835] (-1364.277) (-1373.874) (-1377.361) -- 0:00:13
Average standard deviation of split frequencies: 0.006570
950500 -- (-1381.763) (-1366.614) (-1381.653) [-1363.252] * (-1349.085) [-1377.915] (-1382.606) (-1377.161) -- 0:00:13
951000 -- (-1379.140) (-1361.506) (-1374.366) [-1368.499] * (-1364.525) (-1387.667) [-1360.280] (-1371.971) -- 0:00:12
951500 -- (-1388.974) (-1380.744) [-1361.791] (-1384.910) * [-1350.782] (-1390.817) (-1358.867) (-1377.798) -- 0:00:12
952000 -- [-1365.072] (-1369.094) (-1383.501) (-1386.406) * [-1362.709] (-1382.992) (-1370.035) (-1390.791) -- 0:00:12
952500 -- (-1369.131) [-1370.163] (-1383.869) (-1387.285) * [-1359.193] (-1373.602) (-1370.032) (-1371.353) -- 0:00:12
953000 -- [-1349.626] (-1367.365) (-1377.191) (-1380.920) * (-1373.966) (-1380.816) [-1377.692] (-1377.757) -- 0:00:12
953500 -- [-1345.447] (-1374.731) (-1375.578) (-1372.907) * [-1361.092] (-1373.532) (-1358.415) (-1377.096) -- 0:00:12
954000 -- (-1365.934) (-1381.509) (-1384.663) [-1351.821] * [-1363.292] (-1370.365) (-1354.615) (-1383.735) -- 0:00:12
954500 -- (-1367.052) (-1389.557) (-1385.766) [-1368.472] * (-1372.506) (-1382.784) [-1344.495] (-1377.293) -- 0:00:11
955000 -- (-1372.896) (-1384.284) (-1391.626) [-1353.677] * (-1362.510) (-1386.210) [-1356.724] (-1367.584) -- 0:00:11
Average standard deviation of split frequencies: 0.006312
955500 -- (-1368.427) (-1386.995) (-1393.188) [-1365.360] * [-1353.291] (-1379.481) (-1363.910) (-1379.753) -- 0:00:11
956000 -- [-1354.167] (-1380.166) (-1386.375) (-1373.693) * (-1376.930) (-1386.561) [-1348.746] (-1377.500) -- 0:00:11
956500 -- [-1363.525] (-1374.740) (-1387.135) (-1382.348) * [-1352.101] (-1377.853) (-1378.312) (-1377.993) -- 0:00:11
957000 -- (-1365.354) [-1346.013] (-1373.479) (-1377.620) * (-1381.322) [-1365.077] (-1372.976) (-1363.291) -- 0:00:11
957500 -- [-1352.003] (-1360.244) (-1371.213) (-1380.925) * (-1385.655) [-1371.333] (-1365.028) (-1387.564) -- 0:00:11
958000 -- [-1353.158] (-1367.174) (-1374.014) (-1378.920) * [-1373.349] (-1378.315) (-1377.861) (-1392.616) -- 0:00:11
958500 -- [-1351.222] (-1373.685) (-1380.871) (-1379.405) * (-1367.261) [-1354.063] (-1377.809) (-1374.203) -- 0:00:10
959000 -- [-1362.329] (-1375.386) (-1380.403) (-1368.482) * (-1375.842) [-1374.269] (-1379.781) (-1387.794) -- 0:00:10
959500 -- [-1357.229] (-1381.468) (-1389.514) (-1367.745) * (-1371.704) [-1345.935] (-1367.536) (-1377.951) -- 0:00:10
960000 -- [-1353.277] (-1388.192) (-1377.280) (-1367.243) * (-1375.680) [-1340.609] (-1367.451) (-1372.089) -- 0:00:10
Average standard deviation of split frequencies: 0.006404
960500 -- [-1370.871] (-1375.396) (-1387.555) (-1374.524) * [-1354.474] (-1368.263) (-1372.117) (-1379.383) -- 0:00:10
961000 -- (-1384.442) (-1375.085) (-1357.816) [-1373.727] * [-1362.765] (-1384.352) (-1360.293) (-1380.468) -- 0:00:10
961500 -- [-1370.160] (-1371.854) (-1381.560) (-1352.489) * [-1346.228] (-1381.522) (-1371.123) (-1370.908) -- 0:00:10
962000 -- (-1372.619) (-1383.402) (-1383.516) [-1362.784] * [-1361.124] (-1380.217) (-1363.865) (-1376.327) -- 0:00:09
962500 -- [-1356.763] (-1370.108) (-1377.255) (-1378.429) * [-1360.051] (-1388.109) (-1376.480) (-1375.195) -- 0:00:09
963000 -- (-1372.948) (-1384.594) [-1361.057] (-1378.380) * (-1381.302) [-1370.580] (-1380.474) (-1390.217) -- 0:00:09
963500 -- [-1355.957] (-1382.314) (-1360.668) (-1374.097) * (-1392.104) [-1373.986] (-1375.164) (-1384.490) -- 0:00:09
964000 -- [-1346.039] (-1391.066) (-1371.963) (-1382.206) * (-1368.693) [-1367.680] (-1378.793) (-1377.534) -- 0:00:09
964500 -- (-1362.336) (-1393.768) [-1355.757] (-1369.799) * [-1352.774] (-1367.657) (-1383.396) (-1386.719) -- 0:00:09
965000 -- (-1373.620) [-1373.942] (-1369.523) (-1381.290) * (-1374.927) [-1352.778] (-1385.420) (-1375.682) -- 0:00:09
Average standard deviation of split frequencies: 0.006515
965500 -- (-1369.109) (-1389.995) [-1363.492] (-1381.123) * (-1391.147) [-1359.778] (-1376.662) (-1375.732) -- 0:00:09
966000 -- [-1361.977] (-1383.174) (-1361.978) (-1367.432) * [-1354.357] (-1381.062) (-1365.633) (-1373.234) -- 0:00:08
966500 -- (-1373.941) (-1403.249) [-1355.132] (-1385.424) * [-1361.167] (-1371.465) (-1373.296) (-1384.346) -- 0:00:08
967000 -- (-1375.641) (-1380.610) [-1357.872] (-1360.887) * [-1357.476] (-1365.754) (-1377.972) (-1387.296) -- 0:00:08
967500 -- (-1373.974) (-1384.914) (-1369.369) [-1359.659] * (-1351.379) (-1375.612) [-1364.011] (-1377.499) -- 0:00:08
968000 -- [-1367.792] (-1374.086) (-1364.158) (-1390.167) * [-1345.667] (-1384.972) (-1368.768) (-1378.063) -- 0:00:08
968500 -- (-1386.309) [-1367.223] (-1354.854) (-1379.676) * [-1346.513] (-1380.321) (-1381.339) (-1363.951) -- 0:00:08
969000 -- (-1380.722) [-1354.178] (-1374.438) (-1367.280) * [-1351.956] (-1376.608) (-1370.126) (-1392.142) -- 0:00:08
969500 -- (-1387.915) (-1370.169) [-1364.495] (-1378.132) * (-1362.218) (-1371.184) [-1354.106] (-1381.789) -- 0:00:08
970000 -- [-1374.167] (-1374.573) (-1364.818) (-1382.813) * (-1375.961) (-1378.982) [-1359.157] (-1383.290) -- 0:00:07
Average standard deviation of split frequencies: 0.006653
970500 -- (-1380.034) [-1371.989] (-1379.445) (-1376.824) * (-1383.740) (-1380.518) [-1364.047] (-1381.649) -- 0:00:07
971000 -- [-1364.758] (-1358.582) (-1387.066) (-1379.619) * (-1372.443) (-1377.181) (-1374.670) [-1350.534] -- 0:00:07
971500 -- [-1352.104] (-1345.902) (-1386.192) (-1380.842) * (-1373.997) (-1380.010) [-1356.925] (-1352.721) -- 0:00:07
972000 -- (-1345.332) [-1354.808] (-1376.628) (-1375.909) * (-1378.389) (-1375.963) (-1369.639) [-1346.423] -- 0:00:07
972500 -- [-1349.790] (-1364.554) (-1379.731) (-1377.111) * (-1383.815) (-1373.419) (-1372.187) [-1358.816] -- 0:00:07
973000 -- (-1357.508) [-1365.841] (-1395.042) (-1384.410) * (-1385.067) (-1381.921) (-1381.513) [-1360.339] -- 0:00:07
973500 -- (-1376.243) (-1368.186) [-1374.957] (-1383.890) * (-1388.783) (-1378.918) [-1353.874] (-1365.328) -- 0:00:06
974000 -- (-1392.847) [-1354.912] (-1376.420) (-1371.692) * (-1383.572) (-1374.335) [-1355.297] (-1367.564) -- 0:00:06
974500 -- (-1392.404) [-1355.777] (-1370.377) (-1377.023) * (-1376.119) (-1369.055) [-1355.800] (-1376.780) -- 0:00:06
975000 -- (-1383.088) [-1350.096] (-1382.410) (-1380.725) * (-1379.292) (-1382.304) [-1365.717] (-1376.367) -- 0:00:06
Average standard deviation of split frequencies: 0.006545
975500 -- (-1379.182) [-1362.692] (-1387.063) (-1385.409) * (-1381.467) (-1375.747) [-1344.958] (-1383.079) -- 0:00:06
976000 -- (-1371.581) [-1355.452] (-1381.294) (-1384.256) * (-1384.502) (-1373.692) [-1357.049] (-1387.306) -- 0:00:06
976500 -- [-1361.586] (-1372.492) (-1376.257) (-1390.999) * (-1369.773) (-1392.637) [-1354.674] (-1383.220) -- 0:00:06
977000 -- (-1358.086) [-1369.865] (-1360.722) (-1379.056) * (-1384.720) (-1383.712) [-1356.275] (-1372.001) -- 0:00:06
977500 -- [-1353.166] (-1371.388) (-1384.065) (-1364.940) * (-1376.461) (-1385.291) (-1368.309) [-1370.983] -- 0:00:05
978000 -- (-1360.874) [-1366.634] (-1372.740) (-1367.170) * (-1379.478) (-1392.636) (-1371.075) [-1357.660] -- 0:00:05
978500 -- (-1374.611) (-1365.423) (-1377.327) [-1356.634] * (-1391.933) [-1371.864] (-1369.243) (-1377.459) -- 0:00:05
979000 -- (-1370.425) (-1371.871) (-1376.953) [-1349.292] * (-1381.828) (-1368.612) [-1369.650] (-1380.666) -- 0:00:05
979500 -- (-1374.258) (-1369.294) (-1377.252) [-1353.677] * (-1393.975) [-1354.970] (-1362.773) (-1382.958) -- 0:00:05
980000 -- (-1358.121) (-1368.125) (-1379.021) [-1342.922] * (-1376.796) [-1363.334] (-1378.634) (-1367.179) -- 0:00:05
Average standard deviation of split frequencies: 0.006345
980500 -- [-1362.620] (-1380.828) (-1357.528) (-1374.123) * (-1379.574) [-1359.110] (-1373.318) (-1345.017) -- 0:00:05
981000 -- (-1353.841) (-1371.089) [-1360.053] (-1379.607) * [-1364.582] (-1358.384) (-1376.192) (-1356.298) -- 0:00:04
981500 -- [-1364.863] (-1390.290) (-1367.882) (-1378.310) * (-1369.435) (-1380.020) (-1366.994) [-1373.041] -- 0:00:04
982000 -- (-1377.999) (-1379.533) (-1374.089) [-1371.942] * (-1383.854) (-1393.361) [-1357.489] (-1366.910) -- 0:00:04
982500 -- (-1383.819) [-1357.355] (-1367.488) (-1368.101) * (-1355.256) (-1382.477) [-1361.297] (-1372.868) -- 0:00:04
983000 -- (-1383.565) [-1348.031] (-1377.577) (-1353.952) * (-1355.459) (-1393.313) (-1359.343) [-1363.057] -- 0:00:04
983500 -- [-1354.554] (-1361.906) (-1385.820) (-1364.498) * [-1346.331] (-1379.568) (-1373.408) (-1362.173) -- 0:00:04
984000 -- (-1369.746) (-1364.718) (-1385.056) [-1364.579] * [-1345.121] (-1369.850) (-1379.520) (-1364.345) -- 0:00:04
984500 -- (-1375.203) [-1351.533] (-1384.411) (-1374.151) * [-1352.531] (-1383.086) (-1376.693) (-1373.385) -- 0:00:04
985000 -- (-1371.806) [-1350.961] (-1374.635) (-1373.102) * [-1347.522] (-1375.783) (-1386.300) (-1391.586) -- 0:00:03
Average standard deviation of split frequencies: 0.006240
985500 -- (-1376.368) [-1347.904] (-1387.873) (-1370.253) * [-1348.617] (-1370.547) (-1372.802) (-1383.168) -- 0:00:03
986000 -- (-1352.009) [-1348.460] (-1376.806) (-1388.309) * [-1370.850] (-1380.305) (-1382.567) (-1370.257) -- 0:00:03
986500 -- [-1360.996] (-1376.098) (-1377.147) (-1389.585) * (-1359.269) (-1392.964) [-1363.788] (-1381.124) -- 0:00:03
987000 -- [-1376.208] (-1363.401) (-1373.308) (-1368.092) * (-1363.955) [-1357.855] (-1363.363) (-1388.509) -- 0:00:03
987500 -- (-1371.175) (-1382.322) (-1377.691) [-1348.758] * (-1367.166) [-1367.636] (-1371.746) (-1384.674) -- 0:00:03
988000 -- [-1362.850] (-1390.137) (-1375.900) (-1373.503) * (-1379.641) [-1357.645] (-1386.817) (-1381.287) -- 0:00:03
988500 -- [-1353.359] (-1389.145) (-1387.942) (-1377.524) * (-1386.174) (-1364.034) [-1366.777] (-1387.340) -- 0:00:03
989000 -- [-1376.401] (-1398.908) (-1385.648) (-1386.795) * (-1375.082) [-1360.697] (-1382.823) (-1382.755) -- 0:00:02
989500 -- (-1378.559) (-1387.464) (-1378.283) [-1373.244] * (-1378.566) [-1365.702] (-1368.811) (-1383.513) -- 0:00:02
990000 -- [-1372.863] (-1383.557) (-1376.092) (-1366.193) * (-1384.635) (-1398.580) [-1352.774] (-1377.295) -- 0:00:02
Average standard deviation of split frequencies: 0.006236
990500 -- [-1369.259] (-1385.606) (-1386.539) (-1370.605) * (-1365.582) (-1381.914) [-1355.375] (-1362.641) -- 0:00:02
991000 -- [-1358.866] (-1386.995) (-1379.424) (-1362.087) * (-1380.118) (-1389.911) [-1358.302] (-1348.441) -- 0:00:02
991500 -- (-1368.858) (-1379.339) (-1379.025) [-1356.467] * (-1385.019) (-1380.534) (-1354.541) [-1377.254] -- 0:00:02
992000 -- (-1368.336) [-1348.864] (-1369.749) (-1370.684) * (-1381.853) (-1385.594) [-1364.144] (-1364.067) -- 0:00:02
992500 -- (-1376.216) (-1355.690) [-1364.283] (-1382.327) * (-1386.657) [-1389.798] (-1364.244) (-1374.436) -- 0:00:01
993000 -- (-1384.086) (-1369.475) [-1358.171] (-1371.920) * (-1373.783) (-1378.577) (-1375.925) [-1359.834] -- 0:00:01
993500 -- (-1375.072) [-1367.097] (-1360.855) (-1375.931) * (-1379.349) (-1378.405) [-1375.026] (-1354.723) -- 0:00:01
994000 -- (-1369.640) (-1349.397) [-1369.766] (-1380.371) * (-1379.345) (-1367.255) (-1370.444) [-1345.774] -- 0:00:01
994500 -- (-1377.079) (-1366.353) [-1363.886] (-1386.619) * (-1377.465) [-1345.645] (-1376.808) (-1371.567) -- 0:00:01
995000 -- (-1374.308) (-1365.038) (-1373.583) [-1371.571] * (-1397.207) (-1364.092) [-1370.699] (-1374.147) -- 0:00:01
Average standard deviation of split frequencies: 0.006277
995500 -- (-1366.625) (-1373.983) (-1376.690) [-1361.982] * (-1389.315) (-1366.304) (-1376.768) [-1364.721] -- 0:00:01
996000 -- [-1372.614] (-1361.776) (-1372.444) (-1374.060) * [-1382.447] (-1367.876) (-1373.949) (-1364.078) -- 0:00:01
996500 -- (-1380.153) [-1374.950] (-1371.674) (-1380.091) * (-1369.411) [-1358.907] (-1392.047) (-1364.167) -- 0:00:00
997000 -- (-1374.116) (-1383.044) (-1386.634) [-1370.007] * (-1373.931) [-1354.422] (-1385.384) (-1366.246) -- 0:00:00
997500 -- (-1377.712) (-1394.894) (-1371.927) [-1355.269] * [-1370.810] (-1367.335) (-1371.602) (-1375.906) -- 0:00:00
998000 -- (-1374.998) (-1370.434) [-1359.389] (-1374.241) * (-1375.165) (-1356.785) (-1376.993) [-1356.557] -- 0:00:00
998500 -- (-1384.024) (-1384.309) [-1361.322] (-1358.412) * (-1379.778) (-1339.574) (-1384.522) [-1352.886] -- 0:00:00
999000 -- (-1376.770) (-1388.475) [-1351.170] (-1361.592) * (-1382.828) (-1368.439) (-1368.252) [-1352.999] -- 0:00:00
999500 -- [-1368.844] (-1381.113) (-1369.639) (-1369.433) * [-1372.311] (-1380.856) (-1379.872) (-1365.592) -- 0:00:00
1000000 -- (-1362.955) [-1372.272] (-1373.624) (-1369.053) * (-1371.359) (-1380.470) [-1372.491] (-1378.565) -- 0:00:00
Average standard deviation of split frequencies: 0.006323
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1362.954888 -- 27.637848
Chain 1 -- -1362.954895 -- 27.637848
Chain 2 -- -1372.271695 -- 24.818325
Chain 2 -- -1372.271696 -- 24.818325
Chain 3 -- -1373.623795 -- 25.612748
Chain 3 -- -1373.623794 -- 25.612748
Chain 4 -- -1369.052601 -- 27.949399
Chain 4 -- -1369.052605 -- 27.949399
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1371.358774 -- 25.347188
Chain 1 -- -1371.358779 -- 25.347188
Chain 2 -- -1380.469796 -- 7.565310
Chain 2 -- -1380.469800 -- 7.565310
Chain 3 -- -1372.490696 -- 27.078188
Chain 3 -- -1372.490693 -- 27.078188
Chain 4 -- -1378.564872 -- 28.461296
Chain 4 -- -1378.564865 -- 28.461296
Analysis completed in 4 mins 23 seconds
Analysis used 262.59 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1333.16
Likelihood of best state for "cold" chain of run 2 was -1333.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.6 % ( 44 %) Dirichlet(Revmat{all})
75.7 % ( 63 %) Slider(Revmat{all})
27.7 % ( 39 %) Dirichlet(Pi{all})
28.7 % ( 19 %) Slider(Pi{all})
38.4 % ( 16 %) Multiplier(Alpha{1,2})
49.2 % ( 22 %) Multiplier(Alpha{3})
37.1 % ( 18 %) Slider(Pinvar{all})
41.2 % ( 49 %) ExtSPR(Tau{all},V{all})
15.2 % ( 13 %) ExtTBR(Tau{all},V{all})
50.0 % ( 52 %) NNI(Tau{all},V{all})
42.6 % ( 59 %) ParsSPR(Tau{all},V{all})
27.4 % ( 33 %) Multiplier(V{all})
61.4 % ( 68 %) Nodeslider(V{all})
28.3 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
57.9 % ( 48 %) Dirichlet(Revmat{all})
75.7 % ( 64 %) Slider(Revmat{all})
26.8 % ( 21 %) Dirichlet(Pi{all})
28.8 % ( 26 %) Slider(Pi{all})
38.4 % ( 28 %) Multiplier(Alpha{1,2})
49.2 % ( 36 %) Multiplier(Alpha{3})
37.3 % ( 21 %) Slider(Pinvar{all})
41.5 % ( 29 %) ExtSPR(Tau{all},V{all})
15.4 % ( 15 %) ExtTBR(Tau{all},V{all})
50.3 % ( 41 %) NNI(Tau{all},V{all})
43.0 % ( 44 %) ParsSPR(Tau{all},V{all})
27.4 % ( 27 %) Multiplier(V{all})
61.4 % ( 61 %) Nodeslider(V{all})
28.0 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.47 0.16 0.05
2 | 167411 0.52 0.24
3 | 166443 166498 0.60
4 | 166361 166215 167072
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.47 0.17 0.06
2 | 166968 0.52 0.25
3 | 166772 166927 0.61
4 | 166380 166298 166655
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1352.82
| 1 1 |
| 1 2 |
| 2 |
| 2 1 |
| 1 1 2 2 1 1 1 |
| 1 1 11 2 1 2 1 11 2 |
| 12 21 12 2 11 21 |
|* 2 11 12 11 2221 1 222 2 1 1 1 2 1 |
| 1 1 1 211 12 1 * 2 222 11 2 2 2 |
| 2 2 1 2 2 2 2 1 |
| 2 22 2 1* 2 2 2 1 1 1 |
| 1 2 12 1 2 2 |
| 1 1 2 |
| 2 2 2 1 2 2 2 |
| 1 *|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1363.98
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1340.45 -1378.43
2 -1341.44 -1382.88
--------------------------------------
TOTAL -1340.83 -1382.19
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.471711 0.063859 0.136821 0.983478 0.398510 801.80 816.60 1.002
r(A<->C){all} 0.069978 0.001603 0.003157 0.144533 0.062458 373.38 457.65 1.000
r(A<->G){all} 0.235400 0.015768 0.036986 0.487003 0.210911 91.65 141.13 1.004
r(A<->T){all} 0.068214 0.001666 0.002314 0.143659 0.061539 529.97 574.26 1.003
r(C<->G){all} 0.046793 0.000925 0.004307 0.111149 0.040739 556.36 596.22 1.000
r(C<->T){all} 0.562685 0.022441 0.274033 0.837872 0.566693 102.21 149.75 1.005
r(G<->T){all} 0.016930 0.000305 0.000019 0.052410 0.011032 618.63 650.99 1.000
pi(A){all} 0.280404 0.000256 0.249159 0.310324 0.280458 1057.32 1139.05 1.000
pi(C){all} 0.258927 0.000248 0.227280 0.288890 0.258744 1254.37 1272.37 1.000
pi(G){all} 0.260526 0.000236 0.231890 0.291584 0.260219 917.50 1058.24 1.000
pi(T){all} 0.200143 0.000212 0.169008 0.226582 0.200361 899.95 1077.76 1.000
alpha{1,2} 0.092961 0.000848 0.025787 0.152799 0.091089 1059.05 1105.64 1.001
alpha{3} 1.224562 0.431418 0.217476 2.446944 1.082673 985.67 1034.49 1.002
pinvar{all} 0.824929 0.001223 0.750923 0.884185 0.829828 1076.42 1119.47 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
Key to taxon bipartitions (saved to file "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------------
1 -- .***********
2 -- .*..........
3 -- ..*.........
4 -- ...*........
5 -- ....*.......
6 -- .....*......
7 -- ......*.....
8 -- .......*....
9 -- ........*...
10 -- .........*..
11 -- ..........*.
12 -- ...........*
13 -- .....*******
14 -- .....*.*....
15 -- ...*********
16 -- ...**.......
17 -- .....***....
18 -- ..........**
19 -- .....***.***
20 -- ..**********
21 -- .**.........
22 -- .*.*********
23 -- ......**....
24 -- ....********
25 -- .....***.*..
26 -- .........***
27 -- ...*.*******
28 -- .....***..**
29 -- ......*..*..
30 -- ........****
31 -- ........**..
------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 2063 0.687209 0.002355 0.685543 0.688874 2
15 1954 0.650899 0.008480 0.644903 0.656895 2
16 1929 0.642572 0.005182 0.638907 0.646236 2
17 1802 0.600266 0.016959 0.588274 0.612258 2
18 1559 0.519320 0.003298 0.516989 0.521652 2
19 1153 0.384077 0.006124 0.379747 0.388408 2
20 848 0.282478 0.009422 0.275816 0.289141 2
21 834 0.277815 0.005653 0.273817 0.281812 2
22 794 0.264490 0.027323 0.245170 0.283811 2
23 583 0.194204 0.011777 0.185876 0.202532 2
24 550 0.183211 0.000942 0.182545 0.183877 2
25 510 0.169887 0.002827 0.167888 0.171885 2
26 493 0.164224 0.000471 0.163891 0.164557 2
27 448 0.149234 0.002827 0.147235 0.151233 2
28 377 0.125583 0.003298 0.123251 0.127915 2
29 368 0.122585 0.000000 0.122585 0.122585 2
30 345 0.114923 0.003298 0.112592 0.117255 2
31 309 0.102931 0.009893 0.095936 0.109927 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.011145 0.000129 0.000034 0.032136 0.007853 1.000 2
length{all}[2] 0.005587 0.000054 0.000004 0.018668 0.003258 1.000 2
length{all}[3] 0.011170 0.000117 0.000057 0.031235 0.008087 1.000 2
length{all}[4] 0.006606 0.000075 0.000000 0.022566 0.003798 1.000 2
length{all}[5] 0.011553 0.000146 0.000003 0.033122 0.008024 1.000 2
length{all}[6] 0.026578 0.000504 0.000964 0.070055 0.020290 1.001 2
length{all}[7] 0.034483 0.000818 0.001963 0.090120 0.026615 1.001 2
length{all}[8] 0.021960 0.000401 0.000120 0.060514 0.016216 1.000 2
length{all}[9] 0.055526 0.001699 0.005835 0.140029 0.044354 1.001 2
length{all}[10] 0.034704 0.000744 0.002904 0.090810 0.026875 1.001 2
length{all}[11] 0.040118 0.001018 0.003169 0.099045 0.031245 1.000 2
length{all}[12] 0.030566 0.000609 0.001424 0.078903 0.023984 1.000 2
length{all}[13] 0.082288 0.003162 0.012604 0.194251 0.066596 1.002 2
length{all}[14] 0.019329 0.000366 0.000126 0.055782 0.014144 1.001 2
length{all}[15] 0.014344 0.000171 0.000010 0.039330 0.010849 0.999 2
length{all}[16] 0.013577 0.000190 0.000041 0.039643 0.009725 1.000 2
length{all}[17] 0.021011 0.000398 0.000118 0.061662 0.015447 1.000 2
length{all}[18] 0.015390 0.000260 0.000017 0.041296 0.011252 1.000 2
length{all}[19] 0.016778 0.000314 0.000010 0.050828 0.011899 1.000 2
length{all}[20] 0.006272 0.000045 0.000001 0.019948 0.003901 0.999 2
length{all}[21] 0.006101 0.000081 0.000012 0.020048 0.003268 1.000 2
length{all}[22] 0.006179 0.000055 0.000002 0.019092 0.003793 1.000 2
length{all}[23] 0.015627 0.000242 0.000270 0.045414 0.011241 0.998 2
length{all}[24] 0.007537 0.000093 0.000004 0.021368 0.004830 1.000 2
length{all}[25] 0.009592 0.000139 0.000001 0.031203 0.005408 1.014 2
length{all}[26] 0.008664 0.000111 0.000007 0.027207 0.005337 1.002 2
length{all}[27] 0.006782 0.000079 0.000007 0.019942 0.003935 0.998 2
length{all}[28] 0.008337 0.000160 0.000007 0.026331 0.004494 0.997 2
length{all}[29] 0.014666 0.000222 0.000021 0.044542 0.010192 0.997 2
length{all}[30] 0.011314 0.000185 0.000044 0.038069 0.006775 0.998 2
length{all}[31] 0.009303 0.000136 0.000006 0.033195 0.004984 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006323
Maximum standard deviation of split frequencies = 0.027323
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.014
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
+ /-------------- C4 (4)
| /--------------------64-------------------+
| | \-------------- C5 (5)
| |
| | /-------------- C6 (6)
| | /------69-----+
\------65-----+ | \-------------- C8 (8)
| /------60-----+
| | \---------------------------- C7 (7)
| |
| |------------------------------------------ C9 (9)
\-----100-----+
|------------------------------------------ C10 (10)
|
| /-------------- C11 (11)
\-------------52------------+
\-------------- C12 (12)
Phylogram (based on average branch lengths):
/---- C1 (1)
|
|-- C2 (2)
|
|----- C3 (3)
|
+ /-- C4 (4)
| /-----+
| | \---- C5 (5)
| |
| | /----------- C6 (6)
| | /-------+
\-----+ | \--------- C8 (8)
| /--------+
| | \--------------- C7 (7)
| |
| |------------------------- C9 (9)
\-------------------------------------+
|--------------- C10 (10)
|
| /------------------ C11 (11)
\-----+
\-------------- C12 (12)
|----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (2218 trees sampled):
50 % credible set contains 717 trees
90 % credible set contains 1918 trees
95 % credible set contains 2068 trees
99 % credible set contains 2188 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 12 ls = 744
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Sequences read..
Counting site patterns.. 0:00
84 patterns at 248 / 248 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12
528 bytes for distance
81984 bytes for conP
11424 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
286944 bytes for conP, adjusted
0.004210 0.000000 0.004925 0.006247 0.003086 0.000784 0.004610 0.032854 0.010359 0.000590 0.012189 0.009220 0.016463 0.023632 0.019343 0.009386 0.015199 0.014466 0.300000 1.300000
ntime & nrate & np: 18 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 20
lnL0 = -1366.458208
Iterating by ming2
Initial: fx= 1366.458208
x= 0.00421 0.00000 0.00493 0.00625 0.00309 0.00078 0.00461 0.03285 0.01036 0.00059 0.01219 0.00922 0.01646 0.02363 0.01934 0.00939 0.01520 0.01447 0.30000 1.30000
1 h-m-p 0.0000 0.0000 1465.3766 ++ 1366.451207 m 0.0000 25 | 1/20
2 h-m-p 0.0000 0.0000 330.0935 ++ 1366.142448 m 0.0000 48 | 2/20
3 h-m-p 0.0000 0.0000 345.3184 YCYCCC 1365.589988 5 0.0000 79 | 2/20
4 h-m-p 0.0000 0.0002 278.0429 +YYCCC 1364.415353 4 0.0001 109 | 2/20
5 h-m-p 0.0000 0.0003 449.9006 +CYCCC 1359.781291 4 0.0002 140 | 2/20
6 h-m-p 0.0000 0.0001 2668.1111 YYCCC 1357.302187 4 0.0000 169 | 2/20
7 h-m-p 0.0001 0.0003 1143.5014 +YYCCC 1349.496541 4 0.0002 199 | 2/20
8 h-m-p 0.0000 0.0001 1497.5043 +YYCYCCC 1344.752748 6 0.0001 232 | 2/20
9 h-m-p 0.0000 0.0000 6996.2722 +YYYCCC 1339.079927 5 0.0000 263 | 2/20
10 h-m-p 0.0000 0.0001 972.8162 YCYCCC 1336.280354 5 0.0001 294 | 2/20
11 h-m-p 0.0000 0.0002 346.2976 CYCCC 1335.402634 4 0.0001 324 | 2/20
12 h-m-p 0.0002 0.0011 64.7913 CCC 1335.298755 2 0.0001 351 | 2/20
13 h-m-p 0.0001 0.0011 76.3238 +CCCC 1334.916914 3 0.0003 381 | 2/20
14 h-m-p 0.0001 0.0008 314.1766 +CCYCCC 1331.644691 5 0.0006 415 | 2/20
15 h-m-p 0.0000 0.0001 5080.8452 +CYYYYYYY 1310.576400 7 0.0001 448 | 2/20
16 h-m-p 0.0000 0.0000 64058.3492 YCYCCC 1309.982709 5 0.0000 479 | 2/20
17 h-m-p 0.0014 0.0069 2.8053 YC 1309.945551 1 0.0008 503 | 2/20
18 h-m-p 0.0001 0.0021 34.6660 ++YYCCC 1309.188183 4 0.0007 534 | 2/20
19 h-m-p 0.0002 0.0015 171.5385 +CYYYCCC 1294.561420 6 0.0013 568 | 2/20
20 h-m-p 0.0005 0.0024 13.8942 YCYCCC 1293.766088 5 0.0012 599 | 2/20
21 h-m-p 0.0173 0.0865 0.2989 YCYCCC 1291.906373 5 0.0471 630 | 2/20
22 h-m-p 0.0161 0.0805 0.4871 +YYCYYCCC 1284.839337 7 0.0698 682 | 2/20
23 h-m-p 0.0361 0.1806 0.5025 +YYCCC 1278.136250 4 0.1208 730 | 2/20
24 h-m-p 0.1060 0.5298 0.1282 YCCCC 1276.782212 4 0.2471 778 | 2/20
25 h-m-p 0.1281 0.6406 0.1012 YCYCCC 1276.335400 5 0.2759 827 | 2/20
26 h-m-p 0.1667 1.4536 0.1675 +YYYYCC 1275.041247 5 0.6470 875 | 2/20
27 h-m-p 0.4167 2.0837 0.2235 YCCC 1273.534978 3 0.8579 921 | 2/20
28 h-m-p 1.4358 8.0000 0.1335 YCCC 1271.354746 3 2.8334 967 | 2/20
29 h-m-p 1.1001 5.5005 0.1221 YCCCC 1270.270618 4 2.6656 1015 | 2/20
30 h-m-p 1.6000 8.0000 0.0762 CCCC 1269.763783 3 2.6023 1062 | 2/20
31 h-m-p 1.4937 8.0000 0.1328 CC 1269.424549 1 2.3607 1105 | 2/20
32 h-m-p 1.6000 8.0000 0.1629 CCCC 1269.111800 3 2.3085 1152 | 2/20
33 h-m-p 1.3378 6.6889 0.0983 CCCC 1268.952553 3 1.6929 1199 | 2/20
34 h-m-p 1.6000 8.0000 0.0163 CYC 1268.914564 2 1.8510 1243 | 2/20
35 h-m-p 1.6000 8.0000 0.0038 +YC 1268.864647 1 5.0867 1286 | 2/20
36 h-m-p 0.4220 8.0000 0.0460 ++CC 1268.685986 1 6.2668 1331 | 2/20
37 h-m-p 1.6000 8.0000 0.0286 +YCCC 1268.259640 3 4.6822 1378 | 2/20
38 h-m-p 0.6788 8.0000 0.1970 +CCC 1267.941823 2 2.2595 1424 | 2/20
39 h-m-p 1.3132 6.5658 0.0069 CCCC 1267.816864 3 1.5114 1471 | 2/20
40 h-m-p 0.1267 8.0000 0.0818 +YCC 1267.779700 2 1.0126 1516 | 2/20
41 h-m-p 1.6000 8.0000 0.0076 CCC 1267.720968 2 2.2213 1561 | 2/20
42 h-m-p 0.5794 8.0000 0.0290 +YC 1267.631316 1 4.1822 1604 | 2/20
43 h-m-p 1.6000 8.0000 0.0229 +YC 1267.490548 1 4.8031 1647 | 2/20
44 h-m-p 1.6000 8.0000 0.0062 +CCC 1267.150738 2 5.6713 1693 | 2/20
45 h-m-p 0.2508 8.0000 0.1397 ++YCCC 1266.472460 3 5.1833 1741 | 2/20
46 h-m-p 1.6000 8.0000 0.3078 CCCCC 1265.650245 4 2.5733 1790 | 2/20
47 h-m-p 1.3909 6.9545 0.2722 CCCC 1265.089981 3 1.7862 1837 | 2/20
48 h-m-p 1.6000 8.0000 0.2055 CCCC 1264.569860 3 2.0542 1884 | 2/20
49 h-m-p 1.6000 8.0000 0.0135 YCCC 1264.271445 3 3.2406 1930 | 2/20
50 h-m-p 0.7226 8.0000 0.0605 YC 1264.125950 1 1.7615 1972 | 2/20
51 h-m-p 0.9922 8.0000 0.1074 CCC 1264.060035 2 1.6109 2017 | 2/20
52 h-m-p 1.6000 8.0000 0.0823 CCC 1264.034770 2 1.5632 2062 | 2/20
53 h-m-p 1.6000 8.0000 0.0066 CC 1264.028027 1 1.9533 2105 | 2/20
54 h-m-p 1.6000 8.0000 0.0056 C 1264.026348 0 1.5698 2146 | 2/20
55 h-m-p 1.6000 8.0000 0.0019 C 1264.026204 0 1.3647 2187 | 2/20
56 h-m-p 1.6000 8.0000 0.0006 C 1264.026193 0 1.5201 2228 | 2/20
57 h-m-p 1.6000 8.0000 0.0001 C 1264.026193 0 1.3609 2269 | 2/20
58 h-m-p 1.6000 8.0000 0.0000 Y 1264.026193 0 1.0792 2310 | 2/20
59 h-m-p 1.6000 8.0000 0.0000 Y 1264.026193 0 2.7011 2351 | 2/20
60 h-m-p 0.9713 8.0000 0.0000 -C 1264.026193 0 0.0607 2393 | 2/20
61 h-m-p 0.0519 8.0000 0.0000 --------------.. | 2/20
62 h-m-p 0.0034 1.6935 0.0084 ------------ | 2/20
63 h-m-p 0.0034 1.6935 0.0084 ------------
Out..
lnL = -1264.026193
2549 lfun, 2549 eigenQcodon, 45882 P(t)
Time used: 0:13
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
0.004497 0.000052 0.004662 0.006279 0.002250 0.000000 0.004240 0.032965 0.009784 0.000581 0.012102 0.009012 0.016360 0.023637 0.019612 0.008682 0.014823 0.014390 2.558930 0.652999 0.498354
ntime & nrate & np: 18 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.158505
np = 21
lnL0 = -1301.842541
Iterating by ming2
Initial: fx= 1301.842541
x= 0.00450 0.00005 0.00466 0.00628 0.00225 0.00000 0.00424 0.03297 0.00978 0.00058 0.01210 0.00901 0.01636 0.02364 0.01961 0.00868 0.01482 0.01439 2.55893 0.65300 0.49835
1 h-m-p 0.0000 0.0000 1499.0662 ++ 1301.828807 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 245.2322 ++ 1301.781945 m 0.0000 92 | 2/21
3 h-m-p 0.0000 0.0001 168.4644 +YYCCCCC 1300.606461 6 0.0000 147 | 2/21
4 h-m-p 0.0000 0.0003 167.2646 CYCCC 1300.174838 4 0.0000 198 | 2/21
5 h-m-p 0.0001 0.0005 55.9356 CCC 1300.039560 2 0.0001 245 | 2/21
6 h-m-p 0.0001 0.0006 72.8517 +YYCC 1299.718340 3 0.0002 293 | 2/21
7 h-m-p 0.0000 0.0003 775.0667 +CYCCC 1298.039553 4 0.0001 344 | 2/21
8 h-m-p 0.0000 0.0002 2961.9297 ++ 1281.974078 m 0.0002 387 | 2/21
9 h-m-p 0.0000 0.0000 189.4273
h-m-p: 0.00000000e+00 0.00000000e+00 1.89427274e+02 1281.974078
.. | 2/21
10 h-m-p 0.0000 0.0001 904.1740 YYCCC 1279.285428 4 0.0000 476 | 2/21
11 h-m-p 0.0000 0.0001 460.2870 +YYYYCCC 1274.590592 6 0.0000 528 | 2/21
12 h-m-p 0.0000 0.0000 885.4677 +YYCCCC 1271.319711 5 0.0000 580 | 2/21
13 h-m-p 0.0000 0.0000 615.6501 YCCCC 1270.044614 4 0.0000 630 | 2/21
14 h-m-p 0.0000 0.0000 488.0463 YCYCCC 1269.005657 5 0.0000 681 | 2/21
15 h-m-p 0.0000 0.0002 376.6274 +YYYCC 1265.928926 4 0.0001 730 | 2/21
16 h-m-p 0.0000 0.0002 295.6913 CYCCC 1264.929628 4 0.0001 780 | 2/21
17 h-m-p 0.0001 0.0003 94.9135 YC 1264.823428 1 0.0000 824 | 2/21
18 h-m-p 0.0001 0.0003 50.4822 CCC 1264.761429 2 0.0001 871 | 2/21
19 h-m-p 0.0000 0.0001 76.8539 YCC 1264.707925 2 0.0001 917 | 2/21
20 h-m-p 0.0000 0.0001 114.9077 ++ 1264.595312 m 0.0001 960 | 3/21
21 h-m-p 0.0000 0.0001 393.1345 YCC 1264.577107 2 0.0000 1006 | 3/21
22 h-m-p 0.0002 0.0022 12.7495 YC 1264.560894 1 0.0001 1049 | 3/21
23 h-m-p 0.0003 0.0062 4.0827 YC 1264.560373 1 0.0001 1092 | 3/21
24 h-m-p 0.0003 0.0320 0.8140 C 1264.559827 0 0.0003 1134 | 3/21
25 h-m-p 0.0004 0.0320 0.5979 +YC 1264.537090 1 0.0029 1178 | 3/21
26 h-m-p 0.0002 0.0146 9.1419 ++YCCC 1263.877349 3 0.0021 1227 | 3/21
27 h-m-p 0.0001 0.0003 55.6375 YCCCC 1263.797342 4 0.0001 1276 | 3/21
28 h-m-p 0.0006 0.0031 3.1461 -YC 1263.797010 1 0.0001 1320 | 3/21
29 h-m-p 0.0069 3.4416 0.0482 ++++YYYCCCCC 1263.125573 7 1.9014 1377 | 3/21
30 h-m-p 1.0457 5.2286 0.0633 YYYC 1263.080223 3 0.9901 1422 | 3/21
31 h-m-p 1.6000 8.0000 0.0193 YC 1263.068925 1 0.7037 1465 | 3/21
32 h-m-p 0.9313 8.0000 0.0145 YC 1263.067463 1 0.5859 1508 | 3/21
33 h-m-p 0.8137 8.0000 0.0105 C 1263.066948 0 0.7426 1550 | 3/21
34 h-m-p 1.6000 8.0000 0.0014 C 1263.066833 0 2.3134 1592 | 3/21
35 h-m-p 1.6000 8.0000 0.0006 C 1263.066778 0 1.7799 1634 | 3/21
36 h-m-p 1.6000 8.0000 0.0001 Y 1263.066772 0 1.2155 1676 | 3/21
37 h-m-p 1.2740 8.0000 0.0001 C 1263.066771 0 1.2740 1718 | 3/21
38 h-m-p 1.6000 8.0000 0.0001 Y 1263.066771 0 1.1757 1760 | 3/21
39 h-m-p 1.6000 8.0000 0.0000 Y 1263.066771 0 0.8631 1802 | 3/21
40 h-m-p 1.6000 8.0000 0.0000 C 1263.066771 0 1.3047 1844 | 3/21
41 h-m-p 0.5025 8.0000 0.0000 -C 1263.066771 0 0.0314 1887
Out..
lnL = -1263.066771
1888 lfun, 5664 eigenQcodon, 67968 P(t)
Time used: 0:32
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
initial w for M2:NSpselection reset.
0.004552 0.000298 0.004183 0.006096 0.002353 0.000000 0.004454 0.032667 0.009908 0.000584 0.011850 0.009332 0.016399 0.024011 0.019628 0.009039 0.014985 0.014384 2.601378 1.001601 0.301958 0.109127 2.014820
ntime & nrate & np: 18 3 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.868603
np = 23
lnL0 = -1301.583839
Iterating by ming2
Initial: fx= 1301.583839
x= 0.00455 0.00030 0.00418 0.00610 0.00235 0.00000 0.00445 0.03267 0.00991 0.00058 0.01185 0.00933 0.01640 0.02401 0.01963 0.00904 0.01498 0.01438 2.60138 1.00160 0.30196 0.10913 2.01482
1 h-m-p 0.0000 0.0000 1507.5483 ++ 1301.568842 m 0.0000 51 | 1/23
2 h-m-p 0.0000 0.0000 335.3952 ++ 1301.439079 m 0.0000 100 | 2/23
3 h-m-p 0.0000 0.0001 176.7980 +YYYC 1301.003887 3 0.0000 152 | 2/23
4 h-m-p 0.0001 0.0004 120.7392 CYC 1300.823916 2 0.0000 202 | 2/23
5 h-m-p 0.0001 0.0006 64.5003 CCCC 1300.656830 3 0.0001 255 | 2/23
6 h-m-p 0.0001 0.0004 81.4341 CYCCC 1300.455832 4 0.0001 309 | 2/23
7 h-m-p 0.0000 0.0002 465.1474 +YCY 1300.006241 2 0.0001 360 | 2/23
8 h-m-p 0.0000 0.0001 541.7515 ++ 1297.705770 m 0.0001 407 | 3/23
9 h-m-p 0.0000 0.0002 472.9965 YCYCCC 1297.381678 5 0.0001 462 | 3/23
10 h-m-p 0.0000 0.0008 1345.8530 +YCCCC 1295.036312 4 0.0003 516 | 3/23
11 h-m-p 0.0000 0.0002 3419.5984 +YYCCC 1291.939098 4 0.0001 569 | 3/23
12 h-m-p 0.0000 0.0002 9904.9205 YCCCC 1291.102362 4 0.0000 622 | 3/23
13 h-m-p 0.0000 0.0002 1391.0965 YCCCC 1290.266724 4 0.0001 675 | 3/23
14 h-m-p 0.0003 0.0015 40.2075 YC 1290.234838 1 0.0001 722 | 3/23
15 h-m-p 0.0004 0.0026 12.4540 CCC 1290.223150 2 0.0001 772 | 3/23
16 h-m-p 0.0003 0.0359 6.3367 ++YCCC 1289.358159 3 0.0099 825 | 3/23
17 h-m-p 0.0003 0.0015 229.1017 +YCYCCC 1286.379618 5 0.0008 880 | 3/23
18 h-m-p 0.0001 0.0003 779.9918 +YYCCCC 1283.959664 5 0.0002 935 | 3/23
19 h-m-p 0.0247 0.1234 4.8915 ++ 1278.749305 m 0.1234 981 | 4/23
20 h-m-p 0.0689 0.3443 2.7981 +YYYCCCC 1271.746364 6 0.2458 1037 | 4/23
21 h-m-p 0.3174 2.1802 2.1672 CYCCC 1267.266419 4 0.3473 1089 | 4/23
22 h-m-p 0.2925 1.4623 0.4511 CYCCC 1265.861422 4 0.4632 1141 | 4/23
23 h-m-p 0.2191 1.6953 0.9534 +YYCCC 1264.293376 4 0.6503 1193 | 4/23
24 h-m-p 0.2782 1.3910 0.9153 CCCCC 1263.660413 4 0.4272 1246 | 4/23
25 h-m-p 0.5502 4.5973 0.7107 CCCC 1263.320535 3 0.8214 1297 | 4/23
26 h-m-p 1.6000 8.0000 0.2202 YCC 1263.258745 2 0.6763 1345 | 4/23
27 h-m-p 1.6000 8.0000 0.0483 CCC 1263.219419 2 1.2954 1394 | 4/23
28 h-m-p 0.9270 8.0000 0.0675 CCC 1263.176766 2 1.4637 1443 | 4/23
29 h-m-p 1.6000 8.0000 0.0375 CCC 1263.127821 2 1.3414 1492 | 4/23
30 h-m-p 1.6000 8.0000 0.0176 CC 1263.111083 1 1.9140 1539 | 4/23
31 h-m-p 1.2775 8.0000 0.0264 +YC 1263.091376 1 3.4211 1586 | 4/23
32 h-m-p 1.6000 8.0000 0.0519 CC 1263.074283 1 1.7065 1633 | 4/23
33 h-m-p 1.6000 8.0000 0.0218 CC 1263.068657 1 1.3126 1680 | 4/23
34 h-m-p 1.6000 8.0000 0.0047 CC 1263.067066 1 2.1022 1727 | 4/23
35 h-m-p 1.6000 8.0000 0.0023 YC 1263.066813 1 1.0815 1773 | 4/23
36 h-m-p 1.6000 8.0000 0.0014 C 1263.066775 0 1.3604 1818 | 4/23
37 h-m-p 1.6000 8.0000 0.0008 Y 1263.066771 0 1.0755 1863 | 4/23
38 h-m-p 1.6000 8.0000 0.0002 Y 1263.066771 0 1.1651 1908 | 4/23
39 h-m-p 1.6000 8.0000 0.0000 Y 1263.066771 0 1.0306 1953 | 4/23
40 h-m-p 1.6000 8.0000 0.0000 ---C 1263.066771 0 0.0063 2001
Out..
lnL = -1263.066771
2002 lfun, 8008 eigenQcodon, 108108 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1278.128683 S = -1254.843543 -14.479194
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 84 patterns 1:03
did 20 / 84 patterns 1:03
did 30 / 84 patterns 1:03
did 40 / 84 patterns 1:03
did 50 / 84 patterns 1:03
did 60 / 84 patterns 1:03
did 70 / 84 patterns 1:03
did 80 / 84 patterns 1:03
did 84 / 84 patterns 1:03
Time used: 1:03
Model 3: discrete
TREE # 1
(1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
0.004607 0.000221 0.004764 0.006623 0.002525 0.000000 0.004439 0.032688 0.010138 0.001047 0.012236 0.009406 0.016565 0.024105 0.019430 0.008995 0.015055 0.014261 2.601378 0.898262 0.025525 0.012014 0.027227 0.041946
ntime & nrate & np: 18 4 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 14.494281
np = 24
lnL0 = -1265.410687
Iterating by ming2
Initial: fx= 1265.410687
x= 0.00461 0.00022 0.00476 0.00662 0.00253 0.00000 0.00444 0.03269 0.01014 0.00105 0.01224 0.00941 0.01657 0.02411 0.01943 0.00900 0.01505 0.01426 2.60138 0.89826 0.02553 0.01201 0.02723 0.04195
1 h-m-p 0.0000 0.0000 771.8701 ++ 1265.407003 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0000 369.9651 ++ 1265.325126 m 0.0000 104 | 2/24
3 h-m-p 0.0000 0.0000 231.3845 CYCCC 1265.046217 4 0.0000 161 | 2/24
4 h-m-p 0.0001 0.0003 75.5010 YC 1264.966298 1 0.0000 211 | 2/24
5 h-m-p 0.0001 0.0006 37.0173 YC 1264.947158 1 0.0000 261 | 2/24
6 h-m-p 0.0001 0.0019 18.6420 CC 1264.938765 1 0.0001 312 | 2/24
7 h-m-p 0.0001 0.0017 8.4531 CC 1264.937173 1 0.0001 363 | 2/24
8 h-m-p 0.0000 0.0035 9.9838 CC 1264.935587 1 0.0001 414 | 2/24
9 h-m-p 0.0001 0.0070 9.2059 YC 1264.933504 1 0.0001 464 | 2/24
10 h-m-p 0.0001 0.0030 13.6021 YC 1264.930351 1 0.0001 514 | 2/24
11 h-m-p 0.0001 0.0019 35.0668 CC 1264.926990 1 0.0001 565 | 2/24
12 h-m-p 0.0001 0.0028 20.4746 YC 1264.919625 1 0.0002 615 | 2/24
13 h-m-p 0.0001 0.0008 36.0911 +CC 1264.892370 1 0.0005 667 | 2/24
14 h-m-p 0.0000 0.0000 403.2957 ++ 1264.854732 m 0.0000 716 | 3/24
15 h-m-p 0.0001 0.0009 87.7786 C 1264.852647 0 0.0000 765 | 3/24
16 h-m-p 0.0016 0.0366 1.6259 YC 1264.852160 1 0.0002 814 | 3/24
17 h-m-p 0.0001 0.0118 5.2513 +++YC 1264.830762 1 0.0035 866 | 3/24
18 h-m-p 0.0000 0.0001 564.4221 ++ 1264.706702 m 0.0001 914 | 4/24
19 h-m-p 0.0051 0.0256 5.1517 --YC 1264.706261 1 0.0001 965 | 4/24
20 h-m-p 0.0036 0.6551 0.2000 +++YCC 1264.101834 2 0.1728 1018 | 3/24
21 h-m-p 0.0095 0.0615 3.6276 -YC 1264.096003 1 0.0010 1067 | 3/24
22 h-m-p 0.0061 0.0305 0.4295 ++ 1264.048501 m 0.0305 1115 | 4/24
23 h-m-p 0.0020 0.1305 6.3431 +CYC 1263.952954 2 0.0107 1167 | 4/24
24 h-m-p 0.3958 8.0000 0.1713 +CCC 1263.711699 2 1.9866 1219 | 4/24
25 h-m-p 1.0965 6.8583 0.3103 CCC 1263.604664 2 1.1530 1270 | 4/24
26 h-m-p 0.6210 5.1660 0.5762 CCCC 1263.504531 3 0.8839 1323 | 4/24
27 h-m-p 1.6000 8.0000 0.2152 CCC 1263.373551 2 2.4652 1374 | 4/24
28 h-m-p 1.6000 8.0000 0.1127 YC 1263.336411 1 0.9924 1422 | 4/24
29 h-m-p 0.6421 8.0000 0.1742 YC 1263.332839 1 0.4672 1470 | 4/24
30 h-m-p 1.6000 8.0000 0.0230 ----------------.. | 4/24
31 h-m-p 0.0000 0.0001 45.1765 YC 1263.306951 1 0.0000 1579 | 4/24
32 h-m-p 0.0001 0.0013 16.1913 YC 1263.301974 1 0.0000 1627 | 4/24
33 h-m-p 0.0001 0.0016 6.7182 C 1263.301446 0 0.0000 1674 | 4/24
34 h-m-p 0.0000 0.0084 3.9904 C 1263.301188 0 0.0000 1721 | 4/24
35 h-m-p 0.0001 0.0205 2.2343 +YC 1263.300720 1 0.0003 1770 | 4/24
36 h-m-p 0.0000 0.0042 15.6092 +CC 1263.298644 1 0.0002 1820 | 4/24
37 h-m-p 0.0000 0.0042 85.9596 +CC 1263.291399 1 0.0001 1870 | 4/24
38 h-m-p 0.0001 0.0010 142.8303 CCC 1263.283496 2 0.0001 1921 | 4/24
39 h-m-p 0.0000 0.0033 328.5187 +YCC 1263.260499 2 0.0001 1972 | 4/24
40 h-m-p 0.0002 0.0014 200.4300 YC 1263.250117 1 0.0001 2020 | 4/24
41 h-m-p 0.0003 0.0015 55.1838 -CC 1263.249342 1 0.0000 2070 | 4/24
42 h-m-p 0.0002 0.0077 4.5864 C 1263.249130 0 0.0001 2117 | 4/24
43 h-m-p 0.0001 0.0312 2.9687 YC 1263.249012 1 0.0001 2165 | 4/24
44 h-m-p 0.0003 0.0105 0.9195 -C 1263.249007 0 0.0000 2213 | 4/24
45 h-m-p 0.0003 0.1278 0.4184 C 1263.248983 0 0.0004 2260 | 4/24
46 h-m-p 0.0009 0.4333 2.1331 +C 1263.247860 0 0.0037 2308 | 4/24
47 h-m-p 0.0003 0.1606 142.9499 ++YYC 1263.135219 2 0.0046 2359 | 4/24
48 h-m-p 0.0053 0.1636 123.0969 --CC 1263.134038 1 0.0001 2410 | 4/24
49 h-m-p 0.0514 8.0000 0.1620 ++YC 1263.094258 1 1.9507 2460 | 4/24
50 h-m-p 1.6000 8.0000 0.0987 YC 1263.075585 1 1.1009 2508 | 4/24
51 h-m-p 0.6992 8.0000 0.1554 YC 1263.064499 1 1.2167 2556 | 4/24
52 h-m-p 1.6000 8.0000 0.0405 CC 1263.063118 1 1.3845 2605 | 4/24
53 h-m-p 1.6000 8.0000 0.0051 Y 1263.063085 0 1.0959 2652 | 4/24
54 h-m-p 1.6000 8.0000 0.0009 Y 1263.063085 0 0.9930 2699 | 4/24
55 h-m-p 1.6000 8.0000 0.0000 Y 1263.063085 0 0.7507 2746 | 4/24
56 h-m-p 1.6000 8.0000 0.0000 --C 1263.063085 0 0.0250 2795 | 4/24
57 h-m-p 0.0160 8.0000 0.0000 -------------.. | 4/24
58 h-m-p 0.0160 8.0000 0.0008 -------------
Out..
lnL = -1263.063085
2912 lfun, 11648 eigenQcodon, 157248 P(t)
Time used: 1:48
Model 7: beta
TREE # 1
(1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
0.004753 0.000471 0.004807 0.006362 0.002263 0.000000 0.004860 0.032727 0.010120 0.000509 0.011857 0.009601 0.016631 0.023615 0.019429 0.009307 0.014659 0.014416 2.595567 0.649633 1.679063
ntime & nrate & np: 18 1 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.440735
np = 21
lnL0 = -1281.725047
Iterating by ming2
Initial: fx= 1281.725047
x= 0.00475 0.00047 0.00481 0.00636 0.00226 0.00000 0.00486 0.03273 0.01012 0.00051 0.01186 0.00960 0.01663 0.02361 0.01943 0.00931 0.01466 0.01442 2.59557 0.64963 1.67906
1 h-m-p 0.0000 0.0000 1707.6845 ++ 1281.707025 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 345.0935 ++ 1281.502946 m 0.0000 92 | 2/21
3 h-m-p 0.0000 0.0001 187.2735 +YCCC 1281.158031 3 0.0000 142 | 2/21
4 h-m-p 0.0001 0.0003 96.6617 CCC 1281.018189 2 0.0000 189 | 2/21
5 h-m-p 0.0001 0.0007 45.2981 YCC 1280.962759 2 0.0001 235 | 2/21
6 h-m-p 0.0000 0.0005 66.8148 CC 1280.898951 1 0.0001 280 | 2/21
7 h-m-p 0.0001 0.0010 77.5720 +YCCCC 1280.661855 4 0.0003 331 | 2/21
8 h-m-p 0.0001 0.0006 388.7774 +CYCCC 1279.522504 4 0.0003 382 | 2/21
9 h-m-p 0.0000 0.0001 2553.9150 YCCCC 1277.855154 4 0.0001 432 | 2/21
10 h-m-p 0.0000 0.0001 4764.4666 +YYYCCC 1273.968661 5 0.0001 483 | 2/21
11 h-m-p 0.0000 0.0000 32001.1762 CYCCC 1273.296613 4 0.0000 533 | 2/21
12 h-m-p 0.0000 0.0001 885.6327 CCCC 1273.167096 3 0.0000 582 | 2/21
13 h-m-p 0.0001 0.0004 42.1954 CCC 1273.156685 2 0.0000 629 | 2/21
14 h-m-p 0.0001 0.0022 11.0093 CCC 1273.150299 2 0.0001 676 | 2/21
15 h-m-p 0.0001 0.0048 23.8616 +CCC 1273.120804 2 0.0003 724 | 2/21
16 h-m-p 0.0001 0.0064 76.3954 +YCCC 1272.862798 3 0.0009 773 | 2/21
17 h-m-p 0.0001 0.0010 795.8615 +CYCCC 1271.185341 4 0.0005 824 | 2/21
18 h-m-p 0.0001 0.0003 2843.9528 YCYCCC 1269.402344 5 0.0001 875 | 2/21
19 h-m-p 0.1428 0.7141 1.3269 YCYCCC 1266.485897 5 0.3419 926 | 2/21
20 h-m-p 0.3685 1.8425 0.4257 CCCC 1264.793665 3 0.5643 975 | 2/21
21 h-m-p 0.9305 8.0000 0.2582 CYC 1264.383157 2 1.1028 1021 | 2/21
22 h-m-p 1.1712 5.8559 0.1252 CCCC 1264.039650 3 1.4032 1070 | 2/21
23 h-m-p 1.0359 5.1796 0.1598 YYC 1263.905752 2 0.8372 1115 | 2/21
24 h-m-p 1.3614 8.0000 0.0983 YC 1263.838499 1 1.0371 1159 | 2/21
25 h-m-p 1.6000 8.0000 0.0198 CYC 1263.769673 2 1.9043 1205 | 2/21
26 h-m-p 1.0109 8.0000 0.0373 YC 1263.727740 1 1.8161 1249 | 2/21
27 h-m-p 1.0566 8.0000 0.0640 +YC 1263.685695 1 2.9341 1294 | 2/21
28 h-m-p 1.6000 8.0000 0.0801 CCC 1263.647993 2 1.8915 1341 | 2/21
29 h-m-p 1.6000 8.0000 0.0530 CC 1263.637169 1 1.4330 1386 | 2/21
30 h-m-p 1.6000 8.0000 0.0300 CC 1263.631785 1 1.7811 1431 | 2/21
31 h-m-p 1.6000 8.0000 0.0233 CC 1263.629357 1 2.4509 1476 | 2/21
32 h-m-p 1.4868 8.0000 0.0384 +YC 1263.623429 1 4.8337 1521 | 2/21
33 h-m-p 1.6000 8.0000 0.0860 YC 1263.614002 1 3.5456 1565 | 2/21
34 h-m-p 1.6000 8.0000 0.0817 YC 1263.603935 1 3.4280 1609 | 2/21
35 h-m-p 1.4238 8.0000 0.1966 ++ 1263.532022 m 8.0000 1652 | 2/21
36 h-m-p 0.0054 0.0268 35.4299 YYCYCYC 1263.470505 6 0.0163 1705 | 2/21
37 h-m-p 0.0758 0.3788 0.9593 CC 1263.469489 1 0.0194 1750 | 2/21
38 h-m-p 0.4120 6.2696 0.0451 CYC 1263.412325 2 0.3532 1796 | 2/21
39 h-m-p 0.6360 8.0000 0.0250 YC 1263.394920 1 1.3755 1840 | 2/21
40 h-m-p 1.6000 8.0000 0.0046 C 1263.393079 0 1.4724 1883 | 2/21
41 h-m-p 0.7143 8.0000 0.0096 YC 1263.392731 1 1.3569 1927 | 2/21
42 h-m-p 1.6000 8.0000 0.0035 YC 1263.392661 1 1.1194 1971 | 2/21
43 h-m-p 0.4941 8.0000 0.0080 +C 1263.392569 0 2.0180 2015 | 2/21
44 h-m-p 1.6000 8.0000 0.0088 YC 1263.392443 1 3.8024 2059 | 2/21
45 h-m-p 1.6000 8.0000 0.0066 Y 1263.392427 0 0.7999 2102 | 2/21
46 h-m-p 1.6000 8.0000 0.0020 Y 1263.392417 0 0.8477 2145 | 2/21
47 h-m-p 1.6000 8.0000 0.0007 C 1263.392412 0 1.6541 2188 | 2/21
48 h-m-p 1.6000 8.0000 0.0005 C 1263.392410 0 1.7774 2231 | 2/21
49 h-m-p 1.6000 8.0000 0.0001 Y 1263.392409 0 0.8070 2274 | 2/21
50 h-m-p 0.8397 8.0000 0.0001 ++ 1263.392408 m 8.0000 2317 | 2/21
51 h-m-p 1.2164 8.0000 0.0007 -C 1263.392408 0 0.0952 2361 | 2/21
52 h-m-p 0.1075 8.0000 0.0006 Y 1263.392408 0 0.0164 2404 | 2/21
53 h-m-p 0.0162 8.0000 0.0006 --C 1263.392408 0 0.0003 2449 | 2/21
54 h-m-p 0.0160 8.0000 0.0024 +++C 1263.392402 0 1.0885 2495 | 2/21
55 h-m-p 1.2487 8.0000 0.0021 --------C 1263.392402 0 0.0000 2546 | 2/21
56 h-m-p 0.0160 8.0000 0.1585 ----------C 1263.392402 0 0.0000 2599 | 2/21
57 h-m-p 0.0160 8.0000 0.0003 ++Y 1263.392400 0 0.4453 2644 | 2/21
58 h-m-p 1.6000 8.0000 0.0000 Y 1263.392400 0 1.0577 2687 | 2/21
59 h-m-p 1.6000 8.0000 0.0000 ++ 1263.392400 m 8.0000 2730 | 2/21
60 h-m-p 0.6545 8.0000 0.0000 -----------C 1263.392400 0 0.0000 2784
Out..
lnL = -1263.392400
2785 lfun, 30635 eigenQcodon, 501300 P(t)
Time used: 4:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
initial w for M8:NSbetaw>1 reset.
0.004686 0.000000 0.004945 0.006934 0.002770 0.000564 0.004523 0.033630 0.011130 0.000969 0.013132 0.009090 0.017607 0.023518 0.019348 0.009324 0.016309 0.015877 2.597108 0.900000 0.578325 1.546757 2.928793
ntime & nrate & np: 18 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.918020
np = 23
lnL0 = -1292.112827
Iterating by ming2
Initial: fx= 1292.112827
x= 0.00469 0.00000 0.00495 0.00693 0.00277 0.00056 0.00452 0.03363 0.01113 0.00097 0.01313 0.00909 0.01761 0.02352 0.01935 0.00932 0.01631 0.01588 2.59711 0.90000 0.57833 1.54676 2.92879
1 h-m-p 0.0000 0.0000 876.7134 ++ 1292.107430 m 0.0000 51 | 1/23
2 h-m-p 0.0000 0.0000 354.9570 ++ 1291.859741 m 0.0000 100 | 2/23
3 h-m-p 0.0000 0.0001 389.2748 +YYCCC 1290.655488 4 0.0000 155 | 2/23
4 h-m-p 0.0000 0.0002 339.5146 +YCCC 1288.703649 3 0.0001 208 | 2/23
5 h-m-p 0.0000 0.0001 589.4062 +YCCC 1284.625018 3 0.0001 261 | 2/23
6 h-m-p 0.0000 0.0000 976.4123 ++ 1283.826660 m 0.0000 308 | 3/23
7 h-m-p 0.0000 0.0001 321.4907 +YYCCC 1283.221630 4 0.0000 362 | 3/23
8 h-m-p 0.0000 0.0002 300.2518 YCCCC 1282.269801 4 0.0001 415 | 3/23
9 h-m-p 0.0000 0.0002 222.7462 YCCCC 1281.275355 4 0.0001 468 | 3/23
10 h-m-p 0.0000 0.0001 350.7704 CCCC 1280.838909 3 0.0000 520 | 3/23
11 h-m-p 0.0000 0.0002 175.6344 CYCCC 1280.448778 4 0.0001 573 | 3/23
12 h-m-p 0.0000 0.0003 260.5722 CCC 1280.116353 2 0.0001 623 | 3/23
13 h-m-p 0.0000 0.0002 328.4830 CCC 1279.825892 2 0.0000 673 | 3/23
14 h-m-p 0.0001 0.0006 57.0374 CYC 1279.749076 2 0.0001 722 | 3/23
15 h-m-p 0.0000 0.0006 114.0621 YCCC 1279.632953 3 0.0001 773 | 3/23
16 h-m-p 0.0000 0.0017 244.5888 ++CYCCCC 1272.872129 5 0.0014 831 | 3/23
17 h-m-p 0.0000 0.0000 63012.2208 YCYCCC 1271.504612 5 0.0000 886 | 3/23
18 h-m-p 0.0009 0.0046 6.9549 YC 1271.500446 1 0.0001 933 | 3/23
19 h-m-p 0.0002 0.0877 41.1281 ++++YCC 1267.817459 2 0.0294 986 | 3/23
20 h-m-p 0.3324 1.6622 0.9496 CYCCC 1265.606510 4 0.5988 1039 | 2/23
21 h-m-p 0.0002 0.0011 946.6431 CYCC 1265.427588 3 0.0001 1090 | 2/23
22 h-m-p 0.1134 2.6736 0.5049 +YCCC 1264.271842 3 0.9132 1143 | 2/23
23 h-m-p 0.3956 1.9782 0.3497 CCCC 1263.994435 3 0.5590 1196 | 2/23
24 h-m-p 0.7148 3.5741 0.2106 CCC 1263.730066 2 1.1043 1247 | 2/23
25 h-m-p 0.3803 1.9017 0.2716 +YC 1263.508758 1 1.1665 1296 | 2/23
26 h-m-p 1.2372 6.1861 0.1573 CYC 1263.302114 2 1.3652 1346 | 2/23
27 h-m-p 0.2452 1.2259 0.2322 ++ 1263.180848 m 1.2259 1393 | 2/23
28 h-m-p -0.0000 -0.0000 0.1524
h-m-p: -0.00000000e+00 -0.00000000e+00 1.52443313e-01 1263.180848
.. | 2/23
29 h-m-p 0.0000 0.0001 77.2584 +YYCC 1263.086651 3 0.0000 1489 | 2/23
30 h-m-p 0.0001 0.0005 29.2795 YC 1263.074596 1 0.0000 1537 | 2/23
31 h-m-p 0.0001 0.0008 14.5620 YC 1263.071931 1 0.0000 1585 | 2/23
32 h-m-p 0.0001 0.0045 8.0226 CC 1263.070066 1 0.0001 1634 | 2/23
33 h-m-p 0.0001 0.0047 8.4819 YC 1263.069276 1 0.0000 1682 | 2/23
34 h-m-p 0.0000 0.0005 9.6119 CC 1263.068358 1 0.0001 1731 | 2/23
35 h-m-p 0.0000 0.0001 3.0604 YC 1263.068224 1 0.0000 1779 | 2/23
36 h-m-p 0.0000 0.0001 1.1921 Y 1263.068209 0 0.0000 1826 | 2/23
37 h-m-p 0.0000 0.0000 0.7820 ++ 1263.068200 m 0.0000 1873 | 3/23
38 h-m-p 0.0000 0.0023 2.0467 ++C 1263.068130 0 0.0001 1922 | 3/23
39 h-m-p 0.0001 0.0008 5.5391 C 1263.068073 0 0.0000 1968 | 3/23
40 h-m-p 0.0000 0.0006 6.1138 +
QuantileBeta(0.15, 0.00500, 3.34004) = 7.213574e-161 2000 rounds
YC 1263.067901 1 0.0001 2016 | 3/23
41 h-m-p 0.0001 0.0003 10.2392 YC 1263.067604 1 0.0001 2063 | 3/23
42 h-m-p 0.0001 0.0003 5.5867 Y 1263.067573 0 0.0000 2109 | 3/23
43 h-m-p 0.0001 0.0007 2.3761 C 1263.067545 0 0.0001 2155 | 3/23
44 h-m-p 0.0004 0.0068 0.3560 C 1263.067541 0 0.0001 2201 | 3/23
45 h-m-p 0.0003 0.0602 0.1093 Y 1263.067541 0 0.0001 2247 | 3/23
46 h-m-p 0.0038 1.9107 0.0435 +Y 1263.067528 0 0.0118 2294 | 3/23
47 h-m-p 0.0001 0.0119 7.1965 +++
QuantileBeta(0.15, 0.00500, 3.33995) = 7.213794e-161 2000 rounds
C 1263.066796 0 0.0042 2343 | 3/23
48 h-m-p 0.4824 2.4120 0.0004 C 1263.066782 0 0.6609 2389 | 3/23
49 h-m-p 0.3058 1.5291 0.0008 +
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
+ 1263.066769 m 1.5291 2435
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34011) = 7.213400e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33981) = 7.214152e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33996) = 7.213776e-161 2000 rounds
| 4/23
50 h-m-p 1.6000 8.0000 0.0005
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34007) = 7.213497e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
Y 1263.066768 0 0.9826 2481
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.465562e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34012) = 7.213358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33982) = 7.214109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33997) = 7.213733e-161 2000 rounds
| 4/23
51 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33999) = 7.213693e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
Y 1263.066768 0 1.1963 2526
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.465554e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34013) = 7.213350e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33983) = 7.214101e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
| 4/23
52 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213719e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213724e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213725e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
Y 1263.066768 0 0.0000 2582
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
Out..
lnL = -1263.066768
2583 lfun, 30996 eigenQcodon, 511434 P(t)
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1279.948996 S = -1254.843542 -16.886060
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 84 patterns 6:37
did 20 / 84 patterns 6:37
did 30 / 84 patterns 6:37
did 40 / 84 patterns 6:37
did 50 / 84 patterns 6:37
did 60 / 84 patterns 6:38
did 70 / 84 patterns 6:38
did 80 / 84 patterns 6:38
did 84 / 84 patterns 6:38
QuantileBeta(0.15, 0.00500, 3.33998) = 7.213726e-161 2000 rounds
Time used: 6:38
CodeML output code: -1
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/14-3-3zeta-PK/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 12 ls = 248
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 3 | Cys TGT 0 0 0 0 0 0
TTC 3 4 4 4 4 4 | TCC 7 7 7 7 7 7 | TAC 11 11 11 11 11 10 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 5 5 5 5 5 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 4 4 4 4 4 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 1 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 4 5 5 3
CTC 5 5 5 5 5 5 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 2 2 3 2 2 3
CTA 0 0 0 0 0 1 | CCA 4 4 4 4 4 3 | Gln CAA 3 3 3 3 3 3 | CGA 0 0 0 0 0 1
CTG 11 11 11 11 11 10 | CCG 0 0 0 0 0 0 | CAG 11 11 11 11 11 11 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 3 | Thr ACT 2 2 2 2 3 1 | Asn AAT 4 4 4 4 4 4 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 5 | ACC 4 4 4 4 3 5 | AAC 6 6 6 6 6 6 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 6 6 6 6 6 6 | Lys AAA 9 9 9 9 9 10 | Arg AGA 3 3 3 3 3 3
Met ATG 6 6 6 6 6 6 | ACG 1 1 1 1 1 1 | AAG 9 9 9 9 9 8 | AGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 6 6 6 6 6 5 | Asp GAT 9 9 9 7 7 8 | Gly GGT 4 4 4 4 4 4
GTC 7 7 7 7 7 7 | GCC 11 11 11 11 11 11 | GAC 11 11 11 13 13 13 | GGC 4 4 4 4 4 5
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 7 7 7 7 7 6 | GGA 2 2 2 2 2 2
GTG 3 3 3 3 3 3 | GCG 2 2 2 2 2 2 | GAG 17 17 17 17 17 17 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 1 0 | Tyr TAT 3 3 3 3 2 3 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 7 7 6 7 8 7 | TAC 10 10 10 10 11 10 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 0 1 1 | TCA 4 5 5 4 2 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 5 6 6 5 5 | TCG 5 4 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 3 3 2 4 4 | Pro CCT 0 1 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 4 4 4 4 4 4
CTC 7 6 6 7 5 5 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 0 0 1 0 0 1 | CCA 4 3 4 4 4 4 | Gln CAA 3 4 3 3 4 4 | CGA 0 0 0 0 0 0
CTG 11 10 8 10 10 9 | CCG 0 0 0 0 0 0 | CAG 11 10 11 11 10 10 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 3 4 4 4 4 | Thr ACT 1 1 2 1 1 1 | Asn AAT 4 4 3 4 4 4 | Ser AGT 0 0 0 0 0 0
ATC 6 5 4 4 4 4 | ACC 5 5 4 5 6 4 | AAC 6 6 7 6 6 6 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 6 6 6 6 5 6 | Lys AAA 10 10 10 10 10 10 | Arg AGA 3 3 3 3 3 3
Met ATG 6 6 6 6 6 6 | ACG 1 1 1 1 1 1 | AAG 8 8 8 8 8 8 | AGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 5 5 5 5 5 5 | Asp GAT 8 8 10 8 9 9 | Gly GGT 4 4 4 4 4 4
GTC 7 7 7 8 7 7 | GCC 11 11 11 11 11 12 | GAC 13 13 11 13 12 12 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 5 5 6 6 6 7 | GGA 2 2 2 2 2 2
GTG 3 3 3 2 3 3 | GCG 2 2 2 2 2 2 | GAG 18 18 17 17 17 16 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22984 A:0.40323 G:0.12500
position 3: T:0.18952 C:0.33065 A:0.17742 G:0.30242
Average T:0.20296 C:0.25000 A:0.28226 G:0.26478
#2: D_sechellia_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22984 A:0.40323 G:0.12500
position 3: T:0.18548 C:0.33468 A:0.17742 G:0.30242
Average T:0.20161 C:0.25134 A:0.28226 G:0.26478
#3: D_simulans_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22984 A:0.40323 G:0.12500
position 3: T:0.18145 C:0.33871 A:0.17742 G:0.30242
Average T:0.20027 C:0.25269 A:0.28226 G:0.26478
#4: D_yakuba_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22984 A:0.40323 G:0.12500
position 3: T:0.17742 C:0.34274 A:0.17742 G:0.30242
Average T:0.19892 C:0.25403 A:0.28226 G:0.26478
#5: D_erecta_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22984 A:0.40323 G:0.12500
position 3: T:0.18145 C:0.33871 A:0.17742 G:0.30242
Average T:0.20027 C:0.25269 A:0.28226 G:0.26478
#6: D_takahashii_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22581 A:0.40323 G:0.12903
position 3: T:0.16935 C:0.35484 A:0.17742 G:0.29839
Average T:0.19624 C:0.25672 A:0.28226 G:0.26478
#7: D_biarmipes_14-3-3zeta-PK
position 1: T:0.17339 C:0.19355 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22581 A:0.40323 G:0.12903
position 3: T:0.16129 C:0.36694 A:0.16935 G:0.30242
Average T:0.19220 C:0.26210 A:0.27957 G:0.26613
#8: D_suzukii_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22581 A:0.40323 G:0.12903
position 3: T:0.17339 C:0.35887 A:0.17339 G:0.29435
Average T:0.19758 C:0.25806 A:0.28091 G:0.26344
#9: D_eugracilis_14-3-3zeta-PK
position 1: T:0.18145 C:0.18548 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22581 A:0.40323 G:0.12903
position 3: T:0.18145 C:0.34274 A:0.18145 G:0.29435
Average T:0.20161 C:0.25134 A:0.28360 G:0.26344
#10: D_ficusphila_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22581 A:0.40323 G:0.12903
position 3: T:0.16935 C:0.36290 A:0.16935 G:0.29839
Average T:0.19624 C:0.25941 A:0.27957 G:0.26478
#11: D_rhopaloa_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22581 A:0.40323 G:0.12903
position 3: T:0.18145 C:0.35887 A:0.16532 G:0.29435
Average T:0.20027 C:0.25806 A:0.27823 G:0.26344
#12: D_elegans_14-3-3zeta-PK
position 1: T:0.17742 C:0.18952 A:0.26210 G:0.37097
position 2: T:0.24194 C:0.22581 A:0.40323 G:0.12903
position 3: T:0.18145 C:0.34677 A:0.18548 G:0.28629
Average T:0.20027 C:0.25403 A:0.28360 G:0.26210
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 13 | Ser S TCT 1 | Tyr Y TAT 30 | Cys C TGT 0
TTC 47 | TCC 84 | TAC 126 | TGC 24
Leu L TTA 11 | TCA 53 | *** * TAA 0 | *** * TGA 0
TTG 61 | TCG 54 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 36 | Pro P CCT 2 | His H CAT 12 | Arg R CGT 51
CTC 66 | CCC 24 | CAC 0 | CGC 32
CTA 3 | CCA 46 | Gln Q CAA 39 | CGA 1
CTG 123 | CCG 0 | CAG 129 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 44 | Thr T ACT 19 | Asn N AAT 47 | Ser S AGT 0
ATC 52 | ACC 53 | AAC 73 | AGC 36
ATA 12 | ACA 71 | Lys K AAA 115 | Arg R AGA 36
Met M ATG 72 | ACG 12 | AAG 101 | AGG 48
------------------------------------------------------------------------------
Val V GTT 60 | Ala A GCT 65 | Asp D GAT 101 | Gly G GGT 48
GTC 85 | GCC 133 | GAC 146 | GGC 55
GTA 0 | GCA 36 | Glu E GAA 76 | GGA 24
GTG 35 | GCG 24 | GAG 205 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17742 C:0.18952 A:0.26579 G:0.36727
position 2: T:0.24194 C:0.22749 A:0.40323 G:0.12735
position 3: T:0.17776 C:0.34812 A:0.17574 G:0.29839
Average T:0.19904 C:0.25504 A:0.28159 G:0.26434
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_14-3-3zeta-PK
D_sechellia_14-3-3zeta-PK -1.0000 (0.0000 0.0058)
D_simulans_14-3-3zeta-PK -1.0000 (0.0000 0.0117)-1.0000 (0.0000 0.0058)
D_yakuba_14-3-3zeta-PK -1.0000 (0.0000 0.0177)-1.0000 (0.0000 0.0117)-1.0000 (0.0000 0.0177)
D_erecta_14-3-3zeta-PK -1.0000 (0.0000 0.0237)-1.0000 (0.0000 0.0177)-1.0000 (0.0000 0.0237)-1.0000 (0.0000 0.0058)
D_takahashii_14-3-3zeta-PK 0.0528 (0.0044 0.0830) 0.0573 (0.0044 0.0765) 0.0528 (0.0044 0.0830) 0.0688 (0.0044 0.0637) 0.0625 (0.0044 0.0701)
D_biarmipes_14-3-3zeta-PK 0.0489 (0.0044 0.0895) 0.0528 (0.0044 0.0830) 0.0489 (0.0044 0.0895) 0.0625 (0.0044 0.0701) 0.0573 (0.0044 0.0765)-1.0000 (0.0000 0.0419)
D_suzukii_14-3-3zeta-PK 0.0571 (0.0044 0.0766) 0.0624 (0.0044 0.0702) 0.0571 (0.0044 0.0766) 0.0761 (0.0044 0.0575) 0.0686 (0.0044 0.0638)-1.0000 (0.0000 0.0297)-1.0000 (0.0000 0.0358)
D_eugracilis_14-3-3zeta-PK 0.0622 (0.0044 0.0703) 0.0685 (0.0044 0.0640) 0.0622 (0.0044 0.0703) 0.0685 (0.0044 0.0640) 0.0622 (0.0044 0.0703)-1.0000 (0.0000 0.0735)-1.0000 (0.0000 0.0800)-1.0000 (0.0000 0.0672)
D_ficusphila_14-3-3zeta-PK 0.0571 (0.0044 0.0767) 0.0623 (0.0044 0.0703) 0.0571 (0.0044 0.0767) 0.0623 (0.0044 0.0703) 0.0571 (0.0044 0.0767)-1.0000 (0.0000 0.0544)-1.0000 (0.0000 0.0482)-1.0000 (0.0000 0.0608)-1.0000 (0.0000 0.0673)
D_rhopaloa_14-3-3zeta-PK 0.0571 (0.0044 0.0767) 0.0623 (0.0044 0.0703) 0.0571 (0.0044 0.0767) 0.0623 (0.0044 0.0703) 0.0571 (0.0044 0.0767)-1.0000 (0.0000 0.0607)-1.0000 (0.0000 0.0735)-1.0000 (0.0000 0.0608)-1.0000 (0.0000 0.0802)-1.0000 (0.0000 0.0609)
D_elegans_14-3-3zeta-PK 0.0801 (0.0061 0.0767) 0.0874 (0.0061 0.0702) 0.0801 (0.0061 0.0767) 0.0874 (0.0061 0.0702) 0.0801 (0.0061 0.0767) 0.0364 (0.0017 0.0481) 0.0288 (0.0017 0.0607) 0.0363 (0.0017 0.0482) 0.0260 (0.0017 0.0672) 0.0362 (0.0017 0.0482) 0.0487 (0.0017 0.0359)
Model 0: one-ratio
TREE # 1: (1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
check convergence..
lnL(ntime: 18 np: 20): -1264.026193 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..8 17..7 16..9 16..10 16..19 19..11 19..12
0.004025 0.000004 0.004029 0.003881 0.004216 0.000004 0.004056 0.038104 0.009010 0.004206 0.009137 0.011419 0.015716 0.028950 0.016491 0.008193 0.016638 0.012204 2.558930 0.024029
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.19028
(1: 0.004025, 2: 0.000004, 3: 0.004029, ((4: 0.000004, 5: 0.004056): 0.004216, (((6: 0.009137, 8: 0.011419): 0.004206, 7: 0.015716): 0.009010, 9: 0.028950, 10: 0.016491, (11: 0.016638, 12: 0.012204): 0.008193): 0.038104): 0.003881);
(D_melanogaster_14-3-3zeta-PK: 0.004025, D_sechellia_14-3-3zeta-PK: 0.000004, D_simulans_14-3-3zeta-PK: 0.004029, ((D_yakuba_14-3-3zeta-PK: 0.000004, D_erecta_14-3-3zeta-PK: 0.004056): 0.004216, (((D_takahashii_14-3-3zeta-PK: 0.009137, D_suzukii_14-3-3zeta-PK: 0.011419): 0.004206, D_biarmipes_14-3-3zeta-PK: 0.015716): 0.009010, D_eugracilis_14-3-3zeta-PK: 0.028950, D_ficusphila_14-3-3zeta-PK: 0.016491, (D_rhopaloa_14-3-3zeta-PK: 0.016638, D_elegans_14-3-3zeta-PK: 0.012204): 0.008193): 0.038104): 0.003881);
Detailed output identifying parameters
kappa (ts/tv) = 2.55893
omega (dN/dS) = 0.02403
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 559.2 184.8 0.0240 0.0001 0.0050 0.1 0.9
13..2 0.000 559.2 184.8 0.0240 0.0000 0.0000 0.0 0.0
13..3 0.004 559.2 184.8 0.0240 0.0001 0.0050 0.1 0.9
13..14 0.004 559.2 184.8 0.0240 0.0001 0.0049 0.1 0.9
14..15 0.004 559.2 184.8 0.0240 0.0001 0.0053 0.1 1.0
15..4 0.000 559.2 184.8 0.0240 0.0000 0.0000 0.0 0.0
15..5 0.004 559.2 184.8 0.0240 0.0001 0.0051 0.1 0.9
14..16 0.038 559.2 184.8 0.0240 0.0011 0.0477 0.6 8.8
16..17 0.009 559.2 184.8 0.0240 0.0003 0.0113 0.2 2.1
17..18 0.004 559.2 184.8 0.0240 0.0001 0.0053 0.1 1.0
18..6 0.009 559.2 184.8 0.0240 0.0003 0.0114 0.2 2.1
18..8 0.011 559.2 184.8 0.0240 0.0003 0.0143 0.2 2.6
17..7 0.016 559.2 184.8 0.0240 0.0005 0.0197 0.3 3.6
16..9 0.029 559.2 184.8 0.0240 0.0009 0.0362 0.5 6.7
16..10 0.016 559.2 184.8 0.0240 0.0005 0.0206 0.3 3.8
16..19 0.008 559.2 184.8 0.0240 0.0002 0.0103 0.1 1.9
19..11 0.017 559.2 184.8 0.0240 0.0005 0.0208 0.3 3.8
19..12 0.012 559.2 184.8 0.0240 0.0004 0.0153 0.2 2.8
tree length for dN: 0.0057
tree length for dS: 0.2381
Time used: 0:13
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
lnL(ntime: 18 np: 21): -1263.066771 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..8 17..7 16..9 16..10 16..19 19..11 19..12
0.004045 0.000004 0.004049 0.003905 0.004237 0.000004 0.004089 0.038176 0.008989 0.004193 0.009114 0.011393 0.015680 0.028895 0.016454 0.008209 0.016634 0.012136 2.601378 0.968877 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.19021
(1: 0.004045, 2: 0.000004, 3: 0.004049, ((4: 0.000004, 5: 0.004089): 0.004237, (((6: 0.009114, 8: 0.011393): 0.004193, 7: 0.015680): 0.008989, 9: 0.028895, 10: 0.016454, (11: 0.016634, 12: 0.012136): 0.008209): 0.038176): 0.003905);
(D_melanogaster_14-3-3zeta-PK: 0.004045, D_sechellia_14-3-3zeta-PK: 0.000004, D_simulans_14-3-3zeta-PK: 0.004049, ((D_yakuba_14-3-3zeta-PK: 0.000004, D_erecta_14-3-3zeta-PK: 0.004089): 0.004237, (((D_takahashii_14-3-3zeta-PK: 0.009114, D_suzukii_14-3-3zeta-PK: 0.011393): 0.004193, D_biarmipes_14-3-3zeta-PK: 0.015680): 0.008989, D_eugracilis_14-3-3zeta-PK: 0.028895, D_ficusphila_14-3-3zeta-PK: 0.016454, (D_rhopaloa_14-3-3zeta-PK: 0.016634, D_elegans_14-3-3zeta-PK: 0.012136): 0.008209): 0.038176): 0.003905);
Detailed output identifying parameters
kappa (ts/tv) = 2.60138
dN/dS (w) for site classes (K=2)
p: 0.96888 0.03112
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 558.6 185.4 0.0311 0.0002 0.0049 0.1 0.9
13..2 0.000 558.6 185.4 0.0311 0.0000 0.0000 0.0 0.0
13..3 0.004 558.6 185.4 0.0311 0.0002 0.0050 0.1 0.9
13..14 0.004 558.6 185.4 0.0311 0.0001 0.0048 0.1 0.9
14..15 0.004 558.6 185.4 0.0311 0.0002 0.0052 0.1 1.0
15..4 0.000 558.6 185.4 0.0311 0.0000 0.0000 0.0 0.0
15..5 0.004 558.6 185.4 0.0311 0.0002 0.0050 0.1 0.9
14..16 0.038 558.6 185.4 0.0311 0.0015 0.0467 0.8 8.7
16..17 0.009 558.6 185.4 0.0311 0.0003 0.0110 0.2 2.0
17..18 0.004 558.6 185.4 0.0311 0.0002 0.0051 0.1 1.0
18..6 0.009 558.6 185.4 0.0311 0.0003 0.0111 0.2 2.1
18..8 0.011 558.6 185.4 0.0311 0.0004 0.0139 0.2 2.6
17..7 0.016 558.6 185.4 0.0311 0.0006 0.0192 0.3 3.6
16..9 0.029 558.6 185.4 0.0311 0.0011 0.0353 0.6 6.6
16..10 0.016 558.6 185.4 0.0311 0.0006 0.0201 0.3 3.7
16..19 0.008 558.6 185.4 0.0311 0.0003 0.0100 0.2 1.9
19..11 0.017 558.6 185.4 0.0311 0.0006 0.0203 0.4 3.8
19..12 0.012 558.6 185.4 0.0311 0.0005 0.0148 0.3 2.8
Time used: 0:32
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
lnL(ntime: 18 np: 23): -1263.066771 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..8 17..7 16..9 16..10 16..19 19..11 19..12
0.004045 0.000004 0.004049 0.003905 0.004237 0.000004 0.004089 0.038176 0.008989 0.004193 0.009114 0.011393 0.015680 0.028895 0.016454 0.008209 0.016634 0.012136 2.601378 0.968877 0.012984 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.19021
(1: 0.004045, 2: 0.000004, 3: 0.004049, ((4: 0.000004, 5: 0.004089): 0.004237, (((6: 0.009114, 8: 0.011393): 0.004193, 7: 0.015680): 0.008989, 9: 0.028895, 10: 0.016454, (11: 0.016634, 12: 0.012136): 0.008209): 0.038176): 0.003905);
(D_melanogaster_14-3-3zeta-PK: 0.004045, D_sechellia_14-3-3zeta-PK: 0.000004, D_simulans_14-3-3zeta-PK: 0.004049, ((D_yakuba_14-3-3zeta-PK: 0.000004, D_erecta_14-3-3zeta-PK: 0.004089): 0.004237, (((D_takahashii_14-3-3zeta-PK: 0.009114, D_suzukii_14-3-3zeta-PK: 0.011393): 0.004193, D_biarmipes_14-3-3zeta-PK: 0.015680): 0.008989, D_eugracilis_14-3-3zeta-PK: 0.028895, D_ficusphila_14-3-3zeta-PK: 0.016454, (D_rhopaloa_14-3-3zeta-PK: 0.016634, D_elegans_14-3-3zeta-PK: 0.012136): 0.008209): 0.038176): 0.003905);
Detailed output identifying parameters
kappa (ts/tv) = 2.60138
dN/dS (w) for site classes (K=3)
p: 0.96888 0.01298 0.01814
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 558.6 185.4 0.0311 0.0002 0.0049 0.1 0.9
13..2 0.000 558.6 185.4 0.0311 0.0000 0.0000 0.0 0.0
13..3 0.004 558.6 185.4 0.0311 0.0002 0.0050 0.1 0.9
13..14 0.004 558.6 185.4 0.0311 0.0001 0.0048 0.1 0.9
14..15 0.004 558.6 185.4 0.0311 0.0002 0.0052 0.1 1.0
15..4 0.000 558.6 185.4 0.0311 0.0000 0.0000 0.0 0.0
15..5 0.004 558.6 185.4 0.0311 0.0002 0.0050 0.1 0.9
14..16 0.038 558.6 185.4 0.0311 0.0015 0.0467 0.8 8.7
16..17 0.009 558.6 185.4 0.0311 0.0003 0.0110 0.2 2.0
17..18 0.004 558.6 185.4 0.0311 0.0002 0.0051 0.1 1.0
18..6 0.009 558.6 185.4 0.0311 0.0003 0.0111 0.2 2.1
18..8 0.011 558.6 185.4 0.0311 0.0004 0.0139 0.2 2.6
17..7 0.016 558.6 185.4 0.0311 0.0006 0.0192 0.3 3.6
16..9 0.029 558.6 185.4 0.0311 0.0011 0.0353 0.6 6.6
16..10 0.016 558.6 185.4 0.0311 0.0006 0.0201 0.3 3.7
16..19 0.008 558.6 185.4 0.0311 0.0003 0.0100 0.2 1.9
19..11 0.017 558.6 185.4 0.0311 0.0006 0.0203 0.4 3.8
19..12 0.012 558.6 185.4 0.0311 0.0005 0.0148 0.3 2.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PK)
Pr(w>1) post mean +- SE for w
239 E 0.529 1.464 +- 1.175
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.669 0.181 0.068 0.032 0.018 0.011 0.008 0.006 0.005 0.004
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.998
sum of density on p0-p1 = 1.000000
Time used: 1:03
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
check convergence..
lnL(ntime: 18 np: 24): -1263.063085 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..8 17..7 16..9 16..10 16..19 19..11 19..12
0.004044 0.000004 0.004048 0.003903 0.004236 0.000004 0.004087 0.038171 0.008991 0.004195 0.009117 0.011397 0.015684 0.028902 0.016459 0.008209 0.016635 0.012143 2.595567 0.833725 0.132911 0.000001 0.000001 0.909129
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.19023
(1: 0.004044, 2: 0.000004, 3: 0.004048, ((4: 0.000004, 5: 0.004087): 0.004236, (((6: 0.009117, 8: 0.011397): 0.004195, 7: 0.015684): 0.008991, 9: 0.028902, 10: 0.016459, (11: 0.016635, 12: 0.012143): 0.008209): 0.038171): 0.003903);
(D_melanogaster_14-3-3zeta-PK: 0.004044, D_sechellia_14-3-3zeta-PK: 0.000004, D_simulans_14-3-3zeta-PK: 0.004048, ((D_yakuba_14-3-3zeta-PK: 0.000004, D_erecta_14-3-3zeta-PK: 0.004087): 0.004236, (((D_takahashii_14-3-3zeta-PK: 0.009117, D_suzukii_14-3-3zeta-PK: 0.011397): 0.004195, D_biarmipes_14-3-3zeta-PK: 0.015684): 0.008991, D_eugracilis_14-3-3zeta-PK: 0.028902, D_ficusphila_14-3-3zeta-PK: 0.016459, (D_rhopaloa_14-3-3zeta-PK: 0.016635, D_elegans_14-3-3zeta-PK: 0.012143): 0.008209): 0.038171): 0.003903);
Detailed output identifying parameters
kappa (ts/tv) = 2.59557
dN/dS (w) for site classes (K=3)
p: 0.83372 0.13291 0.03336
w: 0.00000 0.00000 0.90913
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 558.7 185.3 0.0303 0.0002 0.0050 0.1 0.9
13..2 0.000 558.7 185.3 0.0303 0.0000 0.0000 0.0 0.0
13..3 0.004 558.7 185.3 0.0303 0.0002 0.0050 0.1 0.9
13..14 0.004 558.7 185.3 0.0303 0.0001 0.0048 0.1 0.9
14..15 0.004 558.7 185.3 0.0303 0.0002 0.0052 0.1 1.0
15..4 0.000 558.7 185.3 0.0303 0.0000 0.0000 0.0 0.0
15..5 0.004 558.7 185.3 0.0303 0.0002 0.0050 0.1 0.9
14..16 0.038 558.7 185.3 0.0303 0.0014 0.0468 0.8 8.7
16..17 0.009 558.7 185.3 0.0303 0.0003 0.0110 0.2 2.0
17..18 0.004 558.7 185.3 0.0303 0.0002 0.0051 0.1 1.0
18..6 0.009 558.7 185.3 0.0303 0.0003 0.0112 0.2 2.1
18..8 0.011 558.7 185.3 0.0303 0.0004 0.0140 0.2 2.6
17..7 0.016 558.7 185.3 0.0303 0.0006 0.0192 0.3 3.6
16..9 0.029 558.7 185.3 0.0303 0.0011 0.0354 0.6 6.6
16..10 0.016 558.7 185.3 0.0303 0.0006 0.0202 0.3 3.7
16..19 0.008 558.7 185.3 0.0303 0.0003 0.0101 0.2 1.9
19..11 0.017 558.7 185.3 0.0303 0.0006 0.0204 0.3 3.8
19..12 0.012 558.7 185.3 0.0303 0.0005 0.0149 0.3 2.8
Naive Empirical Bayes (NEB) analysis
Time used: 1:48
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
lnL(ntime: 18 np: 21): -1263.392400 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..8 17..7 16..9 16..10 16..19 19..11 19..12
0.004037 0.000004 0.004040 0.003895 0.004227 0.000004 0.004071 0.038159 0.009016 0.004208 0.009143 0.011427 0.015725 0.028970 0.016502 0.008209 0.016658 0.012202 2.597108 0.011499 0.255704
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.19050
(1: 0.004037, 2: 0.000004, 3: 0.004040, ((4: 0.000004, 5: 0.004071): 0.004227, (((6: 0.009143, 8: 0.011427): 0.004208, 7: 0.015725): 0.009016, 9: 0.028970, 10: 0.016502, (11: 0.016658, 12: 0.012202): 0.008209): 0.038159): 0.003895);
(D_melanogaster_14-3-3zeta-PK: 0.004037, D_sechellia_14-3-3zeta-PK: 0.000004, D_simulans_14-3-3zeta-PK: 0.004040, ((D_yakuba_14-3-3zeta-PK: 0.000004, D_erecta_14-3-3zeta-PK: 0.004071): 0.004227, (((D_takahashii_14-3-3zeta-PK: 0.009143, D_suzukii_14-3-3zeta-PK: 0.011427): 0.004208, D_biarmipes_14-3-3zeta-PK: 0.015725): 0.009016, D_eugracilis_14-3-3zeta-PK: 0.028970, D_ficusphila_14-3-3zeta-PK: 0.016502, (D_rhopaloa_14-3-3zeta-PK: 0.016658, D_elegans_14-3-3zeta-PK: 0.012202): 0.008209): 0.038159): 0.003895);
Detailed output identifying parameters
kappa (ts/tv) = 2.59711
Parameters in M7 (beta):
p = 0.01150 q = 0.25570
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 0.29051
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 558.7 185.3 0.0291 0.0001 0.0050 0.1 0.9
13..2 0.000 558.7 185.3 0.0291 0.0000 0.0000 0.0 0.0
13..3 0.004 558.7 185.3 0.0291 0.0001 0.0050 0.1 0.9
13..14 0.004 558.7 185.3 0.0291 0.0001 0.0048 0.1 0.9
14..15 0.004 558.7 185.3 0.0291 0.0002 0.0052 0.1 1.0
15..4 0.000 558.7 185.3 0.0291 0.0000 0.0000 0.0 0.0
15..5 0.004 558.7 185.3 0.0291 0.0001 0.0050 0.1 0.9
14..16 0.038 558.7 185.3 0.0291 0.0014 0.0470 0.8 8.7
16..17 0.009 558.7 185.3 0.0291 0.0003 0.0111 0.2 2.1
17..18 0.004 558.7 185.3 0.0291 0.0002 0.0052 0.1 1.0
18..6 0.009 558.7 185.3 0.0291 0.0003 0.0113 0.2 2.1
18..8 0.011 558.7 185.3 0.0291 0.0004 0.0141 0.2 2.6
17..7 0.016 558.7 185.3 0.0291 0.0006 0.0194 0.3 3.6
16..9 0.029 558.7 185.3 0.0291 0.0010 0.0356 0.6 6.6
16..10 0.017 558.7 185.3 0.0291 0.0006 0.0203 0.3 3.8
16..19 0.008 558.7 185.3 0.0291 0.0003 0.0101 0.2 1.9
19..11 0.017 558.7 185.3 0.0291 0.0006 0.0205 0.3 3.8
19..12 0.012 558.7 185.3 0.0291 0.0004 0.0150 0.2 2.8
Time used: 4:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 8), 7), 9, 10, (11, 12)))); MP score: 45
lnL(ntime: 18 np: 23): -1263.066768 +0.000000
13..1 13..2 13..3 13..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..8 17..7 16..9 16..10 16..19 19..11 19..12
0.004045 0.000004 0.004049 0.003905 0.004237 0.000004 0.004089 0.038176 0.008989 0.004193 0.009114 0.011393 0.015680 0.028895 0.016454 0.008209 0.016634 0.012136 2.601381 0.968877 0.005000 3.339977 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.19021
(1: 0.004045, 2: 0.000004, 3: 0.004049, ((4: 0.000004, 5: 0.004089): 0.004237, (((6: 0.009114, 8: 0.011393): 0.004193, 7: 0.015680): 0.008989, 9: 0.028895, 10: 0.016454, (11: 0.016634, 12: 0.012136): 0.008209): 0.038176): 0.003905);
(D_melanogaster_14-3-3zeta-PK: 0.004045, D_sechellia_14-3-3zeta-PK: 0.000004, D_simulans_14-3-3zeta-PK: 0.004049, ((D_yakuba_14-3-3zeta-PK: 0.000004, D_erecta_14-3-3zeta-PK: 0.004089): 0.004237, (((D_takahashii_14-3-3zeta-PK: 0.009114, D_suzukii_14-3-3zeta-PK: 0.011393): 0.004193, D_biarmipes_14-3-3zeta-PK: 0.015680): 0.008989, D_eugracilis_14-3-3zeta-PK: 0.028895, D_ficusphila_14-3-3zeta-PK: 0.016454, (D_rhopaloa_14-3-3zeta-PK: 0.016634, D_elegans_14-3-3zeta-PK: 0.012136): 0.008209): 0.038176): 0.003905);
Detailed output identifying parameters
kappa (ts/tv) = 2.60138
Parameters in M8 (beta&w>1):
p0 = 0.96888 p = 0.00500 q = 3.33998
(p1 = 0.03112) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09689 0.09689 0.09689 0.09689 0.09689 0.09689 0.09689 0.09689 0.09689 0.09689 0.03112
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 558.6 185.4 0.0311 0.0002 0.0049 0.1 0.9
13..2 0.000 558.6 185.4 0.0311 0.0000 0.0000 0.0 0.0
13..3 0.004 558.6 185.4 0.0311 0.0002 0.0050 0.1 0.9
13..14 0.004 558.6 185.4 0.0311 0.0001 0.0048 0.1 0.9
14..15 0.004 558.6 185.4 0.0311 0.0002 0.0052 0.1 1.0
15..4 0.000 558.6 185.4 0.0311 0.0000 0.0000 0.0 0.0
15..5 0.004 558.6 185.4 0.0311 0.0002 0.0050 0.1 0.9
14..16 0.038 558.6 185.4 0.0311 0.0015 0.0467 0.8 8.7
16..17 0.009 558.6 185.4 0.0311 0.0003 0.0110 0.2 2.0
17..18 0.004 558.6 185.4 0.0311 0.0002 0.0051 0.1 1.0
18..6 0.009 558.6 185.4 0.0311 0.0003 0.0111 0.2 2.1
18..8 0.011 558.6 185.4 0.0311 0.0004 0.0139 0.2 2.6
17..7 0.016 558.6 185.4 0.0311 0.0006 0.0192 0.3 3.6
16..9 0.029 558.6 185.4 0.0311 0.0011 0.0353 0.6 6.6
16..10 0.016 558.6 185.4 0.0311 0.0006 0.0201 0.3 3.7
16..19 0.008 558.6 185.4 0.0311 0.0003 0.0100 0.2 1.9
19..11 0.017 558.6 185.4 0.0311 0.0006 0.0203 0.4 3.8
19..12 0.012 558.6 185.4 0.0311 0.0005 0.0148 0.3 2.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PK)
Pr(w>1) post mean +- SE for w
239 E 0.629 1.231 +- 0.858
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.001 0.008 0.030 0.079 0.162 0.282 0.438
ws: 0.849 0.109 0.025 0.008 0.004 0.002 0.001 0.001 0.001 0.000
Time used: 6:38