--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 14:24:12 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/14-3-3zeta-PG/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1544.40 -1562.83
2 -1544.56 -1563.72
--------------------------------------
TOTAL -1544.48 -1563.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.247920 0.001647 0.176359 0.333366 0.244050 1307.41 1310.60 1.000
r(A<->C){all} 0.111095 0.001122 0.050567 0.178397 0.108058 747.82 835.04 1.000
r(A<->G){all} 0.152878 0.001703 0.077245 0.231470 0.148975 860.48 1021.09 1.000
r(A<->T){all} 0.067466 0.001098 0.012128 0.133970 0.062763 572.59 693.46 1.000
r(C<->G){all} 0.061421 0.000641 0.016602 0.111196 0.058105 899.13 1064.58 1.000
r(C<->T){all} 0.558366 0.004760 0.430141 0.696077 0.558382 677.21 764.72 1.000
r(G<->T){all} 0.048773 0.000730 0.003535 0.099599 0.044829 649.11 806.42 1.001
pi(A){all} 0.285953 0.000252 0.253916 0.314870 0.285640 1172.42 1266.40 1.003
pi(C){all} 0.261314 0.000221 0.232901 0.290045 0.260857 1057.87 1220.34 1.000
pi(G){all} 0.258237 0.000240 0.228554 0.287916 0.258559 1103.28 1177.05 1.001
pi(T){all} 0.194496 0.000198 0.166689 0.220516 0.194117 1180.49 1220.57 1.000
alpha{1,2} 0.056370 0.001757 0.000143 0.134510 0.048662 1226.83 1234.60 1.000
alpha{3} 2.077090 0.654349 0.694719 3.637498 1.954483 1378.89 1439.94 1.000
pinvar{all} 0.475676 0.008692 0.280469 0.634387 0.488729 1139.60 1235.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1451.36118
Model 2: PositiveSelection -1451.36118
Model 0: one-ratio -1458.92382
Model 3: discrete -1451.332921
Model 7: beta -1451.333746
Model 8: beta&w>1 -1451.361179
Model 0 vs 1 15.125279999999748
Model 2 vs 1 0.0
Model 8 vs 7 0.054865999999947235
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=248
C1 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C2 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C3 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C4 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C5 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C6 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C7 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C8 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C9 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C10 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C11 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
C12 MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
**************************************************
C1 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C2 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C3 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C4 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C5 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C6 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C7 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C8 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C9 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C10 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C11 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
C12 YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
**************************************************
C1 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN
C2 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKN
C3 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
C4 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C5 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C6 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C7 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C8 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C9 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C10 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C11 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
C12 LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
*********************************************:**:.
C1 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C2 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C3 AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
C4 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C5 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C6 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C7 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C8 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C9 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C10 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C11 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
C12 AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
***:****:* ***********************:*** :**:*******
C1 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C2 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C3 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C4 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C5 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
C6 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C7 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C8 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C9 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C10 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C11 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
C12 DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
**********************************:*** ********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 248 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [32736]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [32736]--->[32736]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.665 Mb, Max= 31.567 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
FORMAT of file /tmp/tmp1281277342013288242aln Not Supported[FATAL:T-COFFEE]
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:248 S:100 BS:248
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES
BOT 0 1 99.60 C1 C2 99.60
TOP 1 0 99.60 C2 C1 99.60
BOT 0 2 97.98 C1 C3 97.98
TOP 2 0 97.98 C3 C1 97.98
BOT 0 3 97.58 C1 C4 97.58
TOP 3 0 97.58 C4 C1 97.58
BOT 0 4 97.58 C1 C5 97.58
TOP 4 0 97.58 C5 C1 97.58
BOT 0 5 96.77 C1 C6 96.77
TOP 5 0 96.77 C6 C1 96.77
BOT 0 6 96.77 C1 C7 96.77
TOP 6 0 96.77 C7 C1 96.77
BOT 0 7 96.77 C1 C8 96.77
TOP 7 0 96.77 C8 C1 96.77
BOT 0 8 96.77 C1 C9 96.77
TOP 8 0 96.77 C9 C1 96.77
BOT 0 9 96.77 C1 C10 96.77
TOP 9 0 96.77 C10 C1 96.77
BOT 0 10 96.77 C1 C11 96.77
TOP 10 0 96.77 C11 C1 96.77
BOT 0 11 96.37 C1 C12 96.37
TOP 11 0 96.37 C12 C1 96.37
BOT 1 2 97.58 C2 C3 97.58
TOP 2 1 97.58 C3 C2 97.58
BOT 1 3 97.98 C2 C4 97.98
TOP 3 1 97.98 C4 C2 97.98
BOT 1 4 97.98 C2 C5 97.98
TOP 4 1 97.98 C5 C2 97.98
BOT 1 5 97.18 C2 C6 97.18
TOP 5 1 97.18 C6 C2 97.18
BOT 1 6 97.18 C2 C7 97.18
TOP 6 1 97.18 C7 C2 97.18
BOT 1 7 97.18 C2 C8 97.18
TOP 7 1 97.18 C8 C2 97.18
BOT 1 8 97.18 C2 C9 97.18
TOP 8 1 97.18 C9 C2 97.18
BOT 1 9 97.18 C2 C10 97.18
TOP 9 1 97.18 C10 C2 97.18
BOT 1 10 97.18 C2 C11 97.18
TOP 10 1 97.18 C11 C2 97.18
BOT 1 11 96.77 C2 C12 96.77
TOP 11 1 96.77 C12 C2 96.77
BOT 2 3 95.97 C3 C4 95.97
TOP 3 2 95.97 C4 C3 95.97
BOT 2 4 95.97 C3 C5 95.97
TOP 4 2 95.97 C5 C3 95.97
BOT 2 5 95.16 C3 C6 95.16
TOP 5 2 95.16 C6 C3 95.16
BOT 2 6 95.16 C3 C7 95.16
TOP 6 2 95.16 C7 C3 95.16
BOT 2 7 95.16 C3 C8 95.16
TOP 7 2 95.16 C8 C3 95.16
BOT 2 8 95.16 C3 C9 95.16
TOP 8 2 95.16 C9 C3 95.16
BOT 2 9 95.16 C3 C10 95.16
TOP 9 2 95.16 C10 C3 95.16
BOT 2 10 95.16 C3 C11 95.16
TOP 10 2 95.16 C11 C3 95.16
BOT 2 11 94.76 C3 C12 94.76
TOP 11 2 94.76 C12 C3 94.76
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.19 C4 C6 99.19
TOP 5 3 99.19 C6 C4 99.19
BOT 3 6 99.19 C4 C7 99.19
TOP 6 3 99.19 C7 C4 99.19
BOT 3 7 99.19 C4 C8 99.19
TOP 7 3 99.19 C8 C4 99.19
BOT 3 8 99.19 C4 C9 99.19
TOP 8 3 99.19 C9 C4 99.19
BOT 3 9 99.19 C4 C10 99.19
TOP 9 3 99.19 C10 C4 99.19
BOT 3 10 99.19 C4 C11 99.19
TOP 10 3 99.19 C11 C4 99.19
BOT 3 11 98.79 C4 C12 98.79
TOP 11 3 98.79 C12 C4 98.79
BOT 4 5 99.19 C5 C6 99.19
TOP 5 4 99.19 C6 C5 99.19
BOT 4 6 99.19 C5 C7 99.19
TOP 6 4 99.19 C7 C5 99.19
BOT 4 7 99.19 C5 C8 99.19
TOP 7 4 99.19 C8 C5 99.19
BOT 4 8 99.19 C5 C9 99.19
TOP 8 4 99.19 C9 C5 99.19
BOT 4 9 99.19 C5 C10 99.19
TOP 9 4 99.19 C10 C5 99.19
BOT 4 10 99.19 C5 C11 99.19
TOP 10 4 99.19 C11 C5 99.19
BOT 4 11 98.79 C5 C12 98.79
TOP 11 4 98.79 C12 C5 98.79
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 5 11 99.60 C6 C12 99.60
TOP 11 5 99.60 C12 C6 99.60
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 6 11 99.60 C7 C12 99.60
TOP 11 6 99.60 C12 C7 99.60
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 7 11 99.60 C8 C12 99.60
TOP 11 7 99.60 C12 C8 99.60
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 8 11 99.60 C9 C12 99.60
TOP 11 8 99.60 C12 C9 99.60
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
BOT 9 11 99.60 C10 C12 99.60
TOP 11 9 99.60 C12 C10 99.60
BOT 10 11 99.60 C11 C12 99.60
TOP 11 10 99.60 C12 C11 99.60
AVG 0 C1 * 97.25
AVG 1 C2 * 97.54
AVG 2 C3 * 95.75
AVG 3 C4 * 98.68
AVG 4 C5 * 98.68
AVG 5 C6 * 98.83
AVG 6 C7 * 98.83
AVG 7 C8 * 98.83
AVG 8 C9 * 98.83
AVG 9 C10 * 98.83
AVG 10 C11 * 98.83
AVG 11 C12 * 98.46
TOT TOT * 98.28
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C2 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C3 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C4 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C5 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C6 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C7 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C8 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C9 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
C10 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C11 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
C12 ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
****************************************** *******
C1 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C2 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C3 GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
C4 GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
C5 GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
C6 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C7 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C8 GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C9 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C10 GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C11 GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
C12 GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
***.**.***** ******** *****************.**********
C1 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C2 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C3 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C4 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C5 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C6 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C7 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C8 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C9 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
C10 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C11 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
C12 AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
********************************** **.************
C1 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C2 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C3 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C4 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C5 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C6 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C7 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C8 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C9 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C10 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C11 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
C12 TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
**************************************************
C1 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C2 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C3 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C4 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C5 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C6 CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C7 CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C8 CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C9 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C10 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C11 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
C12 CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
*** **************.*******************************
C1 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C2 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C3 AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C4 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C5 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C6 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C7 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C8 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C9 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C10 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C11 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
C12 AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
************* ************************************
C1 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C2 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C3 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C4 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C5 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C6 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C7 CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C8 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C9 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C10 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C11 TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
C12 TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
**********.**************************************
C1 CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C2 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C3 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C4 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C5 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C6 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C7 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C8 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C9 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
C10 CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
C11 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
C12 CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
****** ** *********************** ***********.****
C1 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGATGACTCGAAAAAT
C2 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAT
C3 AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
C4 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C5 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C6 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C7 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C8 AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C9 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C10 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C11 AGGTTGCCACCGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
C12 AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
**********.***** ************** ** ** ******.***.
C1 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCAACACA
C2 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C3 GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
C4 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C5 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C6 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C7 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C8 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C9 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C10 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C11 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
C12 GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
** ** ***** **.** ** ***. .**.. ***********.*****
C1 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C2 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C3 TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
C4 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C5 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C6 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C7 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C8 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C9 TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
C10 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C11 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
C12 TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
***.***.*:**.***** ** ** ***** **.******** ** **.*
C1 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C2 TCTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C3 TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
C4 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C5 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C6 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C7 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C8 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C9 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C10 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C11 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
C12 TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
* :* ** *******. *..***** **.**.******************
C1 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C2 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C3 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C4 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C5 GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
C6 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C7 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C8 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C9 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C10 GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C11 GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
C12 GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
** ***********.*********** ***********************
C1 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C2 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C3 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C4 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C5 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
C6 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
C7 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C8 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C9 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
C10 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
C11 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
C12 GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
************************************ ** ******** *
C1 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C2 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C3 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C4 ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C5 ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
C6 ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
C7 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C8 ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
C9 ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
C10 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C11 ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
C12 ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
**.* ******** *..*.******:******************
>C1
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGATGACTCGAAAAAT
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C2
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAT
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TCTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C3
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC
GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA
TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA
TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C4
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C5
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG
ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC
>C6
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>C7
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C8
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC
>C9
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG
ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C10
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C11
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG
AGGTTGCCACCGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C12
ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA
GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG
AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC
TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC
CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG
AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT
TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG
CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG
AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA
GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA
TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA
TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT
GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC
GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG
ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>C1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C2
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C3
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C4
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C5
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
>C6
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C7
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C8
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C9
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C10
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C11
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
>C12
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 12 taxa and 744 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Taxon 12 -> C12
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480082987
Setting output file names to "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1882304968
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6322150943
Seed = 67904314
Swapseed = 1480082987
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 12 unique site patterns
Division 2 has 10 unique site patterns
Division 3 has 48 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3008.679819 -- -24.979900
Chain 2 -- -3024.957820 -- -24.979900
Chain 3 -- -2866.153195 -- -24.979900
Chain 4 -- -2980.187821 -- -24.979900
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2999.041714 -- -24.979900
Chain 2 -- -2988.138654 -- -24.979900
Chain 3 -- -2889.544368 -- -24.979900
Chain 4 -- -3011.791620 -- -24.979900
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3008.680] (-3024.958) (-2866.153) (-2980.188) * [-2999.042] (-2988.139) (-2889.544) (-3011.792)
500 -- [-1599.938] (-1592.382) (-1581.114) (-1590.169) * (-1596.314) (-1601.638) (-1581.064) [-1585.721] -- 0:00:00
1000 -- (-1583.502) [-1580.254] (-1564.744) (-1577.590) * (-1578.257) (-1583.580) (-1576.916) [-1564.212] -- 0:00:00
1500 -- (-1573.614) [-1564.090] (-1575.363) (-1584.899) * (-1576.369) [-1571.495] (-1566.317) (-1554.593) -- 0:11:05
2000 -- (-1570.713) (-1575.327) [-1554.781] (-1576.210) * [-1564.570] (-1567.814) (-1567.758) (-1567.706) -- 0:08:19
2500 -- (-1571.748) (-1563.203) [-1558.282] (-1570.053) * (-1565.201) (-1566.407) [-1561.369] (-1563.747) -- 0:06:39
3000 -- [-1556.665] (-1555.747) (-1558.217) (-1571.686) * (-1574.639) (-1565.984) (-1558.509) [-1549.584] -- 0:05:32
3500 -- (-1563.739) [-1553.182] (-1554.796) (-1565.775) * (-1566.693) (-1563.602) (-1564.153) [-1549.612] -- 0:04:44
4000 -- (-1545.551) (-1552.935) (-1558.291) [-1563.991] * (-1561.140) (-1556.517) (-1560.472) [-1545.810] -- 0:08:18
4500 -- (-1558.837) (-1562.110) [-1546.037] (-1564.344) * (-1561.201) [-1551.214] (-1565.365) (-1559.133) -- 0:07:22
5000 -- (-1558.323) (-1556.545) [-1550.775] (-1561.524) * (-1570.496) (-1554.716) (-1553.171) [-1547.313] -- 0:06:38
Average standard deviation of split frequencies: 0.123463
5500 -- (-1544.868) [-1555.720] (-1547.442) (-1565.339) * (-1552.064) (-1553.304) (-1554.760) [-1550.029] -- 0:06:01
6000 -- (-1556.833) [-1554.637] (-1557.312) (-1556.794) * (-1574.032) [-1549.938] (-1556.542) (-1550.283) -- 0:05:31
6500 -- [-1554.937] (-1559.090) (-1546.477) (-1553.670) * (-1573.669) (-1551.097) (-1548.526) [-1549.490] -- 0:05:05
7000 -- (-1550.396) (-1558.573) [-1542.764] (-1547.346) * (-1565.020) (-1561.549) [-1546.973] (-1565.376) -- 0:04:43
7500 -- [-1552.694] (-1557.480) (-1542.032) (-1561.437) * (-1548.623) [-1553.172] (-1544.877) (-1554.651) -- 0:06:37
8000 -- (-1556.052) (-1556.790) (-1547.113) [-1549.855] * (-1556.170) (-1554.295) (-1549.716) [-1554.430] -- 0:06:12
8500 -- (-1564.699) [-1558.338] (-1562.962) (-1557.120) * (-1556.622) [-1551.076] (-1551.412) (-1549.215) -- 0:05:49
9000 -- (-1564.074) [-1545.563] (-1550.793) (-1553.663) * (-1547.858) (-1552.502) [-1554.742] (-1544.716) -- 0:05:30
9500 -- (-1564.717) [-1551.897] (-1551.687) (-1553.435) * (-1551.075) [-1551.710] (-1553.676) (-1547.467) -- 0:05:12
10000 -- [-1547.974] (-1562.336) (-1550.106) (-1550.872) * [-1553.993] (-1558.525) (-1554.298) (-1560.235) -- 0:04:57
Average standard deviation of split frequencies: 0.063135
10500 -- (-1555.046) (-1554.625) [-1552.514] (-1549.188) * (-1564.880) [-1552.401] (-1548.922) (-1552.186) -- 0:06:16
11000 -- [-1563.429] (-1574.627) (-1551.370) (-1556.117) * (-1569.168) (-1569.795) (-1543.862) [-1554.517] -- 0:05:59
11500 -- (-1554.015) (-1552.485) (-1550.674) [-1547.350] * (-1551.121) (-1554.787) (-1550.199) [-1546.641] -- 0:05:43
12000 -- (-1560.044) (-1562.149) [-1549.482] (-1554.524) * [-1543.860] (-1549.321) (-1560.992) (-1554.584) -- 0:05:29
12500 -- [-1557.928] (-1547.888) (-1561.595) (-1560.349) * (-1566.808) (-1552.779) (-1555.687) [-1556.268] -- 0:05:16
13000 -- (-1553.798) (-1555.306) (-1553.138) [-1552.629] * (-1553.569) [-1547.621] (-1555.634) (-1553.408) -- 0:05:03
13500 -- (-1550.083) (-1552.670) (-1551.195) [-1539.177] * (-1573.976) [-1544.753] (-1567.960) (-1564.752) -- 0:04:52
14000 -- (-1561.816) [-1548.269] (-1551.899) (-1578.071) * (-1549.337) [-1549.111] (-1564.343) (-1555.180) -- 0:05:52
14500 -- (-1566.129) [-1547.245] (-1541.050) (-1555.510) * (-1553.725) (-1550.772) (-1554.228) [-1548.095] -- 0:05:39
15000 -- [-1562.607] (-1552.406) (-1560.643) (-1547.562) * (-1557.731) [-1542.853] (-1562.436) (-1552.706) -- 0:05:28
Average standard deviation of split frequencies: 0.035776
15500 -- (-1553.321) (-1553.625) [-1547.981] (-1552.548) * (-1559.450) (-1554.932) (-1577.843) [-1545.257] -- 0:05:17
16000 -- [-1543.070] (-1556.024) (-1552.327) (-1558.200) * (-1554.183) [-1551.639] (-1552.284) (-1545.821) -- 0:05:07
16500 -- (-1561.497) (-1546.092) (-1554.035) [-1553.279] * (-1557.568) (-1547.333) (-1563.072) [-1550.417] -- 0:04:58
17000 -- [-1550.240] (-1556.872) (-1545.545) (-1575.695) * [-1550.317] (-1565.135) (-1559.903) (-1548.016) -- 0:05:46
17500 -- [-1549.146] (-1548.847) (-1561.229) (-1557.554) * (-1554.045) [-1550.692] (-1555.287) (-1555.442) -- 0:05:36
18000 -- (-1547.299) (-1551.570) [-1555.766] (-1555.950) * [-1552.946] (-1557.261) (-1552.982) (-1556.469) -- 0:05:27
18500 -- [-1550.534] (-1555.889) (-1555.109) (-1570.484) * (-1554.359) (-1561.917) (-1557.451) [-1545.719] -- 0:05:18
19000 -- (-1546.474) [-1547.692] (-1550.293) (-1558.992) * (-1551.319) (-1561.356) (-1556.940) [-1551.829] -- 0:05:09
19500 -- (-1553.192) [-1555.092] (-1540.034) (-1553.768) * [-1556.985] (-1566.497) (-1552.630) (-1551.589) -- 0:05:01
20000 -- (-1550.791) (-1553.254) [-1544.488] (-1553.598) * (-1561.916) [-1556.038] (-1560.176) (-1546.677) -- 0:04:54
Average standard deviation of split frequencies: 0.027698
20500 -- (-1562.685) (-1548.951) (-1551.947) [-1553.912] * (-1553.477) (-1561.155) [-1546.514] (-1561.527) -- 0:05:34
21000 -- (-1555.328) [-1552.548] (-1549.486) (-1553.516) * [-1552.679] (-1552.834) (-1556.624) (-1564.000) -- 0:05:26
21500 -- (-1548.203) [-1552.033] (-1558.395) (-1557.555) * (-1553.648) (-1561.868) [-1543.109] (-1563.325) -- 0:05:18
22000 -- (-1552.818) (-1552.417) [-1553.734] (-1547.637) * (-1554.180) (-1566.566) [-1550.359] (-1553.421) -- 0:05:11
22500 -- [-1556.053] (-1551.999) (-1555.632) (-1569.600) * (-1556.042) (-1557.663) [-1547.764] (-1561.368) -- 0:05:04
23000 -- (-1551.163) (-1548.798) (-1558.546) [-1557.159] * (-1554.810) (-1552.963) (-1560.365) [-1555.902] -- 0:04:57
23500 -- [-1548.093] (-1542.805) (-1553.854) (-1565.425) * (-1549.965) [-1548.929] (-1555.355) (-1557.517) -- 0:05:32
24000 -- (-1552.404) (-1556.064) [-1548.458] (-1559.454) * (-1550.330) [-1558.203] (-1546.486) (-1559.496) -- 0:05:25
24500 -- [-1548.519] (-1548.120) (-1550.878) (-1573.871) * (-1565.065) (-1554.583) [-1544.474] (-1560.391) -- 0:05:18
25000 -- (-1551.326) (-1551.739) [-1557.730] (-1563.227) * (-1556.815) (-1559.596) [-1556.090] (-1552.973) -- 0:05:12
Average standard deviation of split frequencies: 0.034967
25500 -- (-1567.027) (-1549.982) [-1543.865] (-1552.632) * (-1545.404) (-1568.309) [-1549.927] (-1550.107) -- 0:05:05
26000 -- (-1549.254) (-1556.389) [-1544.515] (-1547.186) * (-1549.010) (-1559.951) (-1567.376) [-1556.501] -- 0:04:59
26500 -- (-1553.212) (-1550.965) (-1550.311) [-1563.043] * (-1553.106) (-1569.810) [-1546.599] (-1547.097) -- 0:04:53
27000 -- [-1547.724] (-1551.426) (-1554.653) (-1558.412) * (-1570.851) [-1555.976] (-1552.494) (-1561.688) -- 0:05:24
27500 -- (-1555.749) [-1546.137] (-1556.630) (-1560.537) * (-1563.447) (-1562.184) [-1561.426] (-1554.210) -- 0:05:18
28000 -- (-1541.522) (-1546.001) (-1553.333) [-1558.220] * (-1569.327) (-1566.714) (-1548.812) [-1546.074] -- 0:05:12
28500 -- (-1542.952) (-1556.413) [-1556.309] (-1575.049) * [-1556.468] (-1559.429) (-1552.510) (-1549.046) -- 0:05:06
29000 -- (-1550.591) (-1550.930) [-1549.919] (-1560.761) * (-1548.772) (-1553.821) (-1554.424) [-1550.048] -- 0:05:01
29500 -- [-1551.254] (-1563.363) (-1551.621) (-1572.812) * (-1569.638) (-1555.349) [-1555.732] (-1544.370) -- 0:04:56
30000 -- (-1561.919) (-1553.180) [-1543.196] (-1556.128) * [-1552.963] (-1557.482) (-1552.514) (-1552.371) -- 0:05:23
Average standard deviation of split frequencies: 0.031842
30500 -- (-1562.125) [-1547.063] (-1546.640) (-1548.904) * (-1556.969) (-1549.854) (-1561.394) [-1547.420] -- 0:05:17
31000 -- (-1558.693) (-1551.234) (-1560.060) [-1545.516] * (-1554.606) [-1551.937] (-1547.793) (-1547.149) -- 0:05:12
31500 -- (-1555.792) (-1554.280) (-1555.949) [-1544.531] * (-1549.711) (-1549.883) (-1549.154) [-1549.048] -- 0:05:07
32000 -- (-1558.347) (-1553.640) [-1556.932] (-1558.983) * (-1558.850) [-1550.953] (-1560.587) (-1553.896) -- 0:05:02
32500 -- (-1560.434) (-1555.239) (-1560.263) [-1552.944] * (-1552.543) (-1546.608) (-1564.128) [-1550.614] -- 0:04:57
33000 -- (-1550.383) (-1564.462) [-1556.543] (-1553.289) * [-1548.020] (-1551.980) (-1552.965) (-1550.595) -- 0:04:53
33500 -- (-1550.294) (-1556.737) [-1548.708] (-1553.463) * (-1570.417) (-1553.801) (-1549.678) [-1547.639] -- 0:05:17
34000 -- [-1555.233] (-1549.656) (-1554.356) (-1560.835) * (-1556.474) [-1548.593] (-1561.144) (-1573.831) -- 0:05:12
34500 -- (-1552.269) (-1550.723) (-1562.343) [-1556.813] * (-1557.814) (-1548.812) [-1552.154] (-1559.201) -- 0:05:07
35000 -- (-1552.288) [-1548.972] (-1544.784) (-1560.729) * (-1555.304) [-1556.331] (-1549.259) (-1556.830) -- 0:05:03
Average standard deviation of split frequencies: 0.023383
35500 -- [-1548.207] (-1558.247) (-1555.228) (-1564.022) * (-1562.772) (-1551.246) (-1555.540) [-1548.589] -- 0:04:58
36000 -- (-1551.805) (-1546.832) (-1562.003) [-1558.409] * (-1566.839) [-1556.760] (-1557.495) (-1554.310) -- 0:04:54
36500 -- (-1553.041) [-1550.852] (-1548.182) (-1557.828) * (-1561.893) [-1551.519] (-1541.379) (-1564.040) -- 0:05:16
37000 -- (-1548.058) [-1556.301] (-1562.305) (-1557.544) * [-1549.905] (-1558.436) (-1558.544) (-1565.227) -- 0:05:12
37500 -- (-1548.979) (-1554.093) [-1558.370] (-1548.428) * (-1553.238) [-1547.429] (-1558.347) (-1564.745) -- 0:05:08
38000 -- [-1558.792] (-1556.037) (-1569.403) (-1550.685) * (-1554.241) (-1558.537) [-1548.645] (-1551.127) -- 0:05:03
38500 -- (-1562.841) (-1551.234) [-1550.551] (-1561.912) * (-1561.029) (-1548.583) (-1545.822) [-1549.021] -- 0:04:59
39000 -- (-1553.796) [-1550.886] (-1556.699) (-1557.439) * (-1554.262) (-1549.960) (-1557.580) [-1545.673] -- 0:04:55
39500 -- (-1556.254) (-1547.847) [-1545.797] (-1555.843) * (-1557.724) (-1549.962) (-1551.349) [-1553.213] -- 0:04:51
40000 -- (-1566.061) (-1560.348) [-1549.615] (-1552.816) * [-1560.473] (-1561.463) (-1548.700) (-1559.234) -- 0:05:12
Average standard deviation of split frequencies: 0.024012
40500 -- (-1560.035) (-1550.989) [-1543.252] (-1561.269) * [-1557.524] (-1542.212) (-1563.885) (-1549.290) -- 0:05:07
41000 -- (-1561.285) (-1555.906) (-1564.698) [-1555.117] * (-1554.862) (-1558.920) [-1562.198] (-1570.515) -- 0:05:04
41500 -- (-1547.710) (-1554.660) [-1551.381] (-1560.975) * [-1554.321] (-1557.068) (-1566.703) (-1559.618) -- 0:05:00
42000 -- (-1558.304) (-1558.969) [-1549.290] (-1559.375) * (-1568.870) (-1560.794) (-1559.555) [-1549.631] -- 0:04:56
42500 -- [-1555.163] (-1556.061) (-1567.223) (-1550.289) * (-1560.336) (-1550.575) (-1566.541) [-1556.098] -- 0:04:52
43000 -- (-1558.144) (-1554.615) [-1563.812] (-1549.663) * (-1552.263) (-1555.864) (-1555.502) [-1542.412] -- 0:04:49
43500 -- [-1549.097] (-1550.791) (-1557.624) (-1564.736) * (-1561.369) (-1557.981) [-1561.507] (-1545.841) -- 0:05:07
44000 -- [-1546.800] (-1553.383) (-1555.304) (-1548.369) * (-1563.988) (-1554.328) [-1559.396] (-1555.852) -- 0:05:04
44500 -- [-1542.921] (-1558.268) (-1563.330) (-1553.869) * (-1554.563) (-1541.416) [-1553.291] (-1557.363) -- 0:05:00
45000 -- (-1556.577) (-1556.065) (-1557.982) [-1559.175] * (-1547.553) (-1545.235) (-1561.436) [-1557.203] -- 0:04:57
Average standard deviation of split frequencies: 0.013908
45500 -- [-1543.853] (-1562.128) (-1545.863) (-1550.890) * (-1562.907) [-1549.167] (-1556.579) (-1557.865) -- 0:04:53
46000 -- (-1546.481) (-1558.629) [-1546.959] (-1549.224) * (-1565.005) (-1545.552) [-1549.002] (-1550.390) -- 0:04:50
46500 -- (-1554.670) (-1552.334) (-1554.601) [-1544.561] * (-1556.190) (-1556.209) [-1552.782] (-1553.828) -- 0:05:07
47000 -- (-1549.765) (-1562.476) (-1557.708) [-1542.329] * (-1555.857) (-1569.020) [-1547.612] (-1550.060) -- 0:05:04
47500 -- (-1557.440) (-1559.447) (-1550.529) [-1553.391] * (-1555.691) (-1546.103) (-1546.866) [-1546.013] -- 0:05:00
48000 -- (-1561.344) (-1560.001) [-1557.253] (-1544.624) * (-1549.851) (-1546.459) [-1550.149] (-1556.955) -- 0:04:57
48500 -- (-1542.542) [-1548.428] (-1548.285) (-1562.346) * [-1542.174] (-1547.655) (-1563.539) (-1555.344) -- 0:04:54
49000 -- [-1549.171] (-1556.267) (-1558.615) (-1563.411) * [-1561.218] (-1549.989) (-1557.045) (-1563.840) -- 0:04:51
49500 -- (-1546.111) [-1542.837] (-1567.248) (-1552.419) * (-1555.998) (-1549.499) [-1551.431] (-1562.126) -- 0:04:48
50000 -- [-1560.956] (-1551.058) (-1558.707) (-1548.652) * (-1561.188) [-1543.916] (-1558.661) (-1562.295) -- 0:05:04
Average standard deviation of split frequencies: 0.018608
50500 -- (-1551.359) (-1573.885) (-1567.173) [-1547.076] * [-1551.664] (-1554.597) (-1550.169) (-1556.732) -- 0:05:00
51000 -- (-1545.987) (-1559.700) (-1561.326) [-1545.060] * [-1549.265] (-1555.923) (-1554.901) (-1562.878) -- 0:04:57
51500 -- (-1549.192) (-1549.095) (-1552.284) [-1550.476] * [-1544.855] (-1572.605) (-1552.276) (-1562.770) -- 0:04:54
52000 -- (-1546.550) (-1557.182) [-1550.380] (-1559.612) * [-1544.455] (-1553.472) (-1550.913) (-1562.125) -- 0:04:51
52500 -- [-1549.937] (-1570.178) (-1550.238) (-1555.803) * (-1551.825) (-1557.665) [-1556.396] (-1562.730) -- 0:04:48
53000 -- (-1544.924) [-1551.250] (-1564.255) (-1556.573) * [-1557.692] (-1558.899) (-1561.459) (-1547.629) -- 0:05:03
53500 -- (-1558.726) (-1554.671) [-1554.383] (-1560.471) * (-1550.532) [-1551.328] (-1552.573) (-1551.716) -- 0:05:00
54000 -- [-1551.989] (-1549.389) (-1557.388) (-1559.432) * (-1547.593) (-1563.780) (-1553.481) [-1544.210] -- 0:04:57
54500 -- [-1552.144] (-1560.696) (-1558.127) (-1553.150) * [-1557.692] (-1555.439) (-1561.147) (-1552.042) -- 0:04:54
55000 -- (-1555.917) (-1551.475) (-1549.117) [-1545.031] * (-1575.173) (-1550.509) [-1550.943] (-1552.662) -- 0:04:52
Average standard deviation of split frequencies: 0.014431
55500 -- (-1568.479) [-1541.147] (-1554.381) (-1553.181) * (-1554.852) [-1549.779] (-1552.217) (-1552.546) -- 0:04:49
56000 -- (-1555.455) [-1551.149] (-1550.736) (-1548.979) * (-1553.640) (-1546.531) (-1549.465) [-1558.479] -- 0:04:46
56500 -- (-1564.563) [-1554.104] (-1555.014) (-1556.892) * (-1546.556) [-1559.386] (-1559.812) (-1566.837) -- 0:05:00
57000 -- (-1568.284) [-1560.474] (-1553.705) (-1554.939) * (-1557.209) (-1556.304) [-1552.206] (-1548.090) -- 0:04:57
57500 -- (-1559.808) (-1556.146) [-1544.271] (-1553.007) * [-1556.859] (-1553.035) (-1560.131) (-1553.729) -- 0:04:55
58000 -- (-1560.362) (-1567.210) [-1549.758] (-1564.228) * [-1546.901] (-1559.669) (-1548.296) (-1553.105) -- 0:04:52
58500 -- [-1548.395] (-1571.007) (-1552.560) (-1560.652) * (-1547.670) [-1559.232] (-1548.026) (-1554.955) -- 0:04:49
59000 -- (-1547.774) (-1563.918) (-1557.839) [-1553.130] * [-1550.733] (-1566.975) (-1551.016) (-1538.968) -- 0:04:47
59500 -- (-1551.265) (-1566.367) [-1543.573] (-1551.693) * (-1559.969) (-1555.715) [-1544.782] (-1548.414) -- 0:05:00
60000 -- [-1549.150] (-1560.726) (-1544.984) (-1560.995) * (-1551.514) (-1566.701) [-1549.165] (-1552.138) -- 0:04:57
Average standard deviation of split frequencies: 0.014431
60500 -- [-1550.290] (-1549.633) (-1570.619) (-1548.412) * (-1550.620) (-1564.072) (-1560.472) [-1546.678] -- 0:04:55
61000 -- (-1564.238) (-1561.145) (-1568.259) [-1547.830] * (-1546.391) [-1551.614] (-1558.863) (-1556.204) -- 0:04:52
61500 -- [-1552.554] (-1568.837) (-1552.996) (-1551.525) * [-1552.347] (-1552.759) (-1564.034) (-1580.372) -- 0:04:49
62000 -- (-1552.012) (-1545.356) (-1563.081) [-1546.253] * (-1549.902) (-1551.067) (-1555.486) [-1549.269] -- 0:04:47
62500 -- (-1555.555) (-1550.737) [-1554.182] (-1562.378) * (-1546.471) (-1555.377) [-1557.541] (-1553.838) -- 0:04:45
63000 -- (-1556.312) [-1547.109] (-1552.083) (-1554.111) * [-1556.150] (-1548.068) (-1554.094) (-1543.911) -- 0:04:57
63500 -- [-1552.283] (-1549.466) (-1549.225) (-1554.089) * (-1553.968) (-1547.822) [-1551.346] (-1550.785) -- 0:04:54
64000 -- [-1545.800] (-1562.401) (-1547.041) (-1560.583) * (-1556.614) (-1569.268) [-1552.846] (-1551.240) -- 0:04:52
64500 -- (-1562.814) (-1556.970) [-1544.980] (-1553.527) * (-1555.352) (-1556.047) (-1555.412) [-1546.559] -- 0:04:50
65000 -- (-1547.323) (-1553.391) [-1543.756] (-1556.533) * (-1549.070) [-1549.987] (-1558.858) (-1549.224) -- 0:04:47
Average standard deviation of split frequencies: 0.013265
65500 -- [-1542.084] (-1570.807) (-1566.093) (-1548.011) * (-1550.664) (-1551.323) (-1560.902) [-1546.146] -- 0:04:45
66000 -- (-1549.635) (-1567.315) (-1557.088) [-1547.652] * [-1545.266] (-1560.283) (-1553.434) (-1548.667) -- 0:04:57
66500 -- [-1556.185] (-1555.000) (-1557.129) (-1555.798) * [-1553.595] (-1542.319) (-1560.589) (-1557.661) -- 0:04:54
67000 -- [-1553.501] (-1550.746) (-1564.571) (-1551.259) * (-1551.259) [-1552.649] (-1548.409) (-1558.334) -- 0:04:52
67500 -- (-1557.748) [-1547.941] (-1558.997) (-1548.063) * [-1561.041] (-1550.492) (-1553.552) (-1557.982) -- 0:04:50
68000 -- (-1561.844) [-1545.322] (-1572.966) (-1546.593) * (-1553.299) (-1549.307) [-1551.497] (-1557.070) -- 0:04:47
68500 -- (-1563.484) (-1560.746) (-1560.759) [-1544.894] * (-1555.820) (-1566.003) [-1545.993] (-1548.812) -- 0:04:45
69000 -- (-1562.468) (-1558.090) (-1557.419) [-1555.818] * (-1548.760) (-1562.719) (-1555.887) [-1548.288] -- 0:04:43
69500 -- [-1556.383] (-1550.518) (-1562.165) (-1561.091) * (-1560.110) (-1570.367) (-1570.519) [-1558.399] -- 0:04:54
70000 -- (-1551.661) [-1553.604] (-1555.186) (-1545.619) * [-1551.577] (-1558.144) (-1550.633) (-1552.922) -- 0:04:52
Average standard deviation of split frequencies: 0.017630
70500 -- (-1561.735) (-1560.250) (-1560.109) [-1550.055] * (-1562.999) (-1549.379) [-1558.670] (-1550.543) -- 0:04:50
71000 -- (-1558.855) (-1568.443) [-1555.520] (-1553.362) * (-1551.060) (-1557.396) [-1549.029] (-1558.070) -- 0:04:47
71500 -- [-1559.739] (-1564.621) (-1550.222) (-1566.765) * [-1544.295] (-1544.805) (-1545.024) (-1549.318) -- 0:04:45
72000 -- (-1547.533) (-1555.215) (-1551.263) [-1549.604] * (-1550.414) [-1541.268] (-1550.320) (-1554.942) -- 0:04:43
72500 -- (-1576.486) [-1555.414] (-1553.254) (-1561.363) * (-1556.105) (-1542.772) (-1554.532) [-1556.583] -- 0:04:54
73000 -- (-1557.481) [-1563.150] (-1549.712) (-1557.129) * (-1556.346) [-1545.156] (-1555.492) (-1572.423) -- 0:04:52
73500 -- [-1544.797] (-1553.231) (-1564.339) (-1551.161) * (-1559.780) [-1542.549] (-1556.649) (-1556.161) -- 0:04:49
74000 -- (-1551.005) (-1559.167) [-1552.531] (-1561.252) * (-1557.220) (-1536.241) [-1555.813] (-1553.896) -- 0:04:47
74500 -- (-1552.402) (-1567.934) (-1552.035) [-1550.889] * [-1554.185] (-1562.084) (-1554.606) (-1553.184) -- 0:04:45
75000 -- [-1546.422] (-1549.032) (-1548.304) (-1552.798) * (-1555.099) [-1542.814] (-1557.531) (-1555.080) -- 0:04:43
Average standard deviation of split frequencies: 0.016393
75500 -- (-1563.679) (-1559.115) (-1558.959) [-1546.723] * (-1555.976) (-1566.679) [-1555.816] (-1550.090) -- 0:04:41
76000 -- (-1578.764) (-1552.901) [-1558.454] (-1549.998) * (-1571.814) (-1558.235) (-1550.018) [-1548.641] -- 0:04:51
76500 -- [-1553.203] (-1559.954) (-1547.695) (-1560.601) * (-1551.446) [-1554.289] (-1555.270) (-1556.684) -- 0:04:49
77000 -- (-1556.668) (-1559.056) (-1561.019) [-1547.184] * (-1553.521) [-1548.672] (-1547.317) (-1566.128) -- 0:04:47
77500 -- (-1564.152) (-1566.455) [-1550.831] (-1549.446) * [-1553.356] (-1562.669) (-1547.782) (-1554.815) -- 0:04:45
78000 -- (-1563.490) (-1563.282) (-1555.843) [-1552.128] * (-1551.921) (-1559.657) [-1547.624] (-1564.858) -- 0:04:43
78500 -- (-1560.723) (-1554.944) (-1559.245) [-1552.115] * [-1549.310] (-1558.435) (-1565.517) (-1553.233) -- 0:04:41
79000 -- (-1558.488) (-1549.639) (-1562.278) [-1551.134] * [-1544.778] (-1545.655) (-1551.487) (-1548.302) -- 0:04:51
79500 -- (-1563.413) (-1549.317) (-1560.115) [-1550.097] * [-1549.015] (-1554.522) (-1555.032) (-1557.986) -- 0:04:49
80000 -- (-1564.700) [-1546.630] (-1556.536) (-1552.754) * (-1553.013) (-1553.612) (-1555.064) [-1545.589] -- 0:04:47
Average standard deviation of split frequencies: 0.014610
80500 -- (-1554.186) (-1555.074) [-1544.882] (-1551.273) * (-1548.858) [-1545.945] (-1563.322) (-1550.253) -- 0:04:45
81000 -- (-1559.650) [-1553.614] (-1551.245) (-1551.203) * (-1552.305) (-1549.762) (-1553.193) [-1551.076] -- 0:04:43
81500 -- (-1552.778) [-1544.391] (-1547.627) (-1556.594) * (-1562.150) (-1558.794) (-1549.563) [-1547.093] -- 0:04:41
82000 -- (-1565.990) (-1562.757) [-1546.974] (-1545.034) * (-1551.533) (-1573.194) (-1552.256) [-1555.752] -- 0:04:39
82500 -- [-1548.191] (-1557.168) (-1544.737) (-1562.160) * [-1544.358] (-1561.587) (-1559.381) (-1550.539) -- 0:04:49
83000 -- [-1550.344] (-1561.500) (-1553.440) (-1555.984) * [-1545.696] (-1559.392) (-1562.044) (-1550.468) -- 0:04:47
83500 -- [-1547.685] (-1555.750) (-1547.181) (-1553.699) * (-1555.471) (-1549.404) [-1558.761] (-1559.392) -- 0:04:45
84000 -- (-1557.985) (-1561.445) (-1547.370) [-1553.321] * [-1547.167] (-1546.608) (-1554.269) (-1563.850) -- 0:04:43
84500 -- (-1558.190) [-1542.677] (-1560.344) (-1548.613) * (-1547.442) (-1550.516) (-1548.175) [-1547.246] -- 0:04:41
85000 -- (-1557.293) [-1542.316] (-1559.400) (-1557.316) * [-1552.934] (-1553.276) (-1545.897) (-1550.386) -- 0:04:39
Average standard deviation of split frequencies: 0.015270
85500 -- (-1555.380) [-1549.927] (-1559.462) (-1547.777) * (-1551.346) (-1560.150) [-1546.759] (-1559.111) -- 0:04:48
86000 -- (-1555.078) [-1548.391] (-1553.510) (-1551.667) * (-1559.943) (-1557.100) [-1548.472] (-1553.192) -- 0:04:46
86500 -- (-1549.270) (-1559.196) [-1546.812] (-1552.159) * (-1555.025) [-1551.621] (-1567.869) (-1563.303) -- 0:04:45
87000 -- (-1557.527) (-1562.783) [-1546.242] (-1546.058) * (-1554.710) (-1552.167) (-1562.764) [-1548.163] -- 0:04:43
87500 -- (-1557.179) (-1547.359) (-1558.782) [-1555.037] * (-1546.394) (-1551.375) [-1554.887] (-1562.497) -- 0:04:41
88000 -- (-1560.253) (-1549.952) [-1551.133] (-1561.522) * (-1553.048) (-1543.842) (-1563.401) [-1551.415] -- 0:04:39
88500 -- (-1557.016) (-1554.565) [-1549.439] (-1562.030) * (-1554.926) (-1546.326) [-1550.787] (-1546.068) -- 0:04:38
89000 -- (-1556.327) (-1562.333) [-1556.110] (-1549.984) * [-1553.857] (-1558.264) (-1554.716) (-1559.343) -- 0:04:46
89500 -- [-1552.408] (-1564.851) (-1546.282) (-1558.929) * (-1551.600) [-1554.962] (-1557.940) (-1560.909) -- 0:04:44
90000 -- (-1547.484) (-1569.628) [-1551.070] (-1560.627) * [-1550.853] (-1552.258) (-1552.559) (-1558.995) -- 0:04:43
Average standard deviation of split frequencies: 0.014484
90500 -- (-1555.962) (-1553.812) [-1558.368] (-1551.867) * [-1545.905] (-1552.871) (-1545.522) (-1561.592) -- 0:04:41
91000 -- [-1548.085] (-1560.206) (-1549.717) (-1555.441) * (-1557.636) [-1546.852] (-1554.692) (-1554.878) -- 0:04:39
91500 -- (-1568.326) (-1553.359) (-1554.390) [-1549.452] * (-1556.547) [-1542.944] (-1554.472) (-1549.016) -- 0:04:38
92000 -- [-1559.456] (-1551.252) (-1552.563) (-1553.425) * [-1555.720] (-1552.100) (-1556.198) (-1561.293) -- 0:04:46
92500 -- (-1551.134) (-1551.411) (-1553.548) [-1546.202] * [-1555.972] (-1545.587) (-1562.763) (-1551.696) -- 0:04:44
93000 -- (-1553.250) (-1559.161) (-1560.633) [-1549.573] * (-1563.200) (-1546.548) [-1548.227] (-1548.177) -- 0:04:42
93500 -- (-1554.971) (-1553.144) [-1558.796] (-1567.597) * [-1548.055] (-1546.968) (-1550.793) (-1580.720) -- 0:04:41
94000 -- (-1564.229) [-1553.830] (-1564.634) (-1548.878) * (-1555.062) (-1546.526) [-1547.006] (-1569.071) -- 0:04:39
94500 -- (-1581.168) (-1549.688) (-1547.318) [-1548.451] * (-1548.890) (-1553.744) (-1552.759) [-1556.625] -- 0:04:37
95000 -- (-1574.971) (-1549.930) (-1550.769) [-1548.547] * (-1552.876) (-1556.691) (-1552.418) [-1549.138] -- 0:04:36
Average standard deviation of split frequencies: 0.013328
95500 -- (-1563.977) [-1547.136] (-1548.894) (-1553.489) * (-1555.168) [-1547.544] (-1554.204) (-1555.850) -- 0:04:44
96000 -- (-1561.428) [-1546.071] (-1553.376) (-1549.303) * [-1550.694] (-1549.527) (-1553.164) (-1553.127) -- 0:04:42
96500 -- [-1552.774] (-1562.522) (-1566.801) (-1565.873) * (-1550.550) [-1545.813] (-1558.359) (-1550.253) -- 0:04:40
97000 -- (-1550.601) [-1547.914] (-1564.709) (-1564.635) * (-1541.617) [-1556.107] (-1549.075) (-1557.972) -- 0:04:39
97500 -- (-1552.998) [-1549.913] (-1559.470) (-1546.173) * [-1544.836] (-1552.111) (-1543.397) (-1554.809) -- 0:04:37
98000 -- (-1553.045) (-1549.797) (-1563.863) [-1548.900] * (-1554.660) [-1550.911] (-1547.432) (-1551.179) -- 0:04:36
98500 -- (-1557.880) [-1550.068] (-1551.941) (-1555.566) * (-1549.059) (-1555.971) [-1548.349] (-1547.603) -- 0:04:34
99000 -- (-1557.021) (-1563.392) (-1547.864) [-1557.167] * (-1547.851) (-1559.260) (-1554.718) [-1559.389] -- 0:04:42
99500 -- (-1560.091) (-1545.874) [-1550.677] (-1564.237) * (-1547.751) (-1560.054) [-1549.501] (-1562.283) -- 0:04:40
100000 -- (-1564.547) [-1547.945] (-1557.352) (-1550.380) * (-1560.020) (-1550.454) (-1554.990) [-1547.949] -- 0:04:39
Average standard deviation of split frequencies: 0.016390
100500 -- (-1550.746) (-1559.187) [-1555.516] (-1549.779) * [-1549.782] (-1561.695) (-1557.939) (-1555.350) -- 0:04:37
101000 -- (-1573.612) (-1547.482) (-1568.283) [-1557.424] * [-1547.272] (-1563.612) (-1556.311) (-1556.107) -- 0:04:35
101500 -- (-1559.050) (-1553.118) [-1542.343] (-1548.820) * [-1550.987] (-1555.841) (-1551.320) (-1560.268) -- 0:04:34
102000 -- (-1554.857) (-1558.431) [-1550.843] (-1558.016) * (-1552.499) [-1545.544] (-1545.003) (-1550.568) -- 0:04:41
102500 -- (-1551.707) (-1554.338) [-1550.172] (-1566.530) * (-1556.995) [-1550.437] (-1556.599) (-1560.012) -- 0:04:40
103000 -- (-1559.222) (-1553.896) [-1544.680] (-1553.122) * (-1566.780) (-1556.711) [-1551.086] (-1559.247) -- 0:04:38
103500 -- [-1553.160] (-1562.305) (-1547.615) (-1566.620) * (-1563.951) (-1545.967) (-1553.338) [-1555.200] -- 0:04:37
104000 -- [-1548.428] (-1558.304) (-1548.931) (-1554.176) * (-1562.216) [-1557.642] (-1554.390) (-1558.865) -- 0:04:35
104500 -- (-1546.925) (-1565.872) (-1547.660) [-1553.636] * [-1556.748] (-1558.601) (-1575.295) (-1551.161) -- 0:04:34
105000 -- [-1553.067] (-1542.405) (-1551.693) (-1562.783) * [-1556.044] (-1552.210) (-1552.805) (-1583.244) -- 0:04:32
Average standard deviation of split frequencies: 0.016836
105500 -- (-1557.845) [-1547.378] (-1549.483) (-1556.972) * (-1562.969) (-1562.470) (-1552.933) [-1553.023] -- 0:04:39
106000 -- (-1554.756) (-1554.524) (-1550.319) [-1548.979] * (-1563.638) [-1560.063] (-1560.121) (-1551.594) -- 0:04:38
106500 -- (-1554.112) (-1554.622) [-1548.923] (-1554.927) * (-1566.238) [-1558.937] (-1562.333) (-1564.783) -- 0:04:36
107000 -- (-1554.747) (-1558.444) (-1556.858) [-1543.607] * [-1544.623] (-1564.841) (-1554.696) (-1557.341) -- 0:04:35
107500 -- (-1555.562) (-1551.888) [-1554.270] (-1561.292) * (-1558.689) (-1565.411) [-1549.936] (-1550.811) -- 0:04:33
108000 -- (-1554.508) (-1558.417) (-1554.793) [-1549.608] * (-1554.287) (-1564.120) (-1547.164) [-1547.260] -- 0:04:32
108500 -- (-1557.082) [-1553.559] (-1555.813) (-1556.952) * (-1556.243) [-1549.271] (-1567.027) (-1546.646) -- 0:04:39
109000 -- (-1550.699) (-1556.860) [-1547.090] (-1555.175) * (-1557.486) [-1552.242] (-1548.163) (-1556.815) -- 0:04:37
109500 -- [-1566.446] (-1559.933) (-1552.765) (-1559.076) * (-1548.082) (-1566.881) (-1552.462) [-1552.040] -- 0:04:36
110000 -- (-1561.331) (-1550.981) [-1551.151] (-1565.296) * [-1542.603] (-1558.135) (-1547.706) (-1558.542) -- 0:04:35
Average standard deviation of split frequencies: 0.015517
110500 -- (-1548.851) [-1539.638] (-1565.743) (-1564.447) * [-1544.945] (-1561.327) (-1551.868) (-1559.066) -- 0:04:33
111000 -- [-1550.348] (-1557.939) (-1556.237) (-1568.369) * (-1562.184) [-1545.580] (-1563.187) (-1555.037) -- 0:04:32
111500 -- (-1573.121) (-1551.681) (-1547.762) [-1550.177] * (-1565.636) (-1549.419) (-1564.190) [-1556.823] -- 0:04:30
112000 -- (-1558.542) (-1542.288) [-1550.189] (-1559.132) * (-1558.288) [-1545.412] (-1561.668) (-1554.383) -- 0:04:37
112500 -- (-1564.574) [-1549.170] (-1545.481) (-1561.555) * (-1551.401) (-1549.569) [-1561.673] (-1544.685) -- 0:04:36
113000 -- [-1552.698] (-1546.722) (-1560.111) (-1564.393) * [-1543.622] (-1553.529) (-1549.732) (-1556.870) -- 0:04:34
113500 -- (-1550.725) (-1557.540) (-1554.489) [-1560.741] * (-1560.104) [-1552.179] (-1551.150) (-1549.720) -- 0:04:33
114000 -- (-1552.128) (-1558.573) (-1547.931) [-1559.902] * (-1561.221) (-1562.147) [-1549.926] (-1552.440) -- 0:04:32
114500 -- (-1554.906) (-1554.192) [-1553.271] (-1556.912) * (-1561.967) [-1547.760] (-1548.482) (-1555.370) -- 0:04:30
115000 -- (-1560.723) [-1548.205] (-1555.827) (-1562.071) * [-1553.036] (-1549.938) (-1551.383) (-1555.458) -- 0:04:37
Average standard deviation of split frequencies: 0.014804
115500 -- (-1556.737) (-1552.096) [-1546.003] (-1568.332) * (-1559.416) [-1548.538] (-1572.269) (-1560.802) -- 0:04:35
116000 -- (-1573.209) (-1562.221) [-1551.745] (-1562.547) * (-1549.889) [-1547.552] (-1555.021) (-1556.363) -- 0:04:34
116500 -- [-1546.234] (-1560.058) (-1545.177) (-1553.685) * (-1545.093) (-1554.356) (-1560.607) [-1557.475] -- 0:04:33
117000 -- (-1557.485) (-1550.865) [-1550.463] (-1556.993) * (-1553.946) (-1564.545) [-1548.228] (-1554.348) -- 0:04:31
117500 -- (-1560.786) (-1547.021) [-1548.852] (-1558.777) * (-1550.070) (-1557.548) [-1552.944] (-1560.309) -- 0:04:30
118000 -- (-1556.421) (-1551.831) (-1551.392) [-1559.115] * [-1550.129] (-1573.914) (-1553.477) (-1550.588) -- 0:04:29
118500 -- (-1542.671) [-1544.547] (-1567.623) (-1557.220) * (-1553.806) (-1556.558) [-1545.464] (-1558.233) -- 0:04:35
119000 -- [-1549.116] (-1556.216) (-1566.683) (-1560.165) * [-1550.477] (-1555.981) (-1552.119) (-1551.688) -- 0:04:33
119500 -- (-1548.318) (-1552.196) [-1553.300] (-1566.084) * [-1546.914] (-1560.144) (-1554.330) (-1553.643) -- 0:04:32
120000 -- (-1558.928) [-1548.559] (-1558.096) (-1554.598) * (-1548.487) [-1542.162] (-1549.238) (-1553.651) -- 0:04:31
Average standard deviation of split frequencies: 0.015348
120500 -- (-1553.274) [-1548.400] (-1544.144) (-1561.742) * (-1559.996) (-1560.388) (-1557.319) [-1550.039] -- 0:04:30
121000 -- (-1558.144) [-1549.225] (-1559.336) (-1558.680) * [-1545.435] (-1556.736) (-1555.653) (-1552.034) -- 0:04:28
121500 -- (-1556.183) (-1558.775) (-1558.432) [-1546.989] * [-1547.284] (-1558.716) (-1563.812) (-1552.095) -- 0:04:34
122000 -- (-1551.569) (-1563.786) (-1553.962) [-1553.063] * [-1546.755] (-1558.074) (-1553.352) (-1557.300) -- 0:04:33
122500 -- (-1555.775) (-1556.843) (-1563.625) [-1552.254] * (-1559.067) (-1556.696) (-1548.304) [-1550.599] -- 0:04:32
123000 -- (-1554.897) [-1549.227] (-1553.418) (-1558.061) * (-1560.619) [-1549.954] (-1550.593) (-1548.615) -- 0:04:30
123500 -- (-1552.407) (-1553.989) [-1543.833] (-1556.176) * (-1551.489) (-1570.949) [-1544.948] (-1551.226) -- 0:04:29
124000 -- (-1551.858) (-1561.806) (-1550.877) [-1544.865] * (-1548.194) (-1550.365) (-1552.045) [-1547.882] -- 0:04:28
124500 -- (-1547.866) (-1562.024) (-1548.778) [-1543.148] * [-1556.248] (-1561.545) (-1552.727) (-1551.168) -- 0:04:27
125000 -- (-1554.118) (-1556.399) (-1555.068) [-1548.823] * [-1550.926] (-1563.847) (-1555.146) (-1551.697) -- 0:04:33
Average standard deviation of split frequencies: 0.013362
125500 -- (-1549.804) (-1567.158) [-1549.220] (-1556.305) * (-1560.349) (-1551.275) [-1553.129] (-1567.150) -- 0:04:31
126000 -- (-1548.423) [-1551.948] (-1552.423) (-1553.126) * [-1549.188] (-1554.142) (-1555.701) (-1552.516) -- 0:04:30
126500 -- (-1550.757) (-1551.316) (-1562.723) [-1550.474] * [-1553.982] (-1552.275) (-1546.137) (-1564.498) -- 0:04:29
127000 -- [-1546.608] (-1563.507) (-1555.545) (-1560.452) * [-1546.889] (-1552.522) (-1555.376) (-1567.489) -- 0:04:28
127500 -- (-1549.439) (-1542.310) (-1567.507) [-1551.118] * [-1545.034] (-1549.348) (-1553.316) (-1552.902) -- 0:04:26
128000 -- (-1566.067) (-1554.005) (-1549.952) [-1562.440] * [-1556.555] (-1554.107) (-1555.504) (-1549.355) -- 0:04:32
128500 -- (-1555.843) (-1554.480) (-1555.631) [-1549.685] * [-1556.686] (-1554.473) (-1552.262) (-1560.016) -- 0:04:31
129000 -- [-1550.513] (-1551.753) (-1551.729) (-1553.233) * [-1548.489] (-1545.557) (-1553.172) (-1556.564) -- 0:04:30
129500 -- (-1558.884) [-1553.164] (-1543.679) (-1560.278) * [-1550.525] (-1552.762) (-1545.057) (-1555.996) -- 0:04:28
130000 -- (-1558.176) (-1543.559) (-1560.035) [-1551.260] * [-1549.112] (-1552.027) (-1552.425) (-1570.039) -- 0:04:27
Average standard deviation of split frequencies: 0.011338
130500 -- [-1560.093] (-1554.302) (-1572.645) (-1552.333) * (-1554.892) (-1538.720) [-1551.649] (-1544.686) -- 0:04:26
131000 -- (-1559.666) (-1556.667) [-1547.397] (-1563.831) * (-1546.791) [-1551.006] (-1551.088) (-1554.565) -- 0:04:25
131500 -- (-1555.705) [-1550.394] (-1548.582) (-1554.394) * (-1549.256) [-1555.255] (-1549.769) (-1562.134) -- 0:04:30
132000 -- [-1558.617] (-1554.041) (-1553.945) (-1553.857) * (-1547.946) (-1549.399) [-1548.711] (-1559.804) -- 0:04:29
132500 -- (-1561.433) (-1554.709) [-1549.456] (-1551.829) * [-1546.117] (-1563.908) (-1549.963) (-1555.905) -- 0:04:28
133000 -- (-1566.602) [-1555.395] (-1544.935) (-1554.231) * (-1542.484) (-1553.178) (-1553.871) [-1555.653] -- 0:04:27
133500 -- (-1563.835) (-1562.292) (-1562.604) [-1546.582] * (-1547.408) [-1557.355] (-1570.544) (-1557.464) -- 0:04:26
134000 -- (-1554.577) [-1555.995] (-1571.304) (-1553.850) * (-1549.283) (-1565.011) (-1550.250) [-1556.540] -- 0:04:24
134500 -- (-1562.987) (-1559.623) (-1555.012) [-1566.331] * (-1547.321) (-1556.903) [-1559.031] (-1554.081) -- 0:04:30
135000 -- (-1565.805) (-1552.647) (-1549.207) [-1548.497] * (-1554.328) (-1560.328) (-1556.019) [-1544.918] -- 0:04:29
Average standard deviation of split frequencies: 0.014360
135500 -- (-1558.446) [-1556.182] (-1554.628) (-1550.785) * (-1557.466) (-1554.792) [-1547.286] (-1552.098) -- 0:04:27
136000 -- (-1552.093) (-1546.577) (-1563.572) [-1549.675] * [-1560.930] (-1554.161) (-1553.550) (-1551.971) -- 0:04:26
136500 -- (-1550.755) (-1553.908) [-1555.730] (-1558.049) * [-1547.939] (-1558.022) (-1560.314) (-1552.059) -- 0:04:25
137000 -- (-1560.694) (-1550.945) (-1550.749) [-1548.076] * (-1553.570) (-1559.796) [-1549.832] (-1560.336) -- 0:04:24
137500 -- (-1556.552) (-1551.059) [-1548.459] (-1550.986) * [-1555.833] (-1551.451) (-1557.739) (-1550.555) -- 0:04:23
138000 -- [-1553.401] (-1553.597) (-1547.343) (-1556.377) * (-1562.608) [-1543.264] (-1561.196) (-1562.216) -- 0:04:28
138500 -- [-1559.219] (-1570.833) (-1544.872) (-1554.392) * (-1552.332) (-1549.046) [-1548.796] (-1553.597) -- 0:04:27
139000 -- (-1564.826) [-1545.746] (-1568.173) (-1553.490) * (-1559.663) (-1551.884) [-1546.255] (-1559.264) -- 0:04:26
139500 -- (-1550.967) (-1548.189) [-1549.816] (-1555.197) * (-1551.375) (-1558.663) [-1548.725] (-1558.945) -- 0:04:25
140000 -- (-1551.515) (-1549.399) [-1549.544] (-1550.050) * (-1554.873) (-1555.197) [-1554.259] (-1558.690) -- 0:04:24
Average standard deviation of split frequencies: 0.012447
140500 -- (-1547.287) (-1564.132) (-1562.794) [-1548.550] * (-1554.415) (-1559.541) [-1553.124] (-1556.295) -- 0:04:23
141000 -- (-1564.744) (-1548.595) (-1570.738) [-1547.443] * (-1564.189) (-1553.932) (-1555.796) [-1544.162] -- 0:04:28
141500 -- [-1555.895] (-1561.309) (-1548.942) (-1553.393) * (-1544.436) (-1550.747) (-1571.914) [-1550.242] -- 0:04:26
142000 -- (-1566.610) (-1557.316) (-1551.616) [-1544.966] * (-1553.316) (-1550.912) [-1556.964] (-1545.699) -- 0:04:25
142500 -- (-1569.568) (-1559.278) (-1548.295) [-1552.134] * [-1546.174] (-1546.306) (-1551.966) (-1550.532) -- 0:04:24
143000 -- (-1563.578) [-1550.574] (-1554.015) (-1552.820) * [-1545.730] (-1582.296) (-1547.843) (-1548.175) -- 0:04:23
143500 -- (-1559.947) (-1544.360) [-1548.506] (-1553.594) * (-1547.467) (-1564.714) [-1548.546] (-1578.968) -- 0:04:22
144000 -- (-1563.923) (-1549.503) [-1545.687] (-1550.323) * (-1559.032) (-1562.246) [-1548.346] (-1552.597) -- 0:04:21
144500 -- (-1557.778) (-1560.111) (-1557.318) [-1546.934] * [-1555.102] (-1548.037) (-1558.655) (-1549.155) -- 0:04:26
145000 -- (-1557.776) [-1558.577] (-1550.245) (-1547.515) * (-1551.455) (-1553.640) [-1554.943] (-1561.027) -- 0:04:25
Average standard deviation of split frequencies: 0.012685
145500 -- (-1559.342) (-1551.040) (-1554.723) [-1550.215] * [-1544.124] (-1558.365) (-1553.789) (-1561.465) -- 0:04:24
146000 -- (-1555.797) (-1553.240) [-1547.904] (-1561.401) * (-1551.858) [-1550.727] (-1554.619) (-1550.038) -- 0:04:23
146500 -- [-1548.656] (-1561.006) (-1560.813) (-1555.154) * (-1547.489) [-1558.023] (-1565.961) (-1547.091) -- 0:04:22
147000 -- [-1551.027] (-1550.181) (-1560.145) (-1554.746) * [-1547.853] (-1542.124) (-1551.195) (-1565.757) -- 0:04:21
147500 -- [-1542.326] (-1554.382) (-1555.124) (-1551.161) * (-1549.746) (-1559.022) (-1545.015) [-1549.033] -- 0:04:20
148000 -- (-1550.035) [-1554.652] (-1551.578) (-1561.278) * (-1555.435) (-1565.710) [-1544.970] (-1565.868) -- 0:04:24
148500 -- (-1546.617) (-1552.946) [-1549.800] (-1556.394) * [-1552.133] (-1552.487) (-1554.929) (-1567.680) -- 0:04:23
149000 -- [-1547.916] (-1564.718) (-1548.226) (-1560.058) * (-1566.888) [-1553.476] (-1556.254) (-1547.366) -- 0:04:22
149500 -- (-1561.862) [-1550.842] (-1564.879) (-1550.160) * (-1545.390) (-1557.593) [-1546.279] (-1553.568) -- 0:04:21
150000 -- (-1551.636) (-1548.554) [-1549.066] (-1560.578) * (-1555.607) (-1557.369) (-1567.627) [-1547.045] -- 0:04:20
Average standard deviation of split frequencies: 0.012962
150500 -- (-1564.213) (-1568.633) [-1559.826] (-1561.098) * [-1545.573] (-1550.067) (-1558.337) (-1568.129) -- 0:04:19
151000 -- [-1550.918] (-1546.209) (-1557.066) (-1568.969) * (-1554.232) (-1556.785) (-1558.750) [-1548.729] -- 0:04:24
151500 -- [-1547.931] (-1554.088) (-1558.631) (-1562.229) * (-1567.115) (-1565.760) [-1548.482] (-1552.869) -- 0:04:23
152000 -- (-1549.902) (-1561.050) (-1555.156) [-1553.171] * [-1551.326] (-1547.610) (-1558.126) (-1561.676) -- 0:04:22
152500 -- (-1558.381) (-1557.758) [-1558.204] (-1548.520) * (-1571.703) (-1554.894) (-1549.459) [-1549.558] -- 0:04:21
153000 -- (-1556.399) (-1556.550) (-1552.011) [-1546.104] * [-1554.114] (-1556.649) (-1562.100) (-1564.189) -- 0:04:20
153500 -- (-1560.886) (-1551.800) (-1552.528) [-1555.114] * (-1567.520) [-1544.397] (-1563.653) (-1557.516) -- 0:04:19
154000 -- [-1552.701] (-1558.038) (-1565.321) (-1550.965) * (-1553.652) [-1545.772] (-1554.248) (-1560.295) -- 0:04:18
154500 -- (-1557.619) (-1543.278) [-1552.863] (-1556.114) * (-1548.331) (-1553.728) [-1551.238] (-1565.973) -- 0:04:22
155000 -- (-1548.880) (-1554.099) (-1545.295) [-1544.732] * (-1554.952) (-1557.614) [-1551.005] (-1553.149) -- 0:04:21
Average standard deviation of split frequencies: 0.012087
155500 -- (-1549.252) (-1554.871) (-1554.805) [-1557.268] * (-1542.807) (-1549.136) (-1552.717) [-1545.908] -- 0:04:20
156000 -- (-1556.262) (-1561.169) (-1553.675) [-1550.788] * (-1553.453) [-1551.807] (-1562.429) (-1552.420) -- 0:04:19
156500 -- (-1555.678) [-1550.088] (-1566.167) (-1547.420) * [-1550.494] (-1565.978) (-1563.494) (-1552.925) -- 0:04:18
157000 -- (-1561.826) (-1553.038) [-1556.014] (-1546.776) * [-1554.587] (-1559.424) (-1563.325) (-1559.300) -- 0:04:17
157500 -- (-1557.666) (-1548.501) (-1562.159) [-1550.084] * (-1561.035) (-1563.351) [-1548.766] (-1555.286) -- 0:04:22
158000 -- (-1552.528) [-1546.850] (-1571.665) (-1552.265) * (-1546.991) (-1573.317) (-1544.392) [-1545.205] -- 0:04:21
158500 -- (-1556.111) (-1559.064) [-1549.648] (-1551.583) * (-1550.105) (-1555.883) (-1553.621) [-1550.434] -- 0:04:20
159000 -- (-1562.781) (-1552.255) (-1551.453) [-1549.899] * [-1555.049] (-1549.057) (-1549.699) (-1552.909) -- 0:04:19
159500 -- (-1552.245) (-1551.503) (-1552.250) [-1550.748] * (-1570.976) (-1549.556) (-1548.067) [-1548.685] -- 0:04:18
160000 -- (-1558.759) (-1559.461) [-1548.441] (-1552.557) * (-1561.832) [-1552.598] (-1554.262) (-1557.581) -- 0:04:17
Average standard deviation of split frequencies: 0.013413
160500 -- (-1556.799) [-1547.540] (-1559.603) (-1553.715) * [-1559.393] (-1549.373) (-1549.669) (-1556.560) -- 0:04:16
161000 -- (-1555.263) [-1548.474] (-1551.975) (-1554.855) * [-1546.344] (-1552.621) (-1549.010) (-1556.316) -- 0:04:20
161500 -- (-1545.258) [-1546.931] (-1559.377) (-1553.053) * (-1557.983) (-1552.062) (-1559.035) [-1546.695] -- 0:04:19
162000 -- (-1565.365) (-1555.419) [-1546.485] (-1552.130) * [-1543.919] (-1559.777) (-1553.242) (-1548.998) -- 0:04:18
162500 -- (-1560.723) [-1542.422] (-1549.393) (-1554.735) * (-1555.243) (-1556.963) (-1553.532) [-1547.980] -- 0:04:17
163000 -- (-1547.664) [-1552.102] (-1550.171) (-1566.551) * [-1557.599] (-1546.109) (-1553.765) (-1544.537) -- 0:04:16
163500 -- (-1567.690) [-1552.887] (-1555.116) (-1548.629) * (-1565.516) (-1554.329) (-1555.707) [-1546.829] -- 0:04:15
164000 -- [-1546.457] (-1558.765) (-1555.518) (-1554.789) * (-1561.885) (-1555.578) [-1550.676] (-1560.027) -- 0:04:14
164500 -- [-1551.272] (-1551.174) (-1558.221) (-1558.936) * [-1544.150] (-1548.779) (-1561.805) (-1564.260) -- 0:04:19
165000 -- (-1556.107) [-1547.909] (-1569.149) (-1559.820) * (-1565.954) [-1550.390] (-1567.824) (-1564.723) -- 0:04:18
Average standard deviation of split frequencies: 0.014199
165500 -- (-1558.488) (-1546.355) (-1558.130) [-1550.984] * (-1555.622) (-1554.094) [-1549.671] (-1552.913) -- 0:04:17
166000 -- (-1557.125) (-1552.758) (-1556.998) [-1546.354] * (-1559.763) (-1554.279) (-1547.366) [-1553.753] -- 0:04:16
166500 -- (-1573.169) (-1555.012) [-1546.310] (-1556.503) * (-1563.874) [-1547.571] (-1553.036) (-1566.941) -- 0:04:15
167000 -- (-1552.954) (-1560.303) (-1544.067) [-1550.267] * (-1550.846) (-1575.682) [-1557.155] (-1573.394) -- 0:04:14
167500 -- [-1553.628] (-1546.528) (-1568.048) (-1552.840) * (-1549.801) (-1544.574) [-1546.979] (-1554.086) -- 0:04:18
168000 -- (-1563.919) (-1552.965) [-1554.386] (-1553.512) * (-1549.679) (-1561.481) [-1547.705] (-1554.217) -- 0:04:17
168500 -- (-1553.944) [-1549.608] (-1562.701) (-1547.866) * (-1549.259) (-1550.567) (-1552.518) [-1548.037] -- 0:04:16
169000 -- [-1543.638] (-1549.152) (-1557.548) (-1554.559) * (-1553.202) (-1552.516) [-1548.185] (-1547.932) -- 0:04:15
169500 -- [-1556.201] (-1552.856) (-1547.153) (-1567.094) * (-1554.128) (-1559.078) (-1548.739) [-1549.985] -- 0:04:14
170000 -- (-1548.374) (-1556.889) [-1551.566] (-1555.059) * [-1552.765] (-1548.107) (-1554.858) (-1552.213) -- 0:04:13
Average standard deviation of split frequencies: 0.015981
170500 -- (-1553.481) (-1552.127) [-1558.051] (-1564.404) * (-1553.467) (-1557.895) (-1545.790) [-1556.703] -- 0:04:12
171000 -- [-1548.854] (-1553.648) (-1549.264) (-1549.193) * (-1546.937) (-1546.970) (-1551.731) [-1555.828] -- 0:04:16
171500 -- [-1552.109] (-1564.266) (-1548.718) (-1566.360) * (-1559.466) [-1547.068] (-1557.262) (-1561.847) -- 0:04:16
172000 -- (-1554.543) (-1548.480) (-1550.704) [-1551.412] * [-1549.513] (-1556.369) (-1562.695) (-1554.242) -- 0:04:15
172500 -- (-1558.601) (-1548.034) (-1551.878) [-1560.928] * (-1560.536) (-1565.244) (-1579.548) [-1545.612] -- 0:04:14
173000 -- (-1569.861) [-1559.078] (-1559.042) (-1563.264) * (-1558.037) [-1543.521] (-1566.213) (-1541.982) -- 0:04:13
173500 -- (-1547.830) (-1564.979) (-1557.994) [-1553.109] * (-1564.152) (-1543.406) (-1568.961) [-1548.859] -- 0:04:12
174000 -- [-1556.135] (-1562.700) (-1559.771) (-1549.703) * (-1562.339) [-1549.851] (-1559.538) (-1555.196) -- 0:04:16
174500 -- (-1556.477) [-1554.150] (-1563.857) (-1547.218) * (-1568.542) (-1574.616) [-1544.376] (-1550.642) -- 0:04:15
175000 -- [-1549.333] (-1577.017) (-1551.796) (-1545.672) * [-1561.623] (-1558.501) (-1554.794) (-1546.494) -- 0:04:14
Average standard deviation of split frequencies: 0.017027
175500 -- [-1560.701] (-1552.751) (-1556.753) (-1549.579) * (-1553.071) [-1547.336] (-1561.660) (-1550.194) -- 0:04:13
176000 -- (-1552.304) (-1553.357) [-1546.505] (-1557.467) * (-1565.312) (-1547.553) (-1561.087) [-1546.363] -- 0:04:12
176500 -- (-1558.845) (-1551.600) [-1546.370] (-1565.281) * (-1559.670) (-1559.098) (-1552.302) [-1547.077] -- 0:04:11
177000 -- [-1553.936] (-1543.061) (-1550.768) (-1573.444) * (-1561.226) (-1552.536) [-1551.902] (-1559.843) -- 0:04:11
177500 -- (-1561.031) (-1561.154) (-1556.441) [-1552.292] * (-1556.910) (-1547.472) (-1561.371) [-1557.770] -- 0:04:14
178000 -- (-1559.859) (-1555.820) [-1548.778] (-1553.045) * (-1564.553) (-1556.329) (-1556.242) [-1550.093] -- 0:04:13
178500 -- [-1551.248] (-1561.470) (-1546.868) (-1556.494) * (-1556.605) (-1554.730) (-1557.893) [-1547.982] -- 0:04:13
179000 -- [-1550.856] (-1560.185) (-1556.692) (-1566.487) * (-1560.137) (-1550.389) (-1554.997) [-1546.900] -- 0:04:12
179500 -- (-1560.157) (-1554.452) [-1552.518] (-1554.841) * (-1553.929) (-1554.158) [-1548.264] (-1570.500) -- 0:04:11
180000 -- [-1550.012] (-1559.337) (-1545.880) (-1553.451) * [-1547.716] (-1548.141) (-1552.932) (-1566.863) -- 0:04:10
Average standard deviation of split frequencies: 0.017333
180500 -- (-1564.469) (-1561.141) [-1550.594] (-1559.788) * (-1556.501) (-1549.942) [-1539.055] (-1553.017) -- 0:04:14
181000 -- [-1550.644] (-1556.258) (-1542.097) (-1572.118) * [-1556.101] (-1556.920) (-1556.833) (-1562.566) -- 0:04:13
181500 -- [-1553.891] (-1559.682) (-1544.344) (-1554.087) * (-1570.070) (-1556.208) (-1556.235) [-1550.400] -- 0:04:12
182000 -- (-1554.659) (-1554.674) (-1549.059) [-1550.161] * (-1555.980) (-1547.450) (-1554.279) [-1548.154] -- 0:04:11
182500 -- (-1555.033) [-1549.022] (-1551.181) (-1563.906) * (-1554.300) (-1546.553) (-1555.386) [-1560.573] -- 0:04:10
183000 -- (-1563.876) (-1563.342) [-1542.153] (-1552.000) * (-1563.361) [-1568.716] (-1546.173) (-1554.524) -- 0:04:10
183500 -- (-1549.635) (-1560.776) (-1560.700) [-1542.716] * (-1555.128) (-1565.928) [-1558.034] (-1543.705) -- 0:04:09
184000 -- (-1559.258) (-1555.905) [-1550.892] (-1548.086) * (-1570.460) (-1567.454) [-1547.528] (-1558.150) -- 0:04:12
184500 -- (-1555.112) (-1553.318) [-1548.648] (-1565.984) * (-1556.251) (-1561.612) [-1544.464] (-1549.703) -- 0:04:11
185000 -- (-1550.205) (-1555.759) [-1552.948] (-1555.676) * (-1567.341) [-1549.094] (-1562.998) (-1555.163) -- 0:04:11
Average standard deviation of split frequencies: 0.013758
185500 -- (-1553.276) (-1556.691) (-1555.372) [-1551.889] * (-1564.392) [-1542.258] (-1543.116) (-1560.647) -- 0:04:10
186000 -- [-1554.247] (-1562.814) (-1556.897) (-1552.486) * [-1560.922] (-1551.431) (-1557.739) (-1550.319) -- 0:04:09
186500 -- (-1550.973) [-1547.852] (-1553.730) (-1554.595) * [-1546.258] (-1545.830) (-1548.081) (-1551.832) -- 0:04:08
187000 -- (-1554.504) (-1551.739) (-1551.189) [-1555.105] * (-1557.225) (-1547.250) (-1559.618) [-1553.025] -- 0:04:07
187500 -- (-1548.431) (-1551.374) (-1559.331) [-1553.231] * [-1547.118] (-1546.006) (-1557.351) (-1554.131) -- 0:04:11
188000 -- (-1552.143) (-1554.303) [-1551.307] (-1571.599) * (-1551.650) (-1550.250) [-1546.084] (-1551.517) -- 0:04:10
188500 -- [-1555.325] (-1550.792) (-1574.662) (-1557.587) * [-1555.291] (-1552.002) (-1549.227) (-1549.184) -- 0:04:09
189000 -- [-1554.882] (-1556.545) (-1557.603) (-1556.044) * (-1551.730) [-1556.939] (-1560.056) (-1564.703) -- 0:04:08
189500 -- (-1557.806) [-1550.348] (-1548.586) (-1558.134) * [-1554.458] (-1554.547) (-1563.592) (-1561.337) -- 0:04:08
190000 -- (-1554.519) (-1557.868) [-1551.534] (-1548.263) * (-1555.211) (-1565.784) (-1566.178) [-1550.979] -- 0:04:07
Average standard deviation of split frequencies: 0.016247
190500 -- (-1544.648) (-1548.509) [-1545.865] (-1562.484) * [-1550.462] (-1561.695) (-1569.158) (-1555.648) -- 0:04:10
191000 -- [-1548.389] (-1554.184) (-1552.938) (-1557.227) * [-1554.392] (-1554.764) (-1563.547) (-1547.571) -- 0:04:09
191500 -- (-1556.681) (-1543.465) [-1550.709] (-1559.642) * (-1555.444) [-1552.600] (-1553.136) (-1556.305) -- 0:04:09
192000 -- [-1551.110] (-1550.703) (-1550.601) (-1554.771) * [-1545.753] (-1543.338) (-1565.413) (-1554.400) -- 0:04:08
192500 -- (-1557.427) [-1548.708] (-1555.303) (-1567.525) * (-1557.604) [-1553.460] (-1547.936) (-1549.725) -- 0:04:07
193000 -- (-1550.755) (-1564.493) [-1541.980] (-1571.069) * (-1562.150) (-1549.625) (-1554.265) [-1549.296] -- 0:04:06
193500 -- [-1554.912] (-1553.622) (-1548.601) (-1566.104) * (-1556.717) (-1558.429) [-1547.650] (-1553.359) -- 0:04:05
194000 -- (-1554.807) (-1560.577) (-1550.357) [-1549.499] * (-1550.591) (-1560.025) [-1557.970] (-1552.298) -- 0:04:09
194500 -- (-1552.534) (-1548.714) (-1563.181) [-1540.433] * (-1563.024) (-1556.161) (-1557.015) [-1551.550] -- 0:04:08
195000 -- [-1551.488] (-1561.060) (-1559.024) (-1551.288) * (-1573.374) (-1548.159) (-1569.269) [-1552.072] -- 0:04:07
Average standard deviation of split frequencies: 0.015633
195500 -- [-1550.769] (-1570.523) (-1546.817) (-1553.916) * [-1549.062] (-1561.816) (-1551.284) (-1556.756) -- 0:04:06
196000 -- (-1564.234) (-1563.014) (-1549.801) [-1553.809] * (-1565.347) (-1552.709) (-1558.076) [-1557.539] -- 0:04:06
196500 -- (-1567.995) [-1549.793] (-1551.330) (-1548.931) * (-1560.908) (-1549.152) [-1559.181] (-1556.858) -- 0:04:05
197000 -- (-1558.286) (-1557.423) (-1546.067) [-1563.080] * (-1553.165) (-1563.392) [-1551.434] (-1554.031) -- 0:04:08
197500 -- [-1557.819] (-1559.635) (-1548.458) (-1561.926) * [-1549.516] (-1555.571) (-1547.445) (-1553.302) -- 0:04:07
198000 -- (-1562.810) [-1547.564] (-1554.756) (-1559.843) * (-1555.827) (-1546.367) (-1552.491) [-1549.187] -- 0:04:07
198500 -- (-1557.042) (-1555.064) [-1543.390] (-1556.493) * (-1556.270) (-1556.693) [-1555.009] (-1560.277) -- 0:04:06
199000 -- [-1549.404] (-1551.144) (-1558.297) (-1548.623) * (-1550.472) (-1554.751) (-1553.601) [-1555.448] -- 0:04:05
199500 -- [-1548.324] (-1546.540) (-1550.161) (-1553.607) * [-1543.913] (-1558.548) (-1546.961) (-1558.184) -- 0:04:04
200000 -- (-1552.702) (-1565.214) (-1552.638) [-1553.911] * (-1554.748) (-1548.541) [-1552.860] (-1554.646) -- 0:04:04
Average standard deviation of split frequencies: 0.016612
200500 -- (-1544.735) (-1546.711) [-1550.113] (-1560.927) * (-1550.814) [-1554.059] (-1560.607) (-1566.877) -- 0:04:07
201000 -- (-1554.672) (-1554.826) [-1558.017] (-1558.513) * (-1552.631) (-1559.600) [-1547.723] (-1549.249) -- 0:04:06
201500 -- [-1555.635] (-1555.907) (-1550.098) (-1568.381) * (-1549.035) (-1554.531) [-1547.465] (-1560.130) -- 0:04:05
202000 -- [-1553.865] (-1553.576) (-1544.977) (-1551.159) * [-1549.911] (-1552.919) (-1548.553) (-1564.253) -- 0:04:04
202500 -- (-1566.291) (-1564.413) (-1546.249) [-1563.781] * (-1562.561) (-1563.439) (-1557.745) [-1555.766] -- 0:04:04
203000 -- (-1561.319) (-1565.978) (-1548.075) [-1549.033] * [-1552.876] (-1550.073) (-1553.334) (-1564.241) -- 0:04:03
203500 -- (-1553.704) (-1557.632) [-1551.783] (-1564.383) * [-1552.555] (-1551.046) (-1564.904) (-1553.271) -- 0:04:06
204000 -- (-1565.375) (-1548.201) (-1552.341) [-1554.418] * (-1550.612) [-1549.658] (-1559.590) (-1549.280) -- 0:04:05
204500 -- (-1564.032) [-1545.551] (-1551.716) (-1553.663) * (-1560.204) [-1555.103] (-1564.287) (-1551.901) -- 0:04:05
205000 -- (-1551.733) [-1548.054] (-1562.222) (-1565.900) * [-1556.805] (-1563.863) (-1564.418) (-1571.933) -- 0:04:04
Average standard deviation of split frequencies: 0.017163
205500 -- (-1557.656) (-1554.010) [-1552.433] (-1551.594) * (-1566.460) [-1557.374] (-1556.138) (-1553.363) -- 0:04:03
206000 -- (-1544.664) (-1557.760) (-1549.913) [-1545.463] * (-1557.540) [-1556.548] (-1558.283) (-1547.188) -- 0:04:02
206500 -- (-1567.257) (-1549.941) [-1550.158] (-1556.717) * (-1546.395) (-1559.867) (-1562.769) [-1547.204] -- 0:04:02
207000 -- [-1548.553] (-1557.575) (-1559.848) (-1561.498) * [-1549.535] (-1550.595) (-1548.573) (-1554.167) -- 0:04:05
207500 -- (-1561.225) (-1546.020) (-1571.622) [-1552.943] * (-1548.776) (-1560.144) (-1561.283) [-1553.749] -- 0:04:04
208000 -- [-1545.490] (-1546.757) (-1549.450) (-1565.902) * [-1550.265] (-1555.447) (-1565.904) (-1549.204) -- 0:04:03
208500 -- (-1547.366) (-1547.649) (-1556.258) [-1552.576] * (-1551.997) (-1554.267) [-1557.668] (-1545.676) -- 0:04:02
209000 -- (-1557.747) [-1557.892] (-1552.827) (-1544.914) * (-1560.917) (-1554.471) (-1558.046) [-1555.706] -- 0:04:02
209500 -- (-1549.550) (-1551.763) [-1552.201] (-1557.741) * [-1549.123] (-1546.318) (-1558.887) (-1555.409) -- 0:04:01
210000 -- (-1554.858) (-1554.431) [-1553.103] (-1559.928) * (-1546.898) (-1559.710) (-1566.757) [-1548.011] -- 0:04:00
Average standard deviation of split frequencies: 0.015504
210500 -- (-1560.078) (-1562.203) [-1550.325] (-1549.964) * (-1553.395) [-1563.676] (-1574.310) (-1546.006) -- 0:04:03
211000 -- (-1548.225) (-1551.694) [-1545.579] (-1565.014) * (-1555.608) [-1551.002] (-1564.484) (-1547.689) -- 0:04:03
211500 -- [-1543.429] (-1551.905) (-1565.546) (-1565.116) * [-1548.684] (-1553.073) (-1556.538) (-1570.524) -- 0:04:02
212000 -- (-1550.490) [-1545.186] (-1562.610) (-1550.652) * (-1558.395) (-1553.932) [-1558.053] (-1559.835) -- 0:04:01
212500 -- (-1556.985) (-1550.628) (-1553.596) [-1544.535] * (-1547.667) (-1548.413) (-1564.159) [-1549.463] -- 0:04:00
213000 -- (-1558.197) (-1551.562) [-1565.000] (-1555.610) * (-1562.059) [-1549.568] (-1550.273) (-1554.326) -- 0:04:00
213500 -- (-1550.333) [-1553.439] (-1550.588) (-1557.439) * (-1545.004) (-1558.659) (-1559.817) [-1552.056] -- 0:04:03
214000 -- (-1561.847) [-1549.409] (-1558.363) (-1546.932) * [-1543.930] (-1553.697) (-1564.462) (-1556.702) -- 0:04:02
214500 -- (-1566.203) (-1547.457) [-1550.183] (-1556.184) * (-1547.795) [-1551.124] (-1562.274) (-1547.869) -- 0:04:01
215000 -- (-1552.082) (-1547.197) (-1558.357) [-1547.678] * (-1552.096) (-1552.738) (-1560.266) [-1549.066] -- 0:04:00
Average standard deviation of split frequencies: 0.015433
215500 -- (-1564.673) (-1544.601) [-1542.467] (-1562.326) * (-1555.128) (-1552.173) (-1553.637) [-1556.431] -- 0:04:00
216000 -- (-1550.523) [-1555.240] (-1550.423) (-1576.671) * (-1552.134) [-1550.862] (-1558.444) (-1547.548) -- 0:03:59
216500 -- (-1545.678) [-1550.355] (-1561.587) (-1557.401) * (-1554.938) (-1556.471) [-1548.897] (-1564.976) -- 0:03:58
217000 -- [-1550.974] (-1550.771) (-1571.909) (-1553.599) * (-1547.392) (-1551.328) (-1555.020) [-1552.587] -- 0:04:01
217500 -- [-1548.856] (-1554.729) (-1559.177) (-1547.308) * (-1556.597) (-1549.306) [-1554.099] (-1560.013) -- 0:04:01
218000 -- (-1554.180) [-1548.128] (-1550.223) (-1567.579) * (-1551.980) (-1551.589) (-1547.363) [-1552.280] -- 0:04:00
218500 -- (-1550.068) (-1561.388) (-1557.748) [-1551.849] * [-1555.413] (-1550.315) (-1550.017) (-1553.190) -- 0:03:59
219000 -- (-1556.241) (-1558.177) [-1557.918] (-1549.707) * [-1553.994] (-1548.980) (-1553.397) (-1579.306) -- 0:03:58
219500 -- [-1552.040] (-1546.959) (-1554.174) (-1545.522) * (-1553.111) [-1547.736] (-1576.335) (-1553.677) -- 0:03:58
220000 -- [-1546.129] (-1558.282) (-1561.184) (-1547.189) * (-1549.656) [-1551.376] (-1557.109) (-1555.370) -- 0:03:57
Average standard deviation of split frequencies: 0.015717
220500 -- [-1540.346] (-1560.488) (-1551.855) (-1545.433) * (-1545.022) [-1544.660] (-1570.333) (-1561.094) -- 0:04:00
221000 -- (-1549.492) (-1551.271) (-1551.551) [-1552.576] * (-1545.892) (-1557.549) (-1547.257) [-1550.002] -- 0:03:59
221500 -- (-1562.535) [-1557.123] (-1553.481) (-1550.085) * (-1542.837) (-1555.025) [-1552.279] (-1558.120) -- 0:03:58
222000 -- (-1552.399) (-1563.061) (-1551.281) [-1542.077] * (-1565.888) [-1548.925] (-1556.960) (-1557.751) -- 0:03:58
222500 -- (-1555.456) (-1560.978) (-1558.456) [-1550.095] * (-1556.233) (-1548.897) [-1545.405] (-1543.040) -- 0:03:57
223000 -- (-1551.451) (-1554.711) (-1565.448) [-1555.083] * (-1568.732) [-1544.277] (-1554.695) (-1559.962) -- 0:03:56
223500 -- (-1560.975) (-1552.822) [-1552.847] (-1557.844) * (-1561.776) (-1554.991) (-1552.203) [-1556.142] -- 0:03:59
224000 -- (-1582.498) [-1551.268] (-1557.818) (-1548.606) * (-1563.981) (-1547.920) [-1554.252] (-1554.283) -- 0:03:59
224500 -- [-1555.840] (-1551.068) (-1561.312) (-1553.286) * (-1554.715) [-1554.948] (-1559.920) (-1556.209) -- 0:03:58
225000 -- (-1560.538) (-1545.770) (-1560.194) [-1549.657] * [-1549.547] (-1551.542) (-1564.485) (-1544.980) -- 0:03:57
Average standard deviation of split frequencies: 0.015793
225500 -- (-1555.451) (-1558.741) [-1547.742] (-1552.258) * (-1556.029) (-1553.101) [-1551.622] (-1560.738) -- 0:03:56
226000 -- (-1561.953) [-1556.721] (-1561.138) (-1557.994) * (-1554.561) (-1547.324) (-1554.963) [-1551.445] -- 0:03:56
226500 -- (-1554.524) (-1550.266) (-1569.711) [-1546.608] * (-1566.841) (-1558.255) (-1562.791) [-1549.103] -- 0:03:55
227000 -- (-1559.363) (-1555.219) (-1548.552) [-1552.382] * [-1546.484] (-1553.907) (-1544.332) (-1550.165) -- 0:03:58
227500 -- [-1549.586] (-1567.096) (-1550.142) (-1555.920) * [-1548.349] (-1545.640) (-1552.129) (-1551.000) -- 0:03:57
228000 -- (-1553.438) (-1558.396) (-1556.395) [-1549.951] * (-1553.365) (-1561.478) (-1552.803) [-1547.472] -- 0:03:57
228500 -- [-1553.583] (-1570.044) (-1563.624) (-1559.447) * (-1562.968) (-1549.338) (-1559.168) [-1544.776] -- 0:03:56
229000 -- (-1559.504) (-1562.965) [-1555.266] (-1551.953) * (-1546.807) (-1558.374) (-1556.315) [-1551.456] -- 0:03:55
229500 -- [-1545.266] (-1551.311) (-1549.837) (-1559.169) * (-1555.119) [-1556.459] (-1550.318) (-1547.387) -- 0:03:55
230000 -- [-1549.383] (-1559.488) (-1554.079) (-1558.708) * (-1551.888) (-1555.775) (-1554.401) [-1553.254] -- 0:03:57
Average standard deviation of split frequencies: 0.017371
230500 -- (-1559.307) [-1549.513] (-1552.520) (-1574.320) * [-1545.123] (-1547.890) (-1556.098) (-1554.431) -- 0:03:57
231000 -- (-1559.985) [-1552.891] (-1564.205) (-1557.997) * (-1552.490) [-1550.074] (-1555.119) (-1555.931) -- 0:03:56
231500 -- (-1555.500) [-1552.112] (-1566.244) (-1558.248) * [-1550.518] (-1562.368) (-1558.797) (-1551.158) -- 0:03:55
232000 -- [-1547.630] (-1548.071) (-1568.715) (-1552.338) * (-1559.449) (-1567.546) [-1550.752] (-1556.755) -- 0:03:55
232500 -- (-1544.702) [-1549.293] (-1567.380) (-1551.828) * [-1551.171] (-1554.304) (-1549.928) (-1556.566) -- 0:03:54
233000 -- (-1556.117) (-1560.213) [-1565.447] (-1560.587) * [-1550.620] (-1560.153) (-1553.449) (-1547.189) -- 0:03:53
233500 -- (-1556.749) (-1556.819) [-1550.077] (-1547.316) * (-1549.474) (-1554.359) [-1546.100] (-1551.819) -- 0:03:56
234000 -- [-1541.890] (-1553.714) (-1550.526) (-1553.173) * (-1555.746) (-1552.795) [-1557.209] (-1558.009) -- 0:03:55
234500 -- (-1546.740) (-1559.116) [-1549.904] (-1560.333) * [-1546.539] (-1555.017) (-1555.399) (-1561.365) -- 0:03:55
235000 -- [-1551.062] (-1555.331) (-1566.788) (-1557.415) * [-1555.783] (-1560.480) (-1565.436) (-1560.343) -- 0:03:54
Average standard deviation of split frequencies: 0.016551
235500 -- (-1554.998) [-1552.343] (-1561.124) (-1550.443) * (-1559.806) [-1559.213] (-1551.137) (-1565.816) -- 0:03:53
236000 -- (-1551.205) (-1559.535) [-1558.457] (-1560.607) * (-1572.938) (-1558.642) [-1550.140] (-1554.448) -- 0:03:53
236500 -- (-1552.407) (-1559.428) [-1541.655] (-1564.448) * (-1564.325) (-1567.089) [-1551.723] (-1552.874) -- 0:03:55
237000 -- (-1558.545) (-1565.406) [-1544.269] (-1549.267) * (-1557.888) (-1560.177) (-1552.291) [-1557.214] -- 0:03:55
237500 -- [-1546.417] (-1571.271) (-1548.302) (-1563.388) * (-1566.821) [-1556.162] (-1555.394) (-1546.340) -- 0:03:54
238000 -- [-1552.993] (-1560.261) (-1562.492) (-1553.009) * [-1554.266] (-1550.496) (-1557.434) (-1557.227) -- 0:03:53
238500 -- [-1552.205] (-1560.047) (-1551.855) (-1550.700) * (-1541.338) (-1556.090) [-1552.098] (-1561.292) -- 0:03:53
239000 -- (-1554.883) (-1554.501) [-1558.973] (-1562.971) * (-1559.631) (-1547.067) [-1550.959] (-1554.183) -- 0:03:52
239500 -- [-1545.286] (-1561.605) (-1562.806) (-1551.446) * (-1551.959) [-1546.388] (-1557.911) (-1562.055) -- 0:03:51
240000 -- [-1550.953] (-1570.410) (-1562.778) (-1556.849) * [-1547.228] (-1555.775) (-1546.599) (-1548.730) -- 0:03:54
Average standard deviation of split frequencies: 0.017069
240500 -- [-1549.710] (-1552.605) (-1564.589) (-1553.605) * (-1552.532) (-1568.417) [-1550.387] (-1544.451) -- 0:03:53
241000 -- (-1556.541) [-1550.085] (-1560.950) (-1547.172) * [-1548.853] (-1552.806) (-1561.796) (-1550.465) -- 0:03:53
241500 -- (-1568.060) (-1550.675) [-1545.644] (-1550.246) * (-1561.992) [-1559.293] (-1555.954) (-1547.060) -- 0:03:52
242000 -- (-1560.965) (-1549.319) (-1552.636) [-1555.441] * [-1548.050] (-1565.832) (-1553.535) (-1550.329) -- 0:03:51
242500 -- (-1570.959) (-1547.785) [-1555.790] (-1556.152) * (-1564.152) (-1561.347) (-1560.753) [-1544.476] -- 0:03:51
243000 -- (-1570.646) (-1543.342) (-1548.364) [-1549.729] * [-1551.960] (-1560.193) (-1556.181) (-1553.166) -- 0:03:53
243500 -- (-1548.089) (-1562.018) (-1551.645) [-1552.353] * (-1546.225) (-1560.349) [-1551.257] (-1554.579) -- 0:03:53
244000 -- [-1551.143] (-1545.436) (-1558.871) (-1559.713) * (-1556.202) (-1551.514) [-1550.216] (-1552.424) -- 0:03:52
244500 -- (-1549.310) (-1552.538) (-1560.218) [-1544.523] * [-1556.999] (-1556.148) (-1558.175) (-1568.043) -- 0:03:51
245000 -- (-1549.700) [-1546.434] (-1564.183) (-1546.515) * (-1557.576) (-1556.169) [-1547.179] (-1547.159) -- 0:03:51
Average standard deviation of split frequencies: 0.017110
245500 -- (-1551.356) (-1559.743) (-1555.815) [-1551.033] * (-1552.523) (-1556.046) [-1545.597] (-1556.043) -- 0:03:50
246000 -- [-1548.432] (-1556.076) (-1551.469) (-1558.957) * (-1558.120) (-1549.683) (-1555.039) [-1543.837] -- 0:03:49
246500 -- (-1560.594) [-1555.963] (-1553.237) (-1561.067) * (-1555.340) (-1553.775) (-1553.114) [-1551.210] -- 0:03:52
247000 -- (-1562.001) [-1554.679] (-1567.739) (-1561.022) * [-1549.497] (-1543.190) (-1563.361) (-1549.739) -- 0:03:51
247500 -- (-1552.230) [-1548.593] (-1553.777) (-1555.150) * (-1557.072) (-1573.730) [-1550.060] (-1552.404) -- 0:03:51
248000 -- [-1543.990] (-1547.464) (-1551.930) (-1561.611) * (-1565.532) [-1548.715] (-1550.937) (-1553.643) -- 0:03:50
248500 -- [-1550.370] (-1558.040) (-1558.300) (-1550.739) * (-1558.687) [-1543.744] (-1564.878) (-1560.548) -- 0:03:49
249000 -- (-1555.584) [-1551.503] (-1551.701) (-1569.382) * (-1558.619) [-1550.199] (-1555.528) (-1559.667) -- 0:03:49
249500 -- (-1551.209) [-1548.529] (-1565.158) (-1551.473) * [-1552.404] (-1551.431) (-1555.196) (-1552.191) -- 0:03:51
250000 -- (-1567.992) (-1563.328) (-1555.843) [-1549.005] * [-1541.666] (-1550.001) (-1561.886) (-1550.090) -- 0:03:51
Average standard deviation of split frequencies: 0.018134
250500 -- (-1554.018) [-1554.591] (-1550.919) (-1551.070) * (-1552.862) (-1555.870) [-1547.211] (-1562.985) -- 0:03:50
251000 -- (-1547.278) (-1559.387) [-1558.506] (-1554.009) * [-1547.592] (-1550.335) (-1553.034) (-1550.057) -- 0:03:49
251500 -- (-1555.801) (-1551.360) (-1557.904) [-1547.112] * (-1550.866) [-1548.241] (-1554.473) (-1555.948) -- 0:03:49
252000 -- [-1543.345] (-1545.607) (-1555.396) (-1546.247) * [-1551.649] (-1559.343) (-1553.885) (-1554.927) -- 0:03:48
252500 -- [-1560.842] (-1558.658) (-1554.523) (-1544.909) * [-1555.476] (-1563.625) (-1566.404) (-1559.545) -- 0:03:47
253000 -- (-1554.711) [-1550.977] (-1550.955) (-1556.982) * (-1550.276) [-1551.358] (-1562.324) (-1556.931) -- 0:03:50
253500 -- (-1553.698) (-1564.735) [-1547.197] (-1556.868) * (-1553.233) (-1558.632) [-1546.818] (-1560.010) -- 0:03:49
254000 -- (-1553.711) (-1559.908) [-1548.388] (-1553.832) * [-1545.773] (-1565.525) (-1553.595) (-1560.790) -- 0:03:49
254500 -- [-1549.227] (-1546.050) (-1561.495) (-1549.412) * (-1555.901) [-1545.515] (-1547.676) (-1560.888) -- 0:03:48
255000 -- (-1558.490) (-1554.659) [-1550.950] (-1555.133) * (-1562.418) [-1545.173] (-1558.176) (-1560.763) -- 0:03:47
Average standard deviation of split frequencies: 0.018151
255500 -- (-1551.098) [-1551.549] (-1553.926) (-1564.346) * (-1566.899) (-1545.024) [-1545.402] (-1554.805) -- 0:03:47
256000 -- (-1566.878) [-1555.154] (-1560.951) (-1560.801) * [-1554.762] (-1552.347) (-1551.729) (-1553.895) -- 0:03:49
256500 -- (-1553.367) (-1557.183) (-1556.088) [-1544.306] * (-1565.368) (-1553.739) [-1551.170] (-1551.249) -- 0:03:48
257000 -- [-1555.044] (-1562.357) (-1557.708) (-1553.303) * (-1567.741) (-1564.471) [-1543.469] (-1556.665) -- 0:03:48
257500 -- (-1559.273) (-1559.834) (-1546.037) [-1558.424] * [-1553.110] (-1553.162) (-1557.656) (-1550.249) -- 0:03:47
258000 -- (-1554.969) [-1543.497] (-1555.834) (-1563.439) * (-1548.884) [-1556.386] (-1551.130) (-1547.627) -- 0:03:47
258500 -- (-1550.208) (-1552.358) (-1553.509) [-1546.646] * (-1560.802) (-1549.378) [-1546.577] (-1557.688) -- 0:03:46
259000 -- (-1552.145) (-1551.441) (-1558.092) [-1545.123] * (-1552.132) [-1547.161] (-1550.228) (-1558.958) -- 0:03:46
259500 -- (-1550.265) [-1551.725] (-1556.786) (-1546.912) * (-1554.347) [-1543.776] (-1556.514) (-1554.676) -- 0:03:48
260000 -- (-1552.857) [-1548.596] (-1546.733) (-1550.352) * [-1545.085] (-1546.291) (-1555.351) (-1550.341) -- 0:03:47
Average standard deviation of split frequencies: 0.017568
260500 -- (-1556.901) [-1549.732] (-1548.545) (-1559.806) * [-1549.704] (-1550.166) (-1557.978) (-1554.312) -- 0:03:47
261000 -- (-1546.617) (-1553.533) [-1546.500] (-1557.504) * (-1553.166) (-1552.155) (-1559.355) [-1550.269] -- 0:03:46
261500 -- (-1549.423) (-1569.080) [-1543.377] (-1555.539) * (-1551.902) (-1549.781) [-1552.143] (-1553.031) -- 0:03:45
262000 -- (-1547.511) (-1553.777) (-1547.860) [-1556.508] * (-1558.632) (-1547.290) (-1556.555) [-1557.660] -- 0:03:45
262500 -- [-1557.317] (-1570.397) (-1550.396) (-1555.628) * [-1542.914] (-1560.991) (-1547.311) (-1548.613) -- 0:03:47
263000 -- (-1551.432) (-1555.043) [-1546.799] (-1552.435) * (-1550.440) (-1553.601) [-1554.539] (-1567.541) -- 0:03:46
263500 -- (-1565.054) (-1546.388) [-1543.256] (-1557.964) * (-1567.260) [-1545.084] (-1552.330) (-1555.824) -- 0:03:46
264000 -- (-1554.311) (-1557.568) [-1548.480] (-1550.265) * [-1559.021] (-1558.414) (-1555.577) (-1556.825) -- 0:03:45
264500 -- (-1557.717) (-1555.900) (-1562.753) [-1547.531] * [-1551.699] (-1549.796) (-1561.023) (-1547.595) -- 0:03:45
265000 -- (-1550.947) (-1564.456) (-1552.313) [-1554.171] * [-1550.419] (-1563.925) (-1556.295) (-1565.419) -- 0:03:44
Average standard deviation of split frequencies: 0.017595
265500 -- [-1554.562] (-1553.306) (-1553.857) (-1559.446) * (-1545.358) (-1544.352) (-1556.171) [-1545.596] -- 0:03:44
266000 -- [-1558.721] (-1571.528) (-1558.337) (-1549.248) * (-1567.851) (-1552.720) [-1551.648] (-1549.444) -- 0:03:46
266500 -- (-1546.927) (-1554.709) (-1553.847) [-1550.652] * [-1544.944] (-1549.460) (-1558.305) (-1558.608) -- 0:03:45
267000 -- [-1554.778] (-1555.836) (-1554.793) (-1553.607) * (-1550.567) (-1551.695) [-1546.170] (-1554.759) -- 0:03:45
267500 -- (-1547.218) (-1554.601) [-1552.552] (-1556.263) * [-1546.615] (-1555.823) (-1555.895) (-1554.349) -- 0:03:44
268000 -- (-1547.955) (-1552.544) (-1551.837) [-1556.775] * (-1555.613) (-1556.750) (-1549.346) [-1548.753] -- 0:03:43
268500 -- (-1554.271) (-1564.736) (-1551.146) [-1563.116] * (-1572.492) (-1545.564) [-1547.190] (-1555.113) -- 0:03:43
269000 -- (-1550.605) (-1548.630) [-1547.262] (-1550.706) * (-1557.476) (-1544.997) (-1555.986) [-1550.996] -- 0:03:45
269500 -- (-1566.593) (-1569.657) (-1550.096) [-1547.492] * [-1556.240] (-1550.560) (-1555.363) (-1559.957) -- 0:03:44
270000 -- (-1550.715) (-1558.276) (-1557.484) [-1548.814] * (-1558.827) (-1557.912) (-1558.081) [-1555.041] -- 0:03:44
Average standard deviation of split frequencies: 0.017914
270500 -- (-1555.270) (-1553.411) (-1566.702) [-1549.581] * (-1554.035) (-1560.436) (-1548.331) [-1553.136] -- 0:03:43
271000 -- (-1546.896) (-1573.526) [-1550.600] (-1555.537) * [-1548.987] (-1560.879) (-1553.983) (-1549.509) -- 0:03:43
271500 -- (-1542.398) (-1555.937) [-1549.027] (-1562.498) * (-1560.778) (-1553.487) (-1541.916) [-1559.015] -- 0:03:42
272000 -- (-1555.186) (-1579.659) (-1561.612) [-1546.877] * (-1547.035) (-1555.472) [-1554.066] (-1556.076) -- 0:03:42
272500 -- [-1544.149] (-1555.315) (-1560.967) (-1546.473) * (-1555.911) [-1551.623] (-1550.117) (-1542.351) -- 0:03:44
273000 -- (-1543.374) [-1553.812] (-1547.609) (-1551.810) * (-1549.002) (-1563.780) [-1550.756] (-1550.425) -- 0:03:43
273500 -- (-1545.456) (-1557.044) [-1544.039] (-1555.091) * [-1554.426] (-1551.568) (-1565.223) (-1547.107) -- 0:03:43
274000 -- (-1557.631) (-1558.594) (-1562.321) [-1554.698] * (-1552.366) (-1560.525) [-1559.027] (-1563.523) -- 0:03:42
274500 -- [-1549.091] (-1553.080) (-1549.537) (-1548.294) * [-1555.165] (-1552.298) (-1559.513) (-1569.728) -- 0:03:42
275000 -- [-1545.362] (-1546.708) (-1559.087) (-1564.999) * [-1552.807] (-1559.175) (-1552.757) (-1553.617) -- 0:03:41
Average standard deviation of split frequencies: 0.017446
275500 -- [-1548.929] (-1551.140) (-1562.135) (-1549.698) * (-1551.971) (-1559.686) (-1550.183) [-1545.618] -- 0:03:43
276000 -- [-1553.217] (-1554.212) (-1552.606) (-1552.577) * (-1551.283) [-1551.518] (-1546.097) (-1554.420) -- 0:03:42
276500 -- (-1553.163) [-1550.936] (-1555.452) (-1558.956) * (-1559.921) [-1552.361] (-1555.637) (-1552.491) -- 0:03:42
277000 -- (-1556.083) [-1556.166] (-1557.219) (-1563.060) * (-1550.205) (-1550.144) [-1547.697] (-1548.765) -- 0:03:41
277500 -- (-1551.394) [-1564.489] (-1555.283) (-1549.470) * (-1549.499) (-1554.219) (-1558.350) [-1546.002] -- 0:03:41
278000 -- (-1558.806) [-1553.542] (-1559.297) (-1552.220) * (-1567.495) (-1544.701) [-1552.209] (-1553.491) -- 0:03:40
278500 -- (-1562.795) [-1549.415] (-1558.716) (-1544.025) * (-1555.317) (-1548.581) [-1543.069] (-1576.190) -- 0:03:40
279000 -- (-1547.244) (-1555.129) (-1553.831) [-1545.505] * (-1547.504) [-1552.461] (-1551.125) (-1560.112) -- 0:03:42
279500 -- [-1549.587] (-1555.886) (-1564.930) (-1559.505) * (-1549.756) (-1555.675) (-1554.275) [-1552.097] -- 0:03:41
280000 -- (-1555.681) [-1549.031] (-1556.760) (-1555.304) * (-1556.453) [-1554.677] (-1563.049) (-1563.513) -- 0:03:41
Average standard deviation of split frequencies: 0.016316
280500 -- (-1554.931) (-1555.162) [-1550.800] (-1550.512) * (-1566.234) (-1557.558) [-1548.554] (-1570.137) -- 0:03:40
281000 -- [-1553.744] (-1575.347) (-1553.298) (-1567.416) * (-1560.866) (-1555.294) [-1550.241] (-1558.699) -- 0:03:40
281500 -- (-1552.037) (-1562.468) (-1560.362) [-1545.031] * (-1562.910) (-1551.085) [-1543.994] (-1553.427) -- 0:03:39
282000 -- [-1551.031] (-1547.975) (-1557.582) (-1547.232) * (-1562.918) (-1558.859) [-1545.637] (-1556.541) -- 0:03:41
282500 -- [-1540.027] (-1553.042) (-1551.531) (-1551.228) * [-1547.119] (-1555.596) (-1549.460) (-1561.972) -- 0:03:40
283000 -- [-1542.156] (-1557.167) (-1547.467) (-1557.466) * (-1549.852) (-1556.265) [-1540.591] (-1576.790) -- 0:03:40
283500 -- [-1543.606] (-1555.062) (-1552.696) (-1548.293) * (-1553.944) (-1553.097) [-1547.347] (-1567.893) -- 0:03:39
284000 -- (-1559.757) [-1550.954] (-1547.412) (-1563.697) * (-1552.677) (-1554.962) [-1548.416] (-1551.179) -- 0:03:39
284500 -- (-1560.821) [-1548.018] (-1547.701) (-1551.813) * (-1552.901) (-1580.306) (-1554.104) [-1553.793] -- 0:03:38
285000 -- [-1567.918] (-1553.190) (-1553.901) (-1560.642) * (-1560.707) (-1557.977) (-1549.452) [-1549.465] -- 0:03:38
Average standard deviation of split frequencies: 0.015659
285500 -- [-1560.877] (-1561.133) (-1563.733) (-1569.142) * (-1555.628) (-1553.234) [-1546.924] (-1550.635) -- 0:03:40
286000 -- (-1554.378) [-1544.541] (-1559.086) (-1570.984) * [-1549.084] (-1565.123) (-1566.201) (-1547.639) -- 0:03:39
286500 -- (-1559.396) (-1552.344) (-1556.304) [-1545.964] * (-1549.578) (-1564.421) (-1561.936) [-1544.126] -- 0:03:39
287000 -- (-1561.209) (-1554.197) (-1555.738) [-1545.102] * (-1550.170) (-1551.515) [-1548.853] (-1566.004) -- 0:03:38
287500 -- [-1559.603] (-1553.823) (-1561.407) (-1559.412) * [-1547.502] (-1554.991) (-1552.471) (-1566.366) -- 0:03:38
288000 -- (-1554.983) [-1547.458] (-1553.872) (-1556.286) * [-1547.390] (-1555.543) (-1550.579) (-1553.309) -- 0:03:37
288500 -- [-1555.815] (-1558.625) (-1551.849) (-1565.874) * (-1548.933) (-1561.697) [-1543.138] (-1561.361) -- 0:03:39
289000 -- (-1559.736) (-1548.793) (-1550.978) [-1547.367] * (-1553.051) (-1559.556) (-1551.423) [-1546.327] -- 0:03:38
289500 -- (-1570.622) [-1545.261] (-1546.905) (-1556.850) * (-1547.132) (-1555.191) [-1546.251] (-1556.162) -- 0:03:38
290000 -- (-1563.343) (-1552.790) (-1548.589) [-1548.889] * (-1549.148) (-1557.285) [-1550.209] (-1565.695) -- 0:03:37
Average standard deviation of split frequencies: 0.016102
290500 -- (-1560.910) (-1560.059) [-1545.246] (-1556.599) * (-1555.326) (-1547.510) (-1551.320) [-1543.549] -- 0:03:37
291000 -- (-1562.857) (-1560.677) (-1543.163) [-1545.615] * (-1555.113) (-1551.296) (-1540.716) [-1549.066] -- 0:03:36
291500 -- (-1563.128) (-1556.001) (-1549.970) [-1554.125] * (-1550.599) (-1554.283) [-1562.022] (-1559.984) -- 0:03:36
292000 -- (-1558.392) (-1551.090) (-1545.069) [-1552.422] * (-1569.329) [-1548.371] (-1559.996) (-1550.475) -- 0:03:38
292500 -- [-1558.585] (-1554.224) (-1553.784) (-1557.795) * [-1548.093] (-1554.693) (-1560.622) (-1553.911) -- 0:03:37
293000 -- (-1555.429) [-1544.552] (-1558.779) (-1553.111) * [-1550.137] (-1554.256) (-1556.155) (-1558.998) -- 0:03:37
293500 -- [-1548.558] (-1545.439) (-1556.610) (-1554.961) * [-1552.752] (-1546.658) (-1544.938) (-1561.538) -- 0:03:36
294000 -- (-1560.447) [-1553.531] (-1555.726) (-1559.129) * (-1548.691) (-1546.462) [-1550.096] (-1552.303) -- 0:03:36
294500 -- (-1574.741) (-1549.787) [-1540.758] (-1555.499) * (-1554.022) [-1542.803] (-1560.432) (-1544.444) -- 0:03:35
295000 -- (-1554.669) (-1561.086) (-1552.936) [-1546.206] * (-1564.449) (-1551.164) (-1560.688) [-1544.420] -- 0:03:35
Average standard deviation of split frequencies: 0.015585
295500 -- (-1549.869) (-1557.024) (-1550.703) [-1548.668] * (-1552.478) (-1555.006) [-1550.233] (-1575.203) -- 0:03:36
296000 -- (-1550.856) (-1546.964) [-1548.429] (-1556.071) * (-1553.202) [-1549.603] (-1555.549) (-1553.258) -- 0:03:36
296500 -- (-1564.859) [-1548.835] (-1552.431) (-1558.781) * (-1563.980) [-1554.888] (-1553.602) (-1565.503) -- 0:03:35
297000 -- (-1555.201) (-1556.336) (-1555.903) [-1562.220] * (-1560.300) (-1554.412) (-1548.800) [-1548.046] -- 0:03:35
297500 -- (-1567.833) [-1557.436] (-1552.619) (-1546.187) * [-1558.861] (-1563.388) (-1550.927) (-1559.227) -- 0:03:34
298000 -- [-1551.156] (-1550.441) (-1564.498) (-1561.540) * (-1560.035) [-1548.410] (-1561.345) (-1558.037) -- 0:03:34
298500 -- (-1551.109) (-1564.026) [-1549.661] (-1553.418) * (-1559.922) (-1559.620) [-1551.659] (-1549.277) -- 0:03:36
299000 -- (-1564.680) (-1547.073) [-1548.164] (-1553.863) * (-1559.033) (-1557.493) [-1548.121] (-1545.912) -- 0:03:35
299500 -- [-1548.783] (-1564.427) (-1554.960) (-1562.546) * (-1565.337) [-1548.464] (-1549.697) (-1552.205) -- 0:03:35
300000 -- (-1549.502) [-1547.853] (-1549.952) (-1543.603) * [-1547.072] (-1560.906) (-1554.168) (-1555.522) -- 0:03:34
Average standard deviation of split frequencies: 0.015007
300500 -- [-1551.765] (-1562.029) (-1564.975) (-1556.051) * (-1563.057) (-1554.605) (-1558.005) [-1551.641] -- 0:03:34
301000 -- (-1563.698) [-1541.711] (-1554.913) (-1558.646) * (-1566.918) [-1562.169] (-1552.485) (-1547.469) -- 0:03:33
301500 -- (-1556.164) (-1552.415) [-1556.936] (-1557.787) * (-1547.172) [-1551.982] (-1554.542) (-1555.800) -- 0:03:33
302000 -- (-1567.354) (-1554.294) (-1553.255) [-1547.558] * (-1559.350) [-1548.378] (-1550.708) (-1563.823) -- 0:03:34
302500 -- [-1553.521] (-1552.047) (-1551.371) (-1553.958) * (-1555.230) [-1551.238] (-1559.940) (-1548.357) -- 0:03:34
303000 -- (-1557.569) [-1553.972] (-1551.385) (-1550.156) * (-1545.039) (-1549.869) [-1548.315] (-1562.093) -- 0:03:33
303500 -- (-1551.807) [-1555.649] (-1557.856) (-1550.009) * (-1551.276) [-1554.897] (-1555.406) (-1547.039) -- 0:03:33
304000 -- (-1555.810) (-1552.750) (-1557.385) [-1557.746] * (-1548.882) [-1558.372] (-1570.917) (-1557.199) -- 0:03:32
304500 -- (-1565.582) (-1559.435) (-1559.456) [-1552.215] * [-1554.920] (-1548.363) (-1571.292) (-1551.511) -- 0:03:32
305000 -- (-1562.389) (-1545.376) [-1552.442] (-1559.451) * [-1542.616] (-1557.011) (-1551.387) (-1558.474) -- 0:03:34
Average standard deviation of split frequencies: 0.015625
305500 -- (-1565.856) (-1548.709) [-1540.213] (-1553.333) * (-1548.955) (-1560.216) [-1549.651] (-1565.260) -- 0:03:33
306000 -- (-1569.037) (-1558.186) (-1557.258) [-1547.821] * (-1545.859) (-1562.121) [-1547.992] (-1562.896) -- 0:03:33
306500 -- (-1567.515) (-1551.749) (-1544.614) [-1550.375] * (-1552.313) [-1544.911] (-1550.971) (-1562.657) -- 0:03:32
307000 -- (-1550.989) (-1569.948) (-1559.896) [-1556.358] * (-1545.514) (-1547.399) (-1555.409) [-1557.703] -- 0:03:32
307500 -- (-1556.515) (-1556.532) (-1564.830) [-1549.685] * (-1559.778) [-1558.573] (-1553.043) (-1554.069) -- 0:03:31
308000 -- (-1550.916) [-1555.355] (-1550.438) (-1566.579) * [-1544.286] (-1564.270) (-1547.035) (-1574.033) -- 0:03:31
308500 -- (-1547.618) (-1560.658) [-1545.882] (-1571.111) * [-1546.406] (-1550.482) (-1551.214) (-1565.129) -- 0:03:32
309000 -- [-1558.871] (-1550.819) (-1552.421) (-1561.606) * (-1550.334) [-1547.828] (-1560.191) (-1568.014) -- 0:03:32
309500 -- (-1553.543) (-1559.215) (-1560.307) [-1548.052] * [-1546.057] (-1553.885) (-1554.835) (-1555.717) -- 0:03:31
310000 -- (-1557.730) (-1550.130) (-1550.307) [-1543.620] * (-1555.831) [-1543.438] (-1544.892) (-1569.941) -- 0:03:31
Average standard deviation of split frequencies: 0.015824
310500 -- (-1574.072) (-1560.068) (-1552.420) [-1553.152] * [-1544.986] (-1550.785) (-1547.318) (-1554.370) -- 0:03:30
311000 -- (-1556.164) [-1546.409] (-1559.015) (-1552.155) * [-1544.212] (-1561.035) (-1554.683) (-1548.443) -- 0:03:30
311500 -- (-1552.560) (-1561.106) (-1546.846) [-1545.468] * (-1556.993) [-1550.610] (-1554.362) (-1556.922) -- 0:03:32
312000 -- [-1556.046] (-1554.290) (-1552.682) (-1561.591) * [-1554.725] (-1550.569) (-1552.956) (-1561.123) -- 0:03:31
312500 -- (-1559.329) (-1563.248) [-1549.673] (-1562.418) * (-1560.931) (-1566.474) [-1555.005] (-1560.100) -- 0:03:31
313000 -- [-1550.838] (-1552.840) (-1560.507) (-1561.865) * (-1549.765) (-1557.631) [-1554.504] (-1549.399) -- 0:03:30
313500 -- (-1557.929) (-1558.321) (-1546.442) [-1541.360] * (-1555.013) [-1551.371] (-1552.250) (-1559.409) -- 0:03:30
314000 -- (-1565.166) [-1552.387] (-1547.380) (-1561.776) * [-1548.829] (-1554.397) (-1547.512) (-1560.414) -- 0:03:29
314500 -- (-1556.596) (-1572.786) [-1556.475] (-1546.238) * (-1557.653) (-1559.518) [-1546.781] (-1548.158) -- 0:03:29
315000 -- (-1549.927) [-1554.051] (-1553.249) (-1555.445) * [-1546.822] (-1550.165) (-1564.612) (-1553.202) -- 0:03:30
Average standard deviation of split frequencies: 0.016729
315500 -- (-1545.692) (-1553.654) (-1549.184) [-1554.694] * (-1545.623) (-1558.923) (-1571.461) [-1553.618] -- 0:03:30
316000 -- (-1556.434) (-1558.384) [-1551.483] (-1558.983) * (-1552.881) [-1556.842] (-1564.701) (-1557.392) -- 0:03:29
316500 -- (-1556.956) [-1548.945] (-1561.745) (-1556.950) * (-1545.724) (-1547.115) [-1556.741] (-1559.415) -- 0:03:29
317000 -- (-1566.451) (-1550.641) (-1545.813) [-1552.359] * [-1554.404] (-1542.783) (-1554.570) (-1564.514) -- 0:03:28
317500 -- (-1568.500) (-1557.030) (-1563.578) [-1555.349] * (-1548.267) [-1551.304] (-1556.381) (-1555.155) -- 0:03:28
318000 -- (-1551.086) (-1559.387) (-1550.407) [-1552.980] * [-1546.757] (-1548.169) (-1555.341) (-1557.261) -- 0:03:30
318500 -- (-1552.315) [-1554.694] (-1573.720) (-1547.333) * (-1561.954) (-1548.137) (-1547.576) [-1563.075] -- 0:03:29
319000 -- (-1565.180) (-1555.547) (-1568.366) [-1544.645] * (-1556.173) [-1541.452] (-1548.241) (-1558.706) -- 0:03:29
319500 -- (-1549.105) (-1566.360) [-1551.064] (-1568.028) * (-1566.222) [-1541.012] (-1562.635) (-1557.590) -- 0:03:28
320000 -- (-1557.566) [-1552.549] (-1541.701) (-1564.884) * (-1553.675) (-1550.930) (-1546.495) [-1553.162] -- 0:03:28
Average standard deviation of split frequencies: 0.016276
320500 -- [-1552.884] (-1577.354) (-1548.141) (-1553.451) * (-1556.215) (-1557.513) [-1557.077] (-1551.834) -- 0:03:27
321000 -- (-1557.184) [-1545.192] (-1547.820) (-1557.854) * [-1557.697] (-1558.913) (-1565.844) (-1552.091) -- 0:03:27
321500 -- (-1554.592) [-1542.134] (-1548.705) (-1550.262) * [-1561.116] (-1546.336) (-1559.918) (-1553.758) -- 0:03:28
322000 -- [-1548.313] (-1550.464) (-1547.666) (-1551.192) * (-1558.747) [-1550.506] (-1564.559) (-1555.056) -- 0:03:28
322500 -- (-1564.003) (-1556.901) [-1556.279] (-1569.282) * (-1559.395) [-1556.196] (-1555.154) (-1554.897) -- 0:03:27
323000 -- (-1560.802) (-1556.145) [-1554.209] (-1554.120) * (-1558.186) (-1551.014) (-1559.504) [-1561.546] -- 0:03:27
323500 -- (-1561.178) (-1559.503) (-1560.291) [-1542.142] * (-1557.997) (-1556.080) (-1551.780) [-1556.450] -- 0:03:27
324000 -- (-1556.428) (-1565.335) (-1558.675) [-1555.030] * (-1554.297) (-1544.813) [-1556.975] (-1558.446) -- 0:03:26
324500 -- [-1546.403] (-1561.295) (-1559.459) (-1556.127) * [-1550.339] (-1549.245) (-1560.699) (-1558.267) -- 0:03:28
325000 -- [-1558.749] (-1561.600) (-1553.125) (-1553.513) * (-1557.162) (-1562.498) [-1544.372] (-1576.973) -- 0:03:27
Average standard deviation of split frequencies: 0.016319
325500 -- (-1539.065) (-1566.156) (-1552.912) [-1553.922] * [-1543.700] (-1557.836) (-1554.377) (-1556.409) -- 0:03:27
326000 -- (-1563.426) (-1564.684) (-1569.345) [-1551.158] * [-1542.611] (-1550.759) (-1555.978) (-1552.649) -- 0:03:26
326500 -- (-1555.643) [-1545.968] (-1558.294) (-1559.792) * (-1557.616) (-1555.084) (-1551.464) [-1552.070] -- 0:03:26
327000 -- (-1561.782) (-1558.581) [-1552.122] (-1557.860) * (-1564.922) [-1546.449] (-1552.367) (-1550.172) -- 0:03:25
327500 -- (-1560.899) (-1560.878) [-1552.147] (-1568.639) * (-1572.499) (-1558.824) (-1553.897) [-1552.343] -- 0:03:25
328000 -- (-1555.998) (-1549.514) (-1548.632) [-1543.642] * (-1565.359) [-1546.437] (-1560.299) (-1554.123) -- 0:03:26
328500 -- (-1565.715) [-1545.698] (-1546.437) (-1546.463) * [-1553.950] (-1551.000) (-1549.673) (-1554.788) -- 0:03:26
329000 -- (-1551.650) (-1552.131) (-1548.348) [-1553.551] * [-1551.704] (-1561.433) (-1561.838) (-1554.810) -- 0:03:25
329500 -- (-1554.651) (-1552.034) (-1560.884) [-1547.377] * (-1564.921) (-1558.073) [-1548.547] (-1558.106) -- 0:03:25
330000 -- [-1550.747] (-1554.037) (-1557.231) (-1551.756) * (-1547.250) (-1553.068) [-1557.166] (-1552.279) -- 0:03:25
Average standard deviation of split frequencies: 0.017006
330500 -- (-1558.280) (-1554.490) (-1548.289) [-1549.748] * (-1554.144) [-1555.336] (-1557.128) (-1555.396) -- 0:03:24
331000 -- (-1553.235) [-1544.345] (-1546.165) (-1552.997) * (-1549.007) (-1564.140) [-1549.130] (-1544.743) -- 0:03:24
331500 -- [-1552.928] (-1557.909) (-1546.529) (-1558.108) * (-1556.660) (-1554.805) (-1561.749) [-1552.876] -- 0:03:25
332000 -- (-1558.838) (-1558.706) (-1554.353) [-1558.572] * [-1552.012] (-1556.200) (-1544.767) (-1556.521) -- 0:03:25
332500 -- [-1559.438] (-1550.190) (-1553.032) (-1563.101) * [-1551.152] (-1551.699) (-1557.882) (-1552.685) -- 0:03:24
333000 -- [-1559.609] (-1551.203) (-1557.567) (-1564.843) * (-1555.994) (-1552.161) [-1554.814] (-1568.833) -- 0:03:24
333500 -- (-1556.604) [-1556.961] (-1553.767) (-1559.341) * [-1548.122] (-1579.933) (-1562.108) (-1552.572) -- 0:03:23
334000 -- (-1559.089) [-1551.543] (-1553.408) (-1546.746) * (-1556.159) (-1565.892) (-1549.078) [-1549.026] -- 0:03:23
334500 -- (-1553.412) (-1550.723) (-1550.132) [-1547.598] * (-1558.117) (-1567.222) (-1544.198) [-1549.297] -- 0:03:24
335000 -- [-1556.948] (-1558.875) (-1553.395) (-1557.512) * [-1558.837] (-1560.559) (-1556.286) (-1559.232) -- 0:03:24
Average standard deviation of split frequencies: 0.017537
335500 -- (-1554.035) (-1554.264) (-1547.141) [-1544.301] * (-1555.005) (-1563.555) [-1543.328] (-1553.022) -- 0:03:24
336000 -- (-1553.029) [-1550.056] (-1552.247) (-1555.539) * (-1555.080) (-1552.798) [-1549.647] (-1549.658) -- 0:03:23
336500 -- [-1544.344] (-1557.866) (-1553.624) (-1558.976) * (-1557.657) (-1568.952) [-1546.701] (-1554.152) -- 0:03:23
337000 -- (-1562.515) [-1553.445] (-1551.626) (-1555.789) * (-1547.713) [-1554.916] (-1566.903) (-1560.248) -- 0:03:22
337500 -- (-1548.391) [-1547.774] (-1552.973) (-1552.880) * [-1553.726] (-1564.583) (-1546.648) (-1561.687) -- 0:03:22
338000 -- (-1551.241) (-1553.204) [-1543.008] (-1550.750) * [-1543.270] (-1557.885) (-1545.795) (-1554.671) -- 0:03:23
338500 -- (-1554.346) (-1546.073) [-1554.036] (-1563.869) * (-1557.327) (-1549.964) (-1559.513) [-1549.854] -- 0:03:23
339000 -- [-1552.049] (-1549.624) (-1566.050) (-1556.360) * (-1546.543) [-1550.963] (-1547.076) (-1552.135) -- 0:03:22
339500 -- [-1551.661] (-1564.909) (-1562.825) (-1551.141) * (-1556.580) [-1555.028] (-1558.173) (-1549.553) -- 0:03:22
340000 -- (-1564.440) [-1561.337] (-1548.693) (-1557.980) * (-1560.962) (-1559.428) [-1555.019] (-1549.735) -- 0:03:21
Average standard deviation of split frequencies: 0.016803
340500 -- [-1547.580] (-1561.904) (-1555.428) (-1553.961) * (-1564.861) (-1550.678) [-1545.535] (-1552.723) -- 0:03:21
341000 -- [-1549.155] (-1560.999) (-1564.510) (-1547.441) * (-1559.172) (-1561.377) [-1549.166] (-1543.606) -- 0:03:22
341500 -- [-1547.111] (-1562.722) (-1561.444) (-1566.389) * (-1553.036) [-1559.647] (-1546.625) (-1560.736) -- 0:03:22
342000 -- [-1551.370] (-1557.549) (-1560.333) (-1546.021) * [-1552.957] (-1548.892) (-1553.841) (-1563.139) -- 0:03:22
342500 -- (-1548.945) [-1550.696] (-1561.380) (-1555.892) * (-1557.536) (-1559.863) [-1549.520] (-1551.238) -- 0:03:21
343000 -- (-1544.777) (-1558.889) [-1547.914] (-1549.319) * (-1544.397) [-1549.055] (-1558.050) (-1551.817) -- 0:03:21
343500 -- (-1558.298) (-1559.319) [-1545.251] (-1549.282) * (-1546.817) [-1552.026] (-1570.757) (-1561.771) -- 0:03:20
344000 -- [-1552.352] (-1565.019) (-1558.853) (-1545.397) * (-1554.093) (-1568.405) (-1560.329) [-1557.226] -- 0:03:20
344500 -- (-1550.961) (-1547.214) [-1563.849] (-1556.807) * [-1561.628] (-1556.851) (-1562.045) (-1548.226) -- 0:03:21
345000 -- (-1553.746) (-1545.458) [-1557.447] (-1552.979) * (-1552.261) (-1558.058) [-1550.343] (-1565.304) -- 0:03:21
Average standard deviation of split frequencies: 0.016349
345500 -- (-1564.471) (-1553.629) (-1566.416) [-1551.873] * [-1556.323] (-1545.946) (-1559.339) (-1562.274) -- 0:03:20
346000 -- (-1552.377) (-1555.096) [-1550.697] (-1549.787) * (-1552.177) [-1548.054] (-1580.897) (-1551.986) -- 0:03:20
346500 -- [-1547.526] (-1555.373) (-1553.291) (-1559.770) * (-1559.819) (-1551.903) (-1556.682) [-1542.855] -- 0:03:19
347000 -- [-1551.144] (-1555.366) (-1558.918) (-1560.866) * [-1552.636] (-1549.463) (-1550.347) (-1567.974) -- 0:03:19
347500 -- (-1553.748) (-1564.366) (-1549.464) [-1551.347] * (-1560.670) (-1563.087) [-1545.754] (-1570.321) -- 0:03:20
348000 -- (-1558.136) (-1562.870) (-1549.341) [-1544.479] * (-1557.875) [-1541.932] (-1564.335) (-1557.175) -- 0:03:20
348500 -- (-1567.623) (-1567.775) [-1549.597] (-1549.084) * (-1555.901) [-1549.070] (-1547.398) (-1553.574) -- 0:03:20
349000 -- [-1548.467] (-1554.930) (-1553.916) (-1562.832) * (-1555.916) [-1549.136] (-1547.134) (-1563.197) -- 0:03:19
349500 -- [-1549.957] (-1549.045) (-1548.870) (-1551.923) * (-1550.617) (-1549.632) [-1544.008] (-1559.170) -- 0:03:19
350000 -- [-1545.911] (-1561.137) (-1557.800) (-1554.296) * (-1553.214) [-1553.013] (-1549.186) (-1566.779) -- 0:03:18
Average standard deviation of split frequencies: 0.015171
350500 -- [-1545.401] (-1546.463) (-1554.530) (-1559.787) * (-1560.077) [-1548.036] (-1547.008) (-1554.435) -- 0:03:18
351000 -- [-1544.505] (-1546.702) (-1542.502) (-1551.877) * (-1563.800) [-1551.494] (-1545.591) (-1558.528) -- 0:03:19
351500 -- (-1546.798) (-1552.886) [-1546.863] (-1557.660) * [-1546.354] (-1561.649) (-1558.519) (-1553.279) -- 0:03:19
352000 -- (-1542.754) [-1550.105] (-1562.594) (-1569.461) * (-1564.531) [-1548.955] (-1543.992) (-1557.304) -- 0:03:18
352500 -- (-1549.692) (-1572.704) [-1551.984] (-1579.834) * (-1552.401) (-1553.068) [-1550.345] (-1552.288) -- 0:03:18
353000 -- (-1557.162) (-1550.833) [-1547.760] (-1564.926) * (-1550.288) (-1554.445) (-1555.052) [-1558.399] -- 0:03:17
353500 -- (-1556.703) (-1558.452) [-1547.847] (-1552.651) * (-1553.065) (-1572.279) [-1551.737] (-1557.796) -- 0:03:17
354000 -- [-1550.467] (-1545.226) (-1567.425) (-1555.200) * (-1553.087) (-1546.728) [-1545.589] (-1553.089) -- 0:03:18
354500 -- [-1550.433] (-1577.081) (-1556.745) (-1562.104) * (-1554.240) (-1557.012) [-1549.550] (-1554.744) -- 0:03:18
355000 -- (-1551.142) [-1551.012] (-1561.255) (-1552.838) * [-1558.271] (-1564.365) (-1546.417) (-1558.307) -- 0:03:18
Average standard deviation of split frequencies: 0.013998
355500 -- (-1544.749) [-1550.798] (-1558.893) (-1570.551) * (-1555.048) (-1548.586) (-1559.364) [-1545.558] -- 0:03:17
356000 -- (-1556.955) (-1548.830) (-1572.085) [-1561.059] * (-1556.425) (-1558.619) (-1551.210) [-1556.052] -- 0:03:17
356500 -- (-1554.855) (-1550.300) [-1555.996] (-1550.177) * [-1543.660] (-1562.334) (-1547.716) (-1560.636) -- 0:03:16
357000 -- (-1551.521) (-1550.872) (-1557.783) [-1557.537] * [-1557.056] (-1567.996) (-1548.346) (-1546.867) -- 0:03:16
357500 -- (-1567.592) [-1551.538] (-1551.376) (-1553.631) * [-1554.224] (-1568.504) (-1555.561) (-1551.292) -- 0:03:17
358000 -- [-1548.396] (-1552.239) (-1553.490) (-1555.384) * [-1545.070] (-1551.282) (-1547.303) (-1547.227) -- 0:03:17
358500 -- (-1564.675) (-1560.233) (-1549.262) [-1561.300] * [-1550.075] (-1568.449) (-1552.355) (-1552.841) -- 0:03:16
359000 -- (-1560.343) (-1557.686) [-1558.211] (-1568.312) * (-1556.384) (-1558.138) [-1554.864] (-1552.525) -- 0:03:16
359500 -- (-1547.187) (-1554.086) (-1557.341) [-1549.772] * (-1549.509) (-1564.779) (-1556.728) [-1558.553] -- 0:03:15
360000 -- (-1546.564) (-1562.851) (-1564.887) [-1558.011] * (-1555.806) (-1560.529) (-1559.479) [-1541.129] -- 0:03:15
Average standard deviation of split frequencies: 0.014377
360500 -- (-1558.157) (-1574.477) [-1556.987] (-1558.005) * [-1549.159] (-1564.247) (-1555.133) (-1544.294) -- 0:03:16
361000 -- (-1562.930) (-1542.672) [-1545.591] (-1553.552) * (-1545.737) (-1556.235) [-1554.723] (-1568.218) -- 0:03:16
361500 -- (-1550.177) [-1543.997] (-1556.730) (-1558.048) * (-1550.626) (-1547.564) [-1548.371] (-1554.646) -- 0:03:16
362000 -- (-1549.419) [-1545.967] (-1564.801) (-1561.475) * (-1552.783) (-1585.715) (-1543.109) [-1547.001] -- 0:03:15
362500 -- (-1549.340) (-1547.739) (-1561.773) [-1550.576] * (-1558.931) (-1562.305) (-1555.539) [-1556.313] -- 0:03:15
363000 -- (-1552.471) (-1548.661) [-1549.842] (-1555.942) * (-1550.836) (-1555.724) (-1552.174) [-1545.797] -- 0:03:14
363500 -- (-1553.272) (-1551.480) (-1563.099) [-1553.341] * [-1546.991] (-1566.343) (-1545.708) (-1555.496) -- 0:03:14
364000 -- (-1558.660) [-1542.438] (-1545.939) (-1550.769) * (-1560.212) (-1557.003) [-1550.615] (-1559.642) -- 0:03:15
364500 -- (-1555.921) [-1548.018] (-1552.132) (-1550.741) * [-1553.665] (-1551.349) (-1559.429) (-1555.231) -- 0:03:15
365000 -- (-1555.415) [-1550.718] (-1551.341) (-1560.402) * [-1551.389] (-1546.453) (-1556.034) (-1551.631) -- 0:03:14
Average standard deviation of split frequencies: 0.013800
365500 -- (-1550.089) (-1551.904) (-1551.507) [-1555.644] * (-1554.989) (-1560.924) [-1553.731] (-1547.408) -- 0:03:14
366000 -- (-1550.604) (-1555.784) [-1550.050] (-1565.352) * (-1553.502) [-1546.967] (-1553.410) (-1555.097) -- 0:03:14
366500 -- [-1548.973] (-1557.461) (-1564.185) (-1562.825) * (-1546.926) (-1547.297) (-1557.643) [-1547.095] -- 0:03:13
367000 -- (-1559.076) (-1549.556) [-1550.198] (-1562.610) * (-1557.778) (-1555.154) (-1551.225) [-1544.286] -- 0:03:14
367500 -- (-1551.785) [-1546.920] (-1550.022) (-1550.381) * (-1546.460) (-1570.102) [-1552.675] (-1549.660) -- 0:03:14
368000 -- (-1553.265) [-1553.466] (-1551.681) (-1549.066) * (-1554.370) (-1561.658) (-1557.476) [-1549.420] -- 0:03:14
368500 -- (-1553.343) (-1551.274) (-1549.005) [-1546.913] * (-1558.486) (-1551.564) [-1546.006] (-1554.793) -- 0:03:13
369000 -- (-1549.074) [-1554.838] (-1553.956) (-1560.010) * (-1558.501) [-1545.956] (-1559.972) (-1562.046) -- 0:03:13
369500 -- [-1548.479] (-1562.394) (-1551.169) (-1553.455) * (-1559.382) (-1553.357) [-1554.340] (-1554.644) -- 0:03:12
370000 -- [-1553.824] (-1559.513) (-1558.487) (-1548.252) * (-1567.947) (-1549.859) (-1553.344) [-1550.086] -- 0:03:12
Average standard deviation of split frequencies: 0.014171
370500 -- (-1552.465) (-1552.690) (-1561.078) [-1548.261] * (-1568.299) (-1558.198) [-1550.906] (-1556.937) -- 0:03:13
371000 -- (-1551.163) (-1551.577) (-1558.250) [-1549.526] * (-1546.027) (-1559.395) [-1549.898] (-1553.933) -- 0:03:13
371500 -- (-1570.184) [-1548.435] (-1551.413) (-1553.851) * (-1548.021) (-1552.269) (-1555.063) [-1551.423] -- 0:03:12
372000 -- (-1560.684) [-1552.933] (-1563.907) (-1544.517) * [-1549.215] (-1561.544) (-1552.902) (-1548.567) -- 0:03:12
372500 -- (-1549.932) (-1548.264) [-1550.044] (-1548.726) * (-1551.464) [-1551.819] (-1558.333) (-1554.462) -- 0:03:12
373000 -- (-1560.061) [-1547.737] (-1555.911) (-1552.032) * (-1566.920) [-1558.272] (-1558.928) (-1559.112) -- 0:03:11
373500 -- (-1551.161) (-1550.802) [-1550.753] (-1550.529) * (-1553.623) (-1554.017) (-1551.046) [-1556.919] -- 0:03:12
374000 -- (-1570.748) [-1549.766] (-1552.110) (-1554.986) * (-1564.742) [-1549.721] (-1559.660) (-1551.097) -- 0:03:12
374500 -- (-1565.014) (-1556.366) (-1550.385) [-1543.106] * [-1552.523] (-1568.160) (-1549.940) (-1556.724) -- 0:03:12
375000 -- (-1549.087) (-1548.057) (-1552.218) [-1547.327] * (-1556.943) (-1545.930) [-1552.502] (-1545.766) -- 0:03:11
Average standard deviation of split frequencies: 0.013254
375500 -- [-1550.475] (-1549.047) (-1556.098) (-1565.266) * [-1546.696] (-1556.303) (-1543.231) (-1553.000) -- 0:03:11
376000 -- (-1552.509) (-1553.772) (-1560.886) [-1558.279] * (-1545.634) (-1554.005) [-1557.529] (-1553.589) -- 0:03:10
376500 -- [-1553.982] (-1554.855) (-1552.889) (-1557.837) * (-1557.669) [-1560.430] (-1563.790) (-1555.842) -- 0:03:10
377000 -- (-1548.789) [-1544.021] (-1562.220) (-1552.846) * (-1553.875) (-1561.386) (-1553.177) [-1551.688] -- 0:03:11
377500 -- (-1550.593) (-1553.290) (-1564.953) [-1550.962] * (-1562.164) (-1545.641) (-1561.110) [-1550.879] -- 0:03:11
378000 -- [-1553.078] (-1554.120) (-1551.174) (-1554.848) * (-1557.741) (-1542.591) (-1552.152) [-1550.259] -- 0:03:10
378500 -- (-1559.280) [-1553.882] (-1550.503) (-1554.669) * (-1547.326) (-1553.573) [-1557.219] (-1553.085) -- 0:03:10
379000 -- (-1553.209) (-1543.868) [-1545.446] (-1550.624) * (-1557.908) (-1568.027) [-1554.432] (-1551.897) -- 0:03:10
379500 -- (-1559.311) (-1550.223) (-1547.937) [-1548.860] * (-1559.808) (-1548.297) (-1559.464) [-1555.022] -- 0:03:09
380000 -- (-1550.147) (-1556.702) (-1560.274) [-1556.759] * (-1554.295) [-1541.589] (-1556.375) (-1549.216) -- 0:03:10
Average standard deviation of split frequencies: 0.013799
380500 -- (-1552.173) [-1544.883] (-1559.670) (-1563.074) * (-1555.369) (-1551.289) (-1576.949) [-1547.865] -- 0:03:10
381000 -- (-1555.325) (-1554.423) [-1550.564] (-1556.223) * (-1561.330) [-1547.018] (-1544.267) (-1548.863) -- 0:03:10
381500 -- (-1552.044) (-1565.755) (-1550.195) [-1556.861] * (-1542.876) (-1558.369) [-1550.056] (-1557.615) -- 0:03:09
382000 -- (-1554.769) (-1560.380) [-1550.108] (-1550.777) * (-1555.702) [-1541.920] (-1566.488) (-1562.458) -- 0:03:09
382500 -- (-1549.166) (-1554.217) (-1556.387) [-1553.559] * (-1553.602) (-1546.501) [-1546.943] (-1561.360) -- 0:03:08
383000 -- (-1551.254) [-1547.076] (-1544.681) (-1561.619) * [-1547.480] (-1555.062) (-1561.873) (-1558.864) -- 0:03:08
383500 -- [-1552.703] (-1557.118) (-1556.560) (-1551.029) * (-1557.794) (-1554.494) (-1555.846) [-1548.442] -- 0:03:09
384000 -- (-1571.274) (-1546.833) [-1553.987] (-1559.190) * (-1558.145) [-1546.228] (-1566.871) (-1555.582) -- 0:03:09
384500 -- (-1566.158) [-1541.414] (-1558.204) (-1550.146) * [-1545.646] (-1554.151) (-1550.732) (-1549.389) -- 0:03:08
385000 -- [-1554.248] (-1557.863) (-1552.155) (-1553.780) * (-1560.107) [-1548.279] (-1556.476) (-1555.753) -- 0:03:08
Average standard deviation of split frequencies: 0.013347
385500 -- [-1554.121] (-1551.434) (-1556.988) (-1560.970) * (-1562.777) [-1548.068] (-1558.348) (-1549.402) -- 0:03:08
386000 -- [-1552.021] (-1545.045) (-1557.737) (-1558.263) * (-1568.923) [-1554.817] (-1557.380) (-1567.304) -- 0:03:07
386500 -- (-1552.869) [-1550.779] (-1555.329) (-1554.532) * (-1552.878) (-1565.296) (-1548.729) [-1556.538] -- 0:03:07
387000 -- (-1552.246) (-1548.612) (-1558.989) [-1550.294] * (-1547.477) [-1545.757] (-1567.101) (-1546.435) -- 0:03:08
387500 -- (-1551.043) (-1549.232) [-1549.596] (-1540.153) * [-1552.081] (-1542.585) (-1546.795) (-1556.675) -- 0:03:08
388000 -- (-1551.039) (-1553.970) [-1551.501] (-1547.624) * (-1564.101) [-1549.023] (-1558.978) (-1553.314) -- 0:03:07
388500 -- (-1552.764) (-1558.899) [-1549.219] (-1557.405) * (-1549.825) [-1548.864] (-1542.675) (-1559.333) -- 0:03:07
389000 -- (-1564.788) (-1551.151) [-1551.725] (-1546.653) * (-1561.104) (-1553.710) (-1557.058) [-1550.035] -- 0:03:06
389500 -- [-1552.034] (-1547.674) (-1556.847) (-1556.270) * (-1552.840) (-1553.545) (-1543.960) [-1549.651] -- 0:03:06
390000 -- (-1551.455) [-1547.310] (-1553.283) (-1553.963) * (-1562.549) (-1547.935) (-1553.549) [-1546.004] -- 0:03:07
Average standard deviation of split frequencies: 0.012929
390500 -- (-1559.033) (-1550.630) [-1547.641] (-1554.094) * (-1546.887) (-1553.742) (-1558.101) [-1551.495] -- 0:03:07
391000 -- (-1580.397) [-1551.804] (-1548.327) (-1567.021) * [-1551.916] (-1564.591) (-1559.876) (-1554.450) -- 0:03:06
391500 -- (-1553.998) (-1560.553) [-1547.315] (-1557.788) * (-1553.558) [-1541.307] (-1572.570) (-1554.367) -- 0:03:06
392000 -- [-1544.206] (-1549.805) (-1570.678) (-1564.216) * (-1563.191) [-1554.975] (-1557.880) (-1543.445) -- 0:03:06
392500 -- (-1557.121) [-1551.639] (-1567.449) (-1561.779) * (-1560.301) [-1552.989] (-1550.996) (-1556.180) -- 0:03:05
393000 -- (-1555.874) [-1562.375] (-1571.815) (-1552.396) * (-1558.738) (-1548.256) [-1559.581] (-1566.344) -- 0:03:05
393500 -- (-1553.734) (-1549.236) (-1565.895) [-1555.238] * (-1553.896) (-1551.056) [-1545.318] (-1552.049) -- 0:03:06
394000 -- (-1573.810) (-1560.752) (-1568.298) [-1542.513] * (-1565.429) (-1551.666) [-1552.738] (-1558.904) -- 0:03:06
394500 -- (-1554.807) [-1557.947] (-1554.373) (-1545.723) * (-1550.815) [-1552.133] (-1551.132) (-1554.779) -- 0:03:05
395000 -- [-1548.316] (-1550.676) (-1549.622) (-1549.699) * (-1560.868) [-1549.492] (-1559.816) (-1548.999) -- 0:03:05
Average standard deviation of split frequencies: 0.011904
395500 -- (-1544.505) [-1549.104] (-1556.238) (-1559.659) * (-1556.395) (-1547.629) [-1545.875] (-1551.374) -- 0:03:04
396000 -- (-1546.465) [-1555.811] (-1558.129) (-1558.628) * (-1546.912) [-1550.755] (-1560.203) (-1556.379) -- 0:03:04
396500 -- (-1548.447) (-1554.709) (-1554.456) [-1554.952] * (-1545.949) (-1546.813) [-1541.832] (-1556.688) -- 0:03:05
397000 -- (-1544.872) (-1558.325) (-1558.286) [-1545.389] * [-1557.474] (-1563.471) (-1559.063) (-1569.080) -- 0:03:05
397500 -- [-1543.101] (-1542.587) (-1564.129) (-1551.182) * (-1548.629) [-1546.918] (-1547.923) (-1551.418) -- 0:03:04
398000 -- (-1549.216) [-1551.474] (-1563.174) (-1553.114) * [-1558.432] (-1551.727) (-1554.458) (-1551.641) -- 0:03:04
398500 -- [-1546.388] (-1555.810) (-1550.430) (-1551.036) * (-1551.657) (-1548.030) (-1544.267) [-1550.531] -- 0:03:04
399000 -- (-1549.787) (-1559.124) [-1546.027] (-1561.558) * (-1553.607) [-1553.164] (-1551.399) (-1547.439) -- 0:03:03
399500 -- [-1547.876] (-1573.884) (-1563.026) (-1544.191) * (-1550.407) [-1542.564] (-1553.958) (-1561.821) -- 0:03:03
400000 -- [-1553.825] (-1562.336) (-1540.789) (-1552.959) * (-1556.094) (-1559.958) [-1555.154] (-1557.422) -- 0:03:04
Average standard deviation of split frequencies: 0.011681
400500 -- (-1545.868) (-1548.377) [-1551.270] (-1558.023) * (-1559.835) (-1550.848) (-1574.581) [-1545.722] -- 0:03:04
401000 -- (-1551.019) (-1556.226) (-1550.799) [-1547.110] * (-1563.014) (-1548.503) (-1565.529) [-1546.141] -- 0:03:03
401500 -- (-1560.353) [-1556.536] (-1557.181) (-1554.404) * [-1558.346] (-1566.651) (-1560.128) (-1550.214) -- 0:03:03
402000 -- (-1559.179) [-1551.339] (-1548.788) (-1560.555) * (-1559.416) (-1553.241) (-1557.021) [-1551.862] -- 0:03:02
402500 -- (-1566.749) (-1552.032) (-1556.955) [-1549.264] * (-1554.032) [-1554.126] (-1542.734) (-1565.991) -- 0:03:02
403000 -- (-1561.985) [-1548.182] (-1554.945) (-1555.461) * (-1544.527) [-1546.805] (-1553.343) (-1567.481) -- 0:03:02
403500 -- (-1563.540) (-1548.028) [-1555.899] (-1561.770) * (-1550.173) (-1551.211) [-1559.821] (-1552.992) -- 0:03:03
404000 -- (-1552.617) (-1547.561) [-1545.858] (-1552.954) * (-1563.193) (-1551.782) (-1554.582) [-1544.433] -- 0:03:02
404500 -- (-1551.321) (-1549.775) (-1549.031) [-1545.662] * [-1548.520] (-1552.183) (-1558.098) (-1563.315) -- 0:03:02
405000 -- (-1554.080) [-1548.808] (-1549.557) (-1550.910) * (-1553.373) (-1555.252) [-1548.577] (-1579.563) -- 0:03:02
Average standard deviation of split frequencies: 0.010616
405500 -- [-1550.145] (-1558.426) (-1553.199) (-1558.984) * (-1553.904) [-1547.629] (-1558.012) (-1558.928) -- 0:03:01
406000 -- (-1559.910) (-1553.486) [-1551.374] (-1562.116) * [-1552.140] (-1560.758) (-1557.693) (-1544.516) -- 0:03:01
406500 -- (-1560.451) (-1554.477) [-1556.503] (-1554.837) * (-1558.017) (-1566.068) (-1551.738) [-1549.049] -- 0:03:02
407000 -- (-1552.746) (-1561.897) (-1549.276) [-1545.841] * (-1552.106) [-1554.991] (-1556.641) (-1554.405) -- 0:03:02
407500 -- [-1555.156] (-1562.700) (-1554.890) (-1563.656) * (-1546.097) [-1551.012] (-1550.880) (-1559.171) -- 0:03:01
408000 -- (-1547.763) (-1562.790) (-1554.209) [-1552.034] * (-1551.540) [-1561.126] (-1549.552) (-1555.411) -- 0:03:01
408500 -- [-1547.433] (-1559.033) (-1563.406) (-1555.656) * (-1556.940) (-1554.611) [-1540.771] (-1556.270) -- 0:03:00
409000 -- (-1562.032) (-1550.836) [-1549.972] (-1573.836) * (-1556.635) (-1554.445) (-1574.662) [-1550.071] -- 0:03:00
409500 -- (-1556.675) (-1560.881) [-1554.794] (-1554.736) * (-1553.911) (-1556.882) [-1549.459] (-1566.521) -- 0:03:00
410000 -- (-1548.414) (-1558.040) (-1558.037) [-1551.048] * (-1554.975) [-1549.514] (-1555.394) (-1558.858) -- 0:03:01
Average standard deviation of split frequencies: 0.008937
410500 -- (-1545.035) (-1559.495) (-1564.018) [-1548.170] * (-1562.368) [-1563.299] (-1554.900) (-1561.675) -- 0:03:00
411000 -- (-1559.994) [-1547.819] (-1556.736) (-1553.211) * (-1554.905) (-1560.123) [-1549.734] (-1550.692) -- 0:03:00
411500 -- (-1556.117) (-1550.569) [-1561.557] (-1561.917) * (-1556.808) [-1559.407] (-1557.713) (-1550.205) -- 0:03:00
412000 -- (-1555.027) (-1557.506) (-1562.803) [-1556.577] * (-1554.212) (-1562.388) [-1550.190] (-1567.086) -- 0:02:59
412500 -- (-1557.948) (-1554.574) (-1548.163) [-1547.330] * [-1551.422] (-1552.413) (-1552.430) (-1552.297) -- 0:02:59
413000 -- (-1563.467) (-1553.849) (-1558.793) [-1549.682] * [-1559.239] (-1552.793) (-1550.450) (-1552.570) -- 0:03:00
413500 -- (-1560.028) [-1548.339] (-1553.192) (-1564.564) * (-1551.514) (-1552.187) (-1556.896) [-1555.598] -- 0:03:00
414000 -- [-1547.183] (-1547.673) (-1549.237) (-1549.250) * (-1553.507) (-1554.585) (-1549.968) [-1552.315] -- 0:02:59
414500 -- (-1546.831) (-1548.955) (-1554.937) [-1554.429] * [-1553.288] (-1558.284) (-1552.236) (-1555.244) -- 0:02:59
415000 -- [-1553.506] (-1548.007) (-1564.419) (-1558.952) * (-1546.771) (-1559.889) [-1550.362] (-1561.287) -- 0:02:59
Average standard deviation of split frequencies: 0.009227
415500 -- (-1551.282) (-1547.682) (-1552.544) [-1553.090] * (-1556.907) (-1547.151) [-1550.624] (-1555.852) -- 0:02:58
416000 -- (-1546.678) [-1550.793] (-1555.606) (-1545.404) * (-1548.861) (-1555.516) (-1545.713) [-1562.305] -- 0:02:58
416500 -- (-1548.065) [-1545.850] (-1554.357) (-1546.127) * (-1548.805) [-1544.311] (-1553.725) (-1549.336) -- 0:02:59
417000 -- (-1557.615) (-1544.104) (-1566.222) [-1549.959] * (-1551.562) [-1557.491] (-1562.470) (-1551.727) -- 0:02:58
417500 -- [-1551.789] (-1562.458) (-1551.310) (-1549.158) * (-1554.510) (-1561.350) (-1562.508) [-1548.417] -- 0:02:58
418000 -- (-1561.472) [-1550.217] (-1549.145) (-1552.773) * [-1548.547] (-1575.870) (-1554.452) (-1547.984) -- 0:02:58
418500 -- (-1551.890) (-1552.370) (-1554.471) [-1549.989] * [-1543.341] (-1562.581) (-1562.924) (-1548.998) -- 0:02:57
419000 -- (-1555.286) (-1557.322) [-1550.689] (-1549.927) * (-1550.799) (-1554.944) [-1561.793] (-1550.419) -- 0:02:57
419500 -- (-1560.248) [-1555.242] (-1551.667) (-1560.535) * (-1550.176) (-1549.444) (-1552.903) [-1547.633] -- 0:02:58
420000 -- (-1550.190) (-1562.552) [-1546.063] (-1569.791) * (-1557.400) (-1561.800) (-1555.153) [-1542.561] -- 0:02:58
Average standard deviation of split frequencies: 0.009925
420500 -- [-1547.505] (-1546.667) (-1546.292) (-1556.988) * (-1558.864) (-1555.143) [-1549.048] (-1546.062) -- 0:02:57
421000 -- (-1552.459) (-1547.840) [-1549.937] (-1555.313) * (-1552.041) (-1552.008) [-1549.985] (-1547.773) -- 0:02:57
421500 -- (-1551.916) (-1555.915) (-1555.221) [-1555.468] * (-1551.450) [-1551.374] (-1553.909) (-1545.427) -- 0:02:57
422000 -- (-1551.702) (-1550.541) (-1549.868) [-1553.577] * (-1551.594) (-1579.262) [-1548.671] (-1557.732) -- 0:02:56
422500 -- [-1547.563] (-1567.031) (-1559.564) (-1550.880) * [-1542.121] (-1559.045) (-1552.516) (-1544.104) -- 0:02:56
423000 -- (-1550.861) (-1548.590) (-1549.852) [-1546.878] * [-1551.099] (-1565.234) (-1559.664) (-1548.803) -- 0:02:57
423500 -- [-1544.976] (-1555.044) (-1547.578) (-1547.763) * (-1548.451) (-1556.201) (-1561.175) [-1550.756] -- 0:02:56
424000 -- [-1546.157] (-1565.845) (-1549.389) (-1548.460) * (-1553.682) [-1542.156] (-1564.366) (-1551.042) -- 0:02:56
424500 -- (-1561.619) (-1553.518) [-1553.224] (-1566.250) * [-1546.474] (-1548.115) (-1566.062) (-1553.484) -- 0:02:56
425000 -- (-1563.137) [-1556.198] (-1554.196) (-1552.341) * (-1560.750) [-1557.197] (-1564.409) (-1572.321) -- 0:02:55
Average standard deviation of split frequencies: 0.010513
425500 -- (-1550.594) (-1553.696) (-1550.253) [-1550.524] * (-1565.158) [-1545.442] (-1552.456) (-1553.727) -- 0:02:55
426000 -- (-1552.577) (-1570.205) (-1560.680) [-1549.634] * [-1553.575] (-1552.172) (-1565.238) (-1551.254) -- 0:02:56
426500 -- (-1574.101) (-1548.008) (-1555.430) [-1551.873] * (-1557.278) (-1554.687) (-1554.454) [-1547.083] -- 0:02:56
427000 -- (-1557.095) (-1564.435) (-1564.319) [-1558.637] * [-1554.992] (-1557.750) (-1557.986) (-1549.356) -- 0:02:55
427500 -- [-1546.574] (-1561.624) (-1553.086) (-1553.361) * [-1567.704] (-1569.755) (-1553.427) (-1561.939) -- 0:02:55
428000 -- (-1554.068) [-1554.702] (-1551.502) (-1560.697) * [-1543.275] (-1555.619) (-1550.630) (-1547.445) -- 0:02:55
428500 -- (-1560.427) [-1561.764] (-1557.407) (-1551.603) * (-1560.396) [-1556.259] (-1570.685) (-1573.689) -- 0:02:54
429000 -- [-1548.980] (-1558.142) (-1557.113) (-1561.653) * (-1559.358) (-1557.614) (-1561.579) [-1562.024] -- 0:02:54
429500 -- (-1560.971) (-1546.032) [-1565.542] (-1550.898) * (-1555.623) (-1561.148) [-1552.925] (-1562.757) -- 0:02:55
430000 -- (-1553.103) [-1549.408] (-1573.366) (-1547.151) * (-1562.534) (-1562.575) (-1558.754) [-1552.051] -- 0:02:54
Average standard deviation of split frequencies: 0.011728
430500 -- (-1552.312) [-1550.578] (-1553.310) (-1551.252) * (-1565.805) [-1552.991] (-1561.583) (-1557.056) -- 0:02:54
431000 -- [-1552.903] (-1563.046) (-1549.406) (-1552.786) * (-1570.247) (-1553.929) [-1560.385] (-1541.048) -- 0:02:54
431500 -- (-1556.389) (-1562.224) [-1548.583] (-1550.397) * (-1552.574) (-1551.570) [-1554.617] (-1546.728) -- 0:02:53
432000 -- (-1553.504) (-1565.841) [-1549.815] (-1555.673) * (-1562.836) [-1545.127] (-1569.670) (-1551.298) -- 0:02:53
432500 -- (-1554.542) [-1555.698] (-1559.992) (-1587.933) * (-1559.139) (-1561.843) (-1565.232) [-1544.606] -- 0:02:54
433000 -- [-1547.633] (-1563.318) (-1567.447) (-1555.273) * (-1555.783) (-1567.312) (-1566.666) [-1545.231] -- 0:02:54
433500 -- (-1545.425) (-1556.001) (-1549.658) [-1567.901] * (-1558.048) (-1548.569) [-1551.799] (-1556.851) -- 0:02:53
434000 -- (-1555.973) (-1556.822) [-1550.488] (-1552.030) * (-1553.797) (-1556.716) (-1547.505) [-1548.278] -- 0:02:53
434500 -- (-1554.593) (-1558.179) (-1556.564) [-1558.894] * (-1559.663) (-1548.820) (-1566.248) [-1551.598] -- 0:02:53
435000 -- [-1553.948] (-1553.889) (-1542.950) (-1559.425) * (-1550.521) (-1547.471) (-1558.862) [-1545.516] -- 0:02:52
Average standard deviation of split frequencies: 0.011198
435500 -- [-1542.814] (-1549.096) (-1544.068) (-1560.825) * [-1546.783] (-1552.719) (-1548.971) (-1549.954) -- 0:02:52
436000 -- (-1550.366) [-1556.869] (-1547.218) (-1562.560) * [-1556.336] (-1560.393) (-1556.520) (-1564.759) -- 0:02:53
436500 -- [-1549.994] (-1555.804) (-1557.166) (-1556.957) * (-1552.383) [-1549.895] (-1548.568) (-1559.192) -- 0:02:52
437000 -- (-1549.377) (-1549.236) [-1547.167] (-1554.188) * [-1548.171] (-1543.849) (-1554.437) (-1567.148) -- 0:02:52
437500 -- (-1555.899) [-1554.180] (-1556.111) (-1571.672) * (-1565.787) [-1550.663] (-1555.341) (-1553.165) -- 0:02:52
438000 -- (-1556.266) [-1554.890] (-1559.903) (-1565.999) * [-1560.677] (-1550.891) (-1561.286) (-1548.197) -- 0:02:51
438500 -- (-1549.671) [-1554.100] (-1565.594) (-1559.636) * (-1556.059) [-1559.888] (-1554.725) (-1560.571) -- 0:02:51
439000 -- (-1554.352) (-1550.923) (-1564.404) [-1544.871] * (-1557.592) (-1552.443) [-1550.319] (-1560.847) -- 0:02:52
439500 -- (-1554.349) (-1545.083) [-1552.786] (-1550.081) * (-1546.693) [-1547.826] (-1563.766) (-1560.260) -- 0:02:52
440000 -- (-1545.314) (-1558.105) (-1556.194) [-1551.949] * [-1555.478] (-1553.166) (-1552.859) (-1556.839) -- 0:02:51
Average standard deviation of split frequencies: 0.011385
440500 -- (-1549.904) (-1555.630) (-1564.149) [-1544.747] * (-1550.885) (-1569.272) (-1551.457) [-1557.851] -- 0:02:51
441000 -- [-1551.059] (-1554.962) (-1554.542) (-1546.946) * (-1550.956) (-1549.530) [-1553.077] (-1557.602) -- 0:02:51
441500 -- [-1547.317] (-1558.285) (-1566.343) (-1552.699) * (-1568.713) (-1562.210) (-1560.671) [-1559.281] -- 0:02:50
442000 -- (-1548.556) (-1564.871) (-1564.849) [-1555.320] * (-1558.631) (-1554.430) [-1545.987] (-1558.297) -- 0:02:50
442500 -- (-1557.324) [-1558.431] (-1553.416) (-1551.587) * (-1551.836) (-1551.935) [-1552.790] (-1552.455) -- 0:02:51
443000 -- [-1548.340] (-1558.318) (-1554.592) (-1567.036) * (-1566.763) (-1562.175) [-1551.455] (-1547.200) -- 0:02:50
443500 -- (-1547.492) [-1553.514] (-1557.637) (-1557.002) * (-1554.757) [-1548.006] (-1557.604) (-1559.902) -- 0:02:50
444000 -- (-1550.744) (-1551.815) [-1546.483] (-1547.050) * (-1546.747) (-1548.640) [-1546.079] (-1554.284) -- 0:02:50
444500 -- (-1545.098) [-1549.952] (-1549.696) (-1556.132) * (-1558.212) (-1559.729) [-1555.324] (-1548.670) -- 0:02:49
445000 -- (-1550.548) (-1547.104) (-1556.083) [-1554.134] * (-1552.624) (-1561.872) (-1556.708) [-1549.146] -- 0:02:49
Average standard deviation of split frequencies: 0.011098
445500 -- (-1551.985) (-1557.744) [-1553.970] (-1554.640) * (-1561.306) (-1545.234) [-1559.113] (-1548.374) -- 0:02:49
446000 -- (-1559.845) [-1544.010] (-1546.942) (-1550.211) * [-1548.195] (-1551.192) (-1556.812) (-1561.000) -- 0:02:50
446500 -- [-1558.658] (-1553.325) (-1559.645) (-1552.045) * (-1550.919) (-1557.487) [-1561.516] (-1558.357) -- 0:02:49
447000 -- (-1554.259) [-1547.940] (-1549.887) (-1550.432) * (-1560.112) (-1562.576) [-1554.597] (-1555.617) -- 0:02:49
447500 -- (-1547.359) [-1549.039] (-1551.174) (-1549.898) * (-1560.777) [-1558.236] (-1565.479) (-1545.132) -- 0:02:49
448000 -- (-1560.552) (-1551.864) (-1555.580) [-1547.949] * [-1543.547] (-1559.689) (-1548.616) (-1553.463) -- 0:02:48
448500 -- (-1565.945) (-1561.834) [-1546.929] (-1550.711) * [-1551.115] (-1565.966) (-1562.268) (-1544.938) -- 0:02:48
449000 -- (-1560.895) (-1559.479) [-1551.955] (-1558.210) * [-1553.238] (-1553.876) (-1566.906) (-1553.376) -- 0:02:49
449500 -- [-1545.706] (-1551.849) (-1552.502) (-1549.610) * (-1557.773) [-1546.826] (-1565.152) (-1567.515) -- 0:02:49
450000 -- (-1557.582) (-1555.181) [-1543.538] (-1551.569) * (-1556.641) (-1564.906) [-1550.392] (-1558.579) -- 0:02:48
Average standard deviation of split frequencies: 0.010834
450500 -- (-1559.244) (-1553.825) (-1557.370) [-1549.034] * (-1558.495) (-1548.493) (-1559.424) [-1545.014] -- 0:02:48
451000 -- [-1547.603] (-1567.305) (-1561.855) (-1551.485) * (-1558.091) [-1557.256] (-1553.852) (-1546.567) -- 0:02:47
451500 -- (-1552.062) [-1543.088] (-1566.579) (-1547.273) * [-1558.078] (-1561.354) (-1561.705) (-1551.835) -- 0:02:47
452000 -- (-1553.966) (-1544.113) (-1562.883) [-1548.400] * [-1546.800] (-1550.056) (-1556.671) (-1549.061) -- 0:02:47
452500 -- (-1558.089) (-1555.493) (-1552.046) [-1558.114] * [-1552.255] (-1566.305) (-1556.865) (-1551.090) -- 0:02:48
453000 -- [-1560.218] (-1567.240) (-1543.814) (-1555.512) * (-1546.368) (-1556.925) (-1559.668) [-1557.038] -- 0:02:47
453500 -- (-1568.461) [-1551.641] (-1554.458) (-1545.424) * (-1544.414) (-1555.324) [-1559.653] (-1556.471) -- 0:02:47
454000 -- [-1543.221] (-1547.569) (-1554.770) (-1554.506) * [-1549.225] (-1561.605) (-1563.195) (-1554.825) -- 0:02:47
454500 -- (-1548.807) [-1542.689] (-1557.615) (-1559.399) * (-1558.082) (-1554.816) (-1557.610) [-1547.351] -- 0:02:46
455000 -- (-1559.104) (-1547.547) (-1556.572) [-1552.222] * (-1556.947) (-1553.757) (-1561.203) [-1550.539] -- 0:02:46
Average standard deviation of split frequencies: 0.010412
455500 -- (-1556.132) (-1545.681) [-1553.134] (-1559.031) * (-1564.610) [-1549.518] (-1557.226) (-1551.759) -- 0:02:47
456000 -- (-1556.605) [-1553.016] (-1563.215) (-1556.463) * (-1562.065) [-1550.291] (-1561.645) (-1556.147) -- 0:02:47
456500 -- [-1552.611] (-1562.297) (-1565.533) (-1559.209) * [-1557.215] (-1547.503) (-1563.610) (-1562.403) -- 0:02:46
457000 -- [-1552.411] (-1548.992) (-1560.322) (-1547.981) * [-1546.356] (-1552.568) (-1547.187) (-1552.753) -- 0:02:46
457500 -- (-1557.188) (-1551.905) [-1547.739] (-1553.076) * (-1560.147) (-1559.362) (-1557.789) [-1549.027] -- 0:02:46
458000 -- (-1559.704) (-1560.511) (-1556.959) [-1546.624] * (-1559.217) (-1565.900) [-1550.913] (-1547.054) -- 0:02:45
458500 -- (-1552.020) (-1563.289) [-1548.810] (-1559.879) * (-1554.147) [-1542.092] (-1557.488) (-1560.862) -- 0:02:45
459000 -- (-1550.731) (-1557.153) (-1554.246) [-1559.202] * (-1547.861) (-1550.970) [-1544.604] (-1564.888) -- 0:02:46
459500 -- [-1545.188] (-1551.520) (-1559.242) (-1557.507) * (-1548.930) (-1549.389) (-1557.188) [-1547.067] -- 0:02:45
460000 -- [-1544.920] (-1557.170) (-1551.187) (-1557.637) * (-1544.299) [-1544.201] (-1559.755) (-1563.523) -- 0:02:45
Average standard deviation of split frequencies: 0.010306
460500 -- [-1549.176] (-1559.284) (-1557.911) (-1552.513) * (-1545.844) [-1558.601] (-1553.657) (-1560.261) -- 0:02:45
461000 -- (-1552.610) (-1558.107) [-1543.510] (-1561.505) * (-1547.523) [-1544.280] (-1565.195) (-1556.383) -- 0:02:44
461500 -- [-1544.526] (-1555.077) (-1545.800) (-1566.501) * (-1550.765) (-1557.170) [-1546.350] (-1556.799) -- 0:02:44
462000 -- [-1555.888] (-1556.401) (-1550.755) (-1549.629) * [-1545.452] (-1553.237) (-1546.746) (-1557.200) -- 0:02:45
462500 -- [-1545.805] (-1567.317) (-1550.791) (-1553.346) * [-1550.224] (-1551.053) (-1554.895) (-1545.457) -- 0:02:45
463000 -- (-1554.386) [-1559.871] (-1554.538) (-1551.060) * (-1550.205) (-1561.794) [-1552.561] (-1553.278) -- 0:02:44
463500 -- [-1550.470] (-1555.521) (-1558.863) (-1556.083) * [-1552.140] (-1549.523) (-1558.764) (-1557.266) -- 0:02:44
464000 -- [-1547.981] (-1564.640) (-1548.321) (-1557.186) * (-1553.230) [-1553.746] (-1566.070) (-1552.318) -- 0:02:44
464500 -- [-1556.858] (-1552.417) (-1557.219) (-1549.867) * (-1567.936) (-1549.900) [-1554.858] (-1552.521) -- 0:02:43
465000 -- (-1555.652) (-1564.958) (-1559.596) [-1543.215] * (-1574.862) [-1548.514] (-1545.399) (-1549.845) -- 0:02:43
Average standard deviation of split frequencies: 0.010766
465500 -- (-1551.823) (-1560.144) [-1551.605] (-1565.368) * (-1557.014) (-1552.176) (-1556.258) [-1568.528] -- 0:02:44
466000 -- [-1541.326] (-1571.351) (-1556.033) (-1552.563) * (-1550.626) [-1549.702] (-1558.339) (-1557.698) -- 0:02:43
466500 -- (-1559.871) (-1556.339) [-1546.882] (-1550.795) * (-1554.460) (-1562.463) [-1548.951] (-1556.703) -- 0:02:43
467000 -- (-1551.291) (-1548.385) [-1544.854] (-1553.624) * (-1560.846) [-1557.631] (-1552.567) (-1563.659) -- 0:02:43
467500 -- (-1567.110) (-1558.571) [-1548.525] (-1548.827) * [-1551.085] (-1546.734) (-1549.064) (-1552.647) -- 0:02:42
468000 -- (-1554.673) [-1554.020] (-1548.134) (-1551.984) * (-1560.990) [-1551.975] (-1557.809) (-1557.009) -- 0:02:42
468500 -- [-1557.173] (-1550.240) (-1554.658) (-1549.257) * [-1549.207] (-1553.623) (-1560.277) (-1559.549) -- 0:02:42
469000 -- (-1551.895) [-1547.099] (-1556.034) (-1560.059) * [-1548.394] (-1561.552) (-1560.649) (-1555.721) -- 0:02:43
469500 -- (-1549.337) [-1552.630] (-1553.400) (-1571.653) * (-1566.314) [-1554.806] (-1547.764) (-1547.289) -- 0:02:42
470000 -- [-1561.324] (-1553.743) (-1566.159) (-1557.524) * (-1561.309) [-1552.168] (-1547.315) (-1552.277) -- 0:02:42
Average standard deviation of split frequencies: 0.010516
470500 -- [-1549.804] (-1549.178) (-1562.221) (-1555.910) * [-1552.294] (-1561.455) (-1550.428) (-1548.175) -- 0:02:42
471000 -- [-1556.129] (-1550.634) (-1555.305) (-1551.753) * (-1545.649) (-1558.140) (-1547.097) [-1543.996] -- 0:02:41
471500 -- (-1559.763) (-1554.288) (-1552.369) [-1551.070] * (-1551.805) [-1548.314] (-1542.984) (-1550.562) -- 0:02:41
472000 -- (-1553.298) (-1554.499) [-1556.004] (-1564.579) * [-1555.146] (-1546.803) (-1550.672) (-1550.747) -- 0:02:42
472500 -- (-1555.097) (-1554.985) (-1545.974) [-1548.166] * [-1546.066] (-1546.240) (-1561.799) (-1552.262) -- 0:02:41
473000 -- (-1563.842) (-1550.192) (-1556.530) [-1546.852] * (-1549.072) (-1565.844) [-1540.607] (-1556.172) -- 0:02:41
473500 -- [-1554.993] (-1550.835) (-1555.460) (-1561.001) * (-1564.546) [-1553.007] (-1568.308) (-1557.713) -- 0:02:41
474000 -- (-1559.487) (-1554.343) (-1555.276) [-1545.680] * [-1560.204] (-1560.531) (-1557.547) (-1556.094) -- 0:02:40
474500 -- [-1545.227] (-1555.060) (-1546.723) (-1569.345) * (-1563.828) (-1561.562) (-1560.256) [-1547.324] -- 0:02:40
475000 -- (-1550.335) (-1560.197) [-1546.672] (-1547.094) * (-1559.819) (-1560.740) [-1545.731] (-1551.146) -- 0:02:40
Average standard deviation of split frequencies: 0.010257
475500 -- (-1549.906) (-1554.002) [-1552.596] (-1547.769) * (-1559.646) (-1553.173) [-1553.995] (-1562.197) -- 0:02:41
476000 -- [-1550.959] (-1548.811) (-1549.942) (-1550.809) * (-1568.861) [-1549.128] (-1556.613) (-1549.120) -- 0:02:40
476500 -- (-1555.456) (-1546.694) [-1539.887] (-1568.272) * (-1557.441) (-1545.249) [-1550.343] (-1551.922) -- 0:02:40
477000 -- (-1549.208) (-1548.578) (-1549.788) [-1547.431] * (-1551.958) (-1546.529) [-1545.435] (-1557.065) -- 0:02:40
477500 -- (-1560.830) [-1554.833] (-1554.556) (-1555.350) * (-1569.624) [-1551.935] (-1549.987) (-1558.338) -- 0:02:39
478000 -- (-1566.174) (-1559.946) [-1549.277] (-1555.408) * (-1595.544) (-1550.925) (-1566.209) [-1552.790] -- 0:02:39
478500 -- [-1553.675] (-1562.407) (-1559.928) (-1552.824) * [-1553.927] (-1550.865) (-1552.459) (-1551.609) -- 0:02:40
479000 -- (-1551.481) (-1551.552) [-1556.824] (-1555.209) * (-1557.073) [-1550.585] (-1555.982) (-1543.966) -- 0:02:39
479500 -- [-1551.315] (-1546.892) (-1556.087) (-1550.769) * (-1558.452) [-1561.241] (-1574.085) (-1564.876) -- 0:02:39
480000 -- (-1553.165) [-1553.425] (-1553.975) (-1549.536) * (-1549.687) (-1555.378) [-1559.803] (-1557.404) -- 0:02:39
Average standard deviation of split frequencies: 0.010017
480500 -- (-1554.726) [-1547.667] (-1553.412) (-1549.835) * (-1550.817) (-1554.542) [-1551.630] (-1543.375) -- 0:02:38
481000 -- (-1563.759) [-1549.172] (-1553.357) (-1565.199) * (-1558.869) (-1561.139) (-1555.365) [-1550.710] -- 0:02:38
481500 -- (-1553.745) (-1554.190) (-1562.018) [-1561.076] * (-1555.318) (-1577.611) (-1558.335) [-1559.297] -- 0:02:38
482000 -- [-1553.326] (-1549.157) (-1562.422) (-1565.300) * (-1548.370) (-1564.757) (-1546.638) [-1544.995] -- 0:02:39
482500 -- (-1547.545) (-1555.484) [-1550.620] (-1561.594) * (-1566.108) [-1550.017] (-1551.538) (-1551.945) -- 0:02:38
483000 -- (-1551.824) [-1549.680] (-1556.854) (-1568.668) * (-1554.157) (-1549.915) (-1551.597) [-1553.093] -- 0:02:38
483500 -- (-1552.250) [-1553.678] (-1555.606) (-1555.079) * [-1550.785] (-1550.077) (-1557.194) (-1574.391) -- 0:02:38
484000 -- (-1553.158) (-1562.232) [-1556.245] (-1551.196) * (-1560.524) (-1568.362) [-1550.092] (-1548.484) -- 0:02:37
484500 -- [-1564.574] (-1557.150) (-1550.001) (-1545.321) * (-1560.526) [-1551.428] (-1554.702) (-1552.378) -- 0:02:37
485000 -- (-1553.222) (-1553.655) [-1545.352] (-1548.172) * (-1561.574) (-1553.340) [-1556.653] (-1555.302) -- 0:02:38
Average standard deviation of split frequencies: 0.009838
485500 -- [-1550.349] (-1557.371) (-1550.523) (-1543.121) * (-1557.771) (-1562.918) [-1547.625] (-1544.695) -- 0:02:37
486000 -- (-1570.588) (-1547.800) [-1547.026] (-1550.552) * [-1555.962] (-1559.492) (-1558.558) (-1547.897) -- 0:02:37
486500 -- (-1553.872) [-1549.652] (-1562.633) (-1550.363) * (-1564.489) (-1556.666) [-1546.969] (-1545.899) -- 0:02:37
487000 -- (-1548.121) [-1556.417] (-1575.286) (-1556.440) * (-1562.377) (-1546.986) (-1561.007) [-1556.751] -- 0:02:36
487500 -- (-1552.850) [-1552.270] (-1549.761) (-1557.713) * [-1546.679] (-1556.721) (-1557.959) (-1563.460) -- 0:02:36
488000 -- (-1559.588) (-1564.111) (-1548.204) [-1551.024] * [-1556.636] (-1550.125) (-1557.163) (-1550.573) -- 0:02:36
488500 -- [-1554.658] (-1557.135) (-1553.400) (-1553.022) * (-1551.328) (-1558.402) [-1552.733] (-1550.670) -- 0:02:37
489000 -- (-1545.224) (-1561.543) [-1550.834] (-1551.241) * (-1555.966) (-1559.277) [-1547.238] (-1571.689) -- 0:02:36
489500 -- (-1547.591) [-1550.377] (-1563.167) (-1553.207) * [-1540.192] (-1554.283) (-1545.902) (-1561.826) -- 0:02:36
490000 -- [-1557.262] (-1554.182) (-1558.392) (-1558.636) * [-1549.499] (-1571.932) (-1554.825) (-1550.249) -- 0:02:36
Average standard deviation of split frequencies: 0.010225
490500 -- (-1570.431) [-1545.301] (-1565.425) (-1552.381) * (-1568.168) (-1561.333) [-1548.425] (-1549.849) -- 0:02:35
491000 -- (-1574.466) [-1544.414] (-1557.852) (-1552.534) * (-1565.152) [-1541.065] (-1551.680) (-1557.125) -- 0:02:35
491500 -- (-1561.868) (-1560.332) [-1545.873] (-1555.470) * (-1553.554) [-1547.003] (-1552.018) (-1559.152) -- 0:02:36
492000 -- (-1571.571) (-1548.342) [-1554.689] (-1560.548) * [-1550.678] (-1546.043) (-1555.165) (-1546.120) -- 0:02:35
492500 -- (-1548.205) (-1568.294) (-1558.913) [-1554.623] * [-1561.189] (-1556.482) (-1563.302) (-1569.209) -- 0:02:35
493000 -- (-1555.496) [-1554.943] (-1553.139) (-1551.776) * (-1555.273) (-1560.264) [-1548.558] (-1554.756) -- 0:02:35
493500 -- (-1553.028) [-1562.600] (-1548.889) (-1548.229) * (-1565.217) (-1553.949) [-1552.125] (-1556.433) -- 0:02:34
494000 -- [-1552.234] (-1555.825) (-1556.736) (-1557.792) * (-1558.944) [-1552.460] (-1553.920) (-1556.071) -- 0:02:34
494500 -- (-1554.243) [-1548.910] (-1550.442) (-1552.181) * (-1551.170) (-1564.801) (-1559.491) [-1549.547] -- 0:02:34
495000 -- (-1551.253) [-1545.262] (-1548.973) (-1561.834) * (-1555.481) (-1567.368) [-1547.873] (-1574.262) -- 0:02:35
Average standard deviation of split frequencies: 0.009640
495500 -- [-1547.518] (-1550.745) (-1545.582) (-1554.404) * (-1550.459) (-1546.371) (-1559.285) [-1549.502] -- 0:02:34
496000 -- (-1565.344) (-1548.901) (-1566.759) [-1552.670] * [-1550.421] (-1552.604) (-1549.763) (-1555.228) -- 0:02:34
496500 -- (-1561.826) (-1560.350) (-1555.536) [-1545.244] * (-1544.599) (-1552.829) [-1548.477] (-1550.813) -- 0:02:34
497000 -- (-1557.043) [-1557.217] (-1563.534) (-1558.151) * (-1548.699) [-1549.342] (-1559.179) (-1549.496) -- 0:02:33
497500 -- (-1547.275) (-1560.051) [-1544.391] (-1557.781) * (-1555.105) [-1543.438] (-1555.831) (-1553.292) -- 0:02:33
498000 -- [-1547.369] (-1561.525) (-1547.305) (-1561.283) * (-1552.555) [-1550.386] (-1559.452) (-1553.161) -- 0:02:33
498500 -- (-1559.955) (-1558.762) [-1549.540] (-1557.157) * (-1560.854) (-1554.212) (-1551.822) [-1552.020] -- 0:02:33
499000 -- (-1547.494) (-1560.511) [-1548.577] (-1557.486) * (-1558.748) (-1555.554) [-1560.092] (-1554.956) -- 0:02:33
499500 -- (-1562.924) [-1557.325] (-1546.138) (-1559.852) * (-1550.326) [-1547.877] (-1558.044) (-1547.633) -- 0:02:33
500000 -- (-1568.099) [-1548.008] (-1550.004) (-1564.726) * (-1568.579) (-1560.929) [-1556.902] (-1558.592) -- 0:02:33
Average standard deviation of split frequencies: 0.008878
500500 -- (-1562.601) (-1551.882) [-1548.492] (-1564.270) * (-1569.601) (-1557.381) (-1556.769) [-1555.520] -- 0:02:32
501000 -- (-1556.655) (-1551.075) [-1552.601] (-1552.499) * (-1554.947) [-1552.629] (-1541.909) (-1552.313) -- 0:02:32
501500 -- [-1565.517] (-1545.596) (-1552.443) (-1556.867) * (-1571.042) [-1547.033] (-1551.498) (-1563.936) -- 0:02:33
502000 -- (-1561.716) (-1545.103) (-1558.137) [-1551.428] * [-1553.613] (-1556.508) (-1547.815) (-1553.512) -- 0:02:32
502500 -- (-1551.274) [-1552.638] (-1549.786) (-1563.357) * [-1549.614] (-1557.809) (-1555.678) (-1547.221) -- 0:02:32
503000 -- [-1545.914] (-1564.986) (-1556.842) (-1560.190) * (-1549.214) [-1545.712] (-1561.696) (-1556.226) -- 0:02:32
503500 -- (-1557.442) (-1560.102) (-1564.037) [-1546.197] * [-1551.595] (-1557.828) (-1561.459) (-1558.841) -- 0:02:31
504000 -- [-1557.863] (-1553.096) (-1561.759) (-1547.283) * [-1546.839] (-1553.287) (-1550.387) (-1547.516) -- 0:02:31
504500 -- (-1566.699) (-1548.775) (-1557.954) [-1544.391] * (-1560.742) (-1571.553) (-1560.849) [-1553.033] -- 0:02:31
505000 -- (-1555.964) (-1558.449) (-1556.736) [-1554.745] * [-1556.444] (-1562.850) (-1553.784) (-1562.410) -- 0:02:31
Average standard deviation of split frequencies: 0.008784
505500 -- (-1567.006) [-1543.688] (-1553.491) (-1551.109) * (-1556.039) (-1566.369) (-1556.529) [-1559.258] -- 0:02:31
506000 -- (-1569.451) (-1558.487) [-1550.659] (-1545.879) * (-1554.836) (-1562.090) (-1552.582) [-1551.792] -- 0:02:31
506500 -- [-1550.662] (-1570.907) (-1549.855) (-1551.271) * (-1551.492) (-1556.002) (-1549.656) [-1546.159] -- 0:02:31
507000 -- (-1558.015) [-1551.516] (-1563.374) (-1555.593) * (-1557.619) (-1548.908) [-1552.219] (-1571.093) -- 0:02:30
507500 -- [-1549.909] (-1555.922) (-1551.510) (-1561.274) * (-1554.392) (-1556.704) [-1555.875] (-1552.333) -- 0:02:30
508000 -- [-1548.005] (-1547.222) (-1557.756) (-1559.677) * [-1557.290] (-1552.519) (-1554.396) (-1566.172) -- 0:02:31
508500 -- (-1547.600) (-1556.362) (-1559.593) [-1550.855] * (-1557.498) (-1551.775) (-1559.988) [-1548.314] -- 0:02:30
509000 -- [-1557.977] (-1563.356) (-1569.418) (-1567.033) * [-1551.297] (-1542.624) (-1562.010) (-1552.662) -- 0:02:30
509500 -- (-1556.826) (-1557.444) (-1554.962) [-1559.244] * [-1549.838] (-1551.887) (-1555.534) (-1554.083) -- 0:02:30
510000 -- [-1548.655] (-1567.163) (-1549.011) (-1550.962) * [-1546.757] (-1559.974) (-1548.245) (-1559.016) -- 0:02:29
Average standard deviation of split frequencies: 0.009033
510500 -- (-1553.922) [-1554.077] (-1556.500) (-1555.981) * [-1541.856] (-1553.221) (-1554.215) (-1550.822) -- 0:02:29
511000 -- [-1548.911] (-1554.867) (-1568.956) (-1567.267) * (-1556.032) [-1549.653] (-1553.776) (-1561.324) -- 0:02:29
511500 -- (-1557.488) (-1559.777) [-1565.268] (-1564.693) * (-1547.851) [-1544.004] (-1553.075) (-1562.190) -- 0:02:29
512000 -- (-1551.743) (-1551.489) [-1555.182] (-1561.325) * (-1569.806) (-1549.372) [-1551.482] (-1552.861) -- 0:02:29
512500 -- (-1558.600) [-1545.662] (-1553.894) (-1562.520) * [-1553.754] (-1550.761) (-1560.308) (-1570.727) -- 0:02:29
513000 -- (-1541.182) [-1547.220] (-1550.971) (-1553.815) * [-1548.977] (-1544.747) (-1550.464) (-1561.134) -- 0:02:29
513500 -- [-1551.268] (-1544.960) (-1566.287) (-1560.105) * (-1553.780) (-1558.227) [-1554.221] (-1556.635) -- 0:02:28
514000 -- [-1541.352] (-1549.725) (-1563.335) (-1555.136) * (-1553.547) [-1548.022] (-1544.114) (-1551.174) -- 0:02:28
514500 -- (-1552.224) (-1554.794) (-1564.460) [-1546.080] * (-1557.125) (-1564.671) (-1546.607) [-1544.067] -- 0:02:29
515000 -- (-1557.006) (-1546.322) (-1555.199) [-1558.105] * (-1554.417) [-1565.524] (-1546.335) (-1552.503) -- 0:02:28
Average standard deviation of split frequencies: 0.008483
515500 -- [-1551.752] (-1563.375) (-1559.160) (-1551.799) * [-1553.906] (-1563.278) (-1551.994) (-1557.380) -- 0:02:28
516000 -- (-1554.518) (-1560.698) [-1560.030] (-1545.347) * [-1548.321] (-1560.820) (-1558.676) (-1562.822) -- 0:02:28
516500 -- [-1553.907] (-1549.517) (-1557.671) (-1552.888) * (-1561.510) (-1563.673) [-1553.089] (-1557.498) -- 0:02:27
517000 -- (-1548.763) [-1543.482] (-1555.846) (-1552.816) * (-1562.452) [-1568.708] (-1559.078) (-1555.200) -- 0:02:27
517500 -- (-1550.006) [-1554.730] (-1553.590) (-1551.182) * (-1555.424) (-1556.544) (-1559.843) [-1552.180] -- 0:02:27
518000 -- [-1550.534] (-1549.807) (-1556.628) (-1548.617) * [-1546.275] (-1552.915) (-1564.827) (-1556.478) -- 0:02:27
518500 -- (-1545.535) (-1552.618) (-1558.464) [-1554.486] * [-1553.893] (-1555.294) (-1556.267) (-1550.856) -- 0:02:27
519000 -- (-1554.056) [-1555.293] (-1561.536) (-1550.789) * (-1560.395) (-1549.266) (-1552.639) [-1546.011] -- 0:02:27
519500 -- [-1542.609] (-1552.086) (-1548.019) (-1552.452) * (-1568.439) (-1547.737) [-1552.459] (-1548.543) -- 0:02:27
520000 -- [-1548.066] (-1553.557) (-1560.105) (-1555.202) * [-1548.806] (-1553.952) (-1563.987) (-1548.202) -- 0:02:26
Average standard deviation of split frequencies: 0.008537
520500 -- (-1561.155) [-1549.643] (-1548.045) (-1554.761) * (-1555.194) [-1553.623] (-1566.208) (-1547.715) -- 0:02:26
521000 -- (-1566.845) (-1549.919) [-1550.189] (-1550.784) * (-1552.447) (-1550.608) (-1561.136) [-1551.282] -- 0:02:26
521500 -- (-1555.703) (-1558.402) [-1548.981] (-1554.563) * [-1550.206] (-1551.656) (-1553.301) (-1561.982) -- 0:02:26
522000 -- (-1559.872) (-1561.609) (-1550.340) [-1548.042] * (-1555.844) (-1560.038) [-1552.392] (-1553.442) -- 0:02:26
522500 -- [-1549.488] (-1555.349) (-1561.630) (-1563.572) * (-1547.133) (-1546.277) (-1557.945) [-1555.385] -- 0:02:26
523000 -- (-1548.840) (-1572.557) [-1555.484] (-1565.491) * (-1550.326) (-1544.709) [-1551.925] (-1551.528) -- 0:02:25
523500 -- (-1570.948) [-1554.594] (-1556.331) (-1553.559) * (-1555.654) (-1548.574) (-1550.942) [-1555.641] -- 0:02:25
524000 -- (-1564.869) (-1557.101) (-1552.533) [-1550.532] * (-1550.509) [-1549.081] (-1555.409) (-1555.297) -- 0:02:25
524500 -- (-1557.211) (-1567.359) (-1558.217) [-1554.026] * (-1557.698) (-1554.231) (-1551.747) [-1545.353] -- 0:02:25
525000 -- (-1553.789) (-1549.301) (-1550.481) [-1544.388] * (-1549.503) [-1548.321] (-1545.699) (-1560.974) -- 0:02:25
Average standard deviation of split frequencies: 0.006914
525500 -- (-1552.996) (-1561.159) [-1564.154] (-1562.072) * (-1546.911) [-1555.894] (-1558.839) (-1550.293) -- 0:02:25
526000 -- (-1557.380) [-1549.217] (-1557.802) (-1548.173) * [-1551.932] (-1549.370) (-1551.965) (-1550.590) -- 0:02:25
526500 -- [-1559.342] (-1550.223) (-1562.226) (-1563.297) * (-1561.927) [-1551.186] (-1550.781) (-1557.393) -- 0:02:24
527000 -- [-1551.499] (-1553.492) (-1550.465) (-1558.109) * (-1554.458) [-1554.656] (-1555.916) (-1559.224) -- 0:02:24
527500 -- (-1555.298) (-1549.978) (-1560.807) [-1555.798] * [-1552.798] (-1551.161) (-1551.790) (-1545.457) -- 0:02:24
528000 -- (-1552.603) [-1549.314] (-1562.597) (-1556.441) * (-1547.631) (-1548.609) (-1556.601) [-1550.454] -- 0:02:24
528500 -- (-1552.493) (-1553.013) [-1550.992] (-1565.514) * [-1552.590] (-1550.071) (-1566.151) (-1544.953) -- 0:02:24
529000 -- [-1546.019] (-1564.997) (-1568.854) (-1545.772) * (-1541.910) (-1561.940) (-1560.706) [-1548.075] -- 0:02:24
529500 -- (-1548.110) (-1554.564) (-1550.905) [-1545.984] * (-1555.315) [-1551.321] (-1544.991) (-1553.591) -- 0:02:23
530000 -- (-1545.049) [-1547.055] (-1549.664) (-1573.711) * [-1549.849] (-1546.883) (-1547.758) (-1558.777) -- 0:02:23
Average standard deviation of split frequencies: 0.006472
530500 -- (-1552.465) (-1555.776) [-1552.827] (-1551.375) * (-1562.720) [-1547.649] (-1550.902) (-1562.157) -- 0:02:23
531000 -- (-1557.507) (-1558.828) (-1554.383) [-1542.455] * [-1550.302] (-1555.084) (-1559.901) (-1551.554) -- 0:02:23
531500 -- (-1549.256) (-1568.265) (-1547.329) [-1550.250] * [-1548.740] (-1556.006) (-1551.149) (-1559.719) -- 0:02:23
532000 -- (-1547.371) (-1558.108) (-1555.376) [-1551.304] * (-1547.158) [-1551.800] (-1548.645) (-1578.076) -- 0:02:23
532500 -- (-1545.687) (-1553.074) [-1548.796] (-1558.845) * [-1543.548] (-1550.029) (-1553.707) (-1560.755) -- 0:02:23
533000 -- (-1552.362) [-1561.253] (-1548.929) (-1549.024) * (-1548.564) (-1567.566) (-1552.067) [-1553.078] -- 0:02:22
533500 -- (-1550.806) (-1552.286) [-1540.554] (-1557.235) * (-1555.820) (-1549.845) (-1552.266) [-1545.973] -- 0:02:22
534000 -- (-1562.017) [-1557.547] (-1546.926) (-1549.943) * [-1552.172] (-1565.924) (-1557.446) (-1550.991) -- 0:02:22
534500 -- (-1561.043) (-1556.389) [-1547.771] (-1561.693) * (-1560.646) (-1558.296) (-1555.357) [-1544.609] -- 0:02:22
535000 -- [-1550.690] (-1551.481) (-1558.639) (-1556.509) * (-1561.511) [-1550.028] (-1559.172) (-1559.011) -- 0:02:22
Average standard deviation of split frequencies: 0.006156
535500 -- (-1550.183) [-1550.205] (-1554.106) (-1545.470) * (-1563.564) (-1553.954) (-1551.521) [-1559.442] -- 0:02:22
536000 -- (-1560.850) (-1555.712) [-1546.544] (-1552.416) * [-1545.226] (-1564.303) (-1562.301) (-1547.597) -- 0:02:21
536500 -- [-1551.245] (-1544.921) (-1558.074) (-1550.529) * (-1550.223) (-1558.212) [-1568.421] (-1567.108) -- 0:02:21
537000 -- (-1552.286) (-1547.795) [-1552.006] (-1548.799) * [-1548.395] (-1560.232) (-1540.110) (-1569.366) -- 0:02:21
537500 -- (-1548.509) [-1556.017] (-1564.505) (-1568.245) * (-1556.196) (-1556.626) [-1559.679] (-1563.559) -- 0:02:21
538000 -- (-1557.736) (-1554.097) (-1563.548) [-1551.337] * (-1550.212) [-1552.173] (-1558.013) (-1558.591) -- 0:02:21
538500 -- [-1551.987] (-1566.494) (-1561.632) (-1557.653) * (-1557.750) [-1549.634] (-1550.491) (-1569.946) -- 0:02:21
539000 -- (-1561.391) (-1555.301) (-1547.019) [-1560.750] * (-1561.621) [-1563.067] (-1546.106) (-1566.720) -- 0:02:21
539500 -- [-1552.124] (-1558.786) (-1552.015) (-1555.815) * (-1559.460) (-1557.805) (-1549.127) [-1557.974] -- 0:02:20
540000 -- (-1550.577) (-1553.847) (-1556.746) [-1557.225] * (-1559.461) [-1552.095] (-1547.150) (-1549.098) -- 0:02:20
Average standard deviation of split frequencies: 0.005792
540500 -- (-1562.233) (-1559.626) [-1550.509] (-1568.776) * (-1548.913) (-1560.269) [-1555.780] (-1551.561) -- 0:02:20
541000 -- (-1552.188) (-1557.738) [-1554.928] (-1570.539) * (-1557.132) [-1545.981] (-1564.064) (-1551.369) -- 0:02:20
541500 -- (-1553.349) (-1551.505) [-1549.455] (-1567.670) * (-1565.989) [-1552.703] (-1559.942) (-1559.999) -- 0:02:20
542000 -- (-1549.468) [-1552.550] (-1548.352) (-1564.467) * (-1548.539) [-1544.108] (-1557.015) (-1547.455) -- 0:02:20
542500 -- (-1546.542) (-1546.830) [-1548.436] (-1555.552) * [-1542.594] (-1547.767) (-1558.016) (-1568.445) -- 0:02:19
543000 -- [-1550.497] (-1552.872) (-1559.345) (-1551.571) * (-1556.611) (-1552.911) [-1553.632] (-1556.507) -- 0:02:19
543500 -- (-1558.156) [-1559.528] (-1553.606) (-1560.019) * (-1561.351) [-1547.783] (-1554.840) (-1554.277) -- 0:02:19
544000 -- (-1553.428) (-1554.900) [-1548.757] (-1547.584) * (-1554.110) [-1547.466] (-1551.775) (-1547.992) -- 0:02:19
544500 -- (-1555.054) [-1544.211] (-1560.736) (-1548.031) * (-1554.899) (-1548.223) (-1561.406) [-1544.163] -- 0:02:19
545000 -- (-1562.659) (-1566.123) (-1559.399) [-1552.016] * (-1549.456) (-1567.439) [-1556.071] (-1573.392) -- 0:02:19
Average standard deviation of split frequencies: 0.006414
545500 -- [-1549.119] (-1570.914) (-1553.144) (-1553.043) * (-1551.222) (-1559.509) [-1550.778] (-1555.042) -- 0:02:19
546000 -- (-1558.191) [-1540.935] (-1548.486) (-1569.193) * (-1562.889) [-1562.686] (-1559.852) (-1552.612) -- 0:02:18
546500 -- (-1560.083) [-1548.378] (-1560.955) (-1554.522) * (-1557.494) [-1553.485] (-1554.319) (-1555.515) -- 0:02:18
547000 -- (-1553.724) (-1558.493) [-1557.721] (-1561.363) * [-1556.568] (-1555.119) (-1564.495) (-1548.529) -- 0:02:18
547500 -- [-1551.717] (-1554.976) (-1556.065) (-1555.907) * (-1552.039) [-1546.919] (-1554.903) (-1568.992) -- 0:02:18
548000 -- (-1562.820) (-1555.682) [-1549.500] (-1551.996) * (-1559.794) (-1564.490) (-1560.206) [-1544.669] -- 0:02:18
548500 -- (-1567.560) (-1557.821) [-1551.252] (-1562.593) * [-1545.641] (-1550.623) (-1558.506) (-1555.677) -- 0:02:18
549000 -- (-1564.497) [-1550.044] (-1552.873) (-1562.353) * (-1558.026) (-1550.289) (-1544.691) [-1547.693] -- 0:02:18
549500 -- (-1563.574) (-1556.488) [-1551.336] (-1554.286) * (-1549.866) (-1551.109) (-1549.768) [-1545.954] -- 0:02:17
550000 -- (-1555.348) (-1545.658) [-1556.673] (-1563.354) * (-1566.738) (-1552.928) (-1544.121) [-1548.671] -- 0:02:17
Average standard deviation of split frequencies: 0.006848
550500 -- (-1552.843) [-1547.248] (-1564.713) (-1555.494) * (-1573.210) (-1551.088) (-1563.197) [-1554.976] -- 0:02:17
551000 -- (-1542.554) [-1554.914] (-1556.759) (-1571.737) * (-1552.602) (-1550.055) [-1553.284] (-1562.681) -- 0:02:17
551500 -- [-1548.997] (-1553.282) (-1549.441) (-1555.247) * [-1550.719] (-1555.419) (-1544.019) (-1549.650) -- 0:02:17
552000 -- [-1552.317] (-1562.708) (-1557.426) (-1547.460) * (-1545.238) [-1551.915] (-1553.533) (-1562.417) -- 0:02:17
552500 -- (-1555.135) (-1551.775) (-1561.324) [-1543.733] * [-1552.726] (-1551.437) (-1562.565) (-1558.318) -- 0:02:16
553000 -- (-1555.595) [-1554.501] (-1557.744) (-1556.542) * (-1554.753) (-1554.265) (-1568.935) [-1554.672] -- 0:02:16
553500 -- (-1547.993) (-1565.655) [-1548.163] (-1550.920) * [-1547.156] (-1561.072) (-1565.221) (-1549.535) -- 0:02:16
554000 -- [-1546.932] (-1549.923) (-1557.205) (-1549.848) * [-1550.852] (-1554.493) (-1555.999) (-1556.840) -- 0:02:16
554500 -- (-1555.368) (-1549.631) [-1552.674] (-1552.039) * (-1584.129) (-1559.940) [-1554.142] (-1546.914) -- 0:02:16
555000 -- [-1556.502] (-1559.254) (-1560.414) (-1558.598) * (-1546.658) [-1550.516] (-1567.175) (-1550.672) -- 0:02:16
Average standard deviation of split frequencies: 0.006419
555500 -- (-1556.347) (-1549.571) (-1562.040) [-1552.377] * (-1561.575) [-1557.107] (-1559.596) (-1553.481) -- 0:02:16
556000 -- [-1545.316] (-1561.716) (-1549.221) (-1553.681) * (-1557.372) [-1561.191] (-1555.335) (-1557.110) -- 0:02:15
556500 -- (-1548.983) (-1557.366) (-1570.539) [-1547.713] * (-1554.110) (-1564.548) [-1552.763] (-1560.453) -- 0:02:15
557000 -- [-1548.702] (-1550.784) (-1557.362) (-1557.429) * (-1560.726) (-1562.817) (-1552.405) [-1547.336] -- 0:02:16
557500 -- (-1558.980) (-1559.649) [-1557.331] (-1561.351) * (-1551.569) (-1549.631) (-1552.475) [-1558.203] -- 0:02:15
558000 -- (-1553.430) (-1551.005) [-1545.862] (-1558.149) * (-1549.116) (-1554.533) (-1569.179) [-1547.321] -- 0:02:15
558500 -- (-1558.011) (-1554.092) (-1550.665) [-1548.212] * [-1556.702] (-1562.407) (-1565.220) (-1553.034) -- 0:02:15
559000 -- [-1554.339] (-1566.877) (-1567.865) (-1550.509) * (-1550.035) (-1559.005) (-1559.317) [-1541.758] -- 0:02:14
559500 -- [-1554.641] (-1554.610) (-1556.747) (-1555.037) * (-1553.323) (-1553.805) [-1552.322] (-1557.797) -- 0:02:14
560000 -- [-1552.950] (-1549.772) (-1557.156) (-1556.170) * [-1556.061] (-1547.461) (-1549.965) (-1550.345) -- 0:02:14
Average standard deviation of split frequencies: 0.005825
560500 -- (-1554.275) (-1553.475) [-1546.660] (-1558.850) * (-1560.205) [-1546.178] (-1553.277) (-1548.918) -- 0:02:14
561000 -- [-1555.176] (-1548.762) (-1561.645) (-1565.657) * [-1561.489] (-1560.640) (-1556.429) (-1552.732) -- 0:02:14
561500 -- (-1558.597) [-1546.315] (-1566.369) (-1555.312) * (-1572.894) (-1566.712) [-1557.299] (-1561.421) -- 0:02:14
562000 -- (-1553.874) [-1546.949] (-1555.929) (-1554.636) * (-1565.914) [-1558.928] (-1563.128) (-1548.030) -- 0:02:14
562500 -- (-1550.563) [-1553.662] (-1554.613) (-1554.118) * (-1546.861) (-1571.417) [-1552.662] (-1548.551) -- 0:02:13
563000 -- [-1552.750] (-1564.363) (-1551.530) (-1552.922) * (-1549.322) (-1557.147) [-1542.010] (-1558.311) -- 0:02:13
563500 -- [-1548.022] (-1550.502) (-1554.697) (-1561.793) * (-1560.536) (-1558.847) (-1560.726) [-1548.671] -- 0:02:13
564000 -- (-1553.737) (-1566.510) (-1555.187) [-1550.872] * (-1556.179) (-1544.764) [-1549.728] (-1562.521) -- 0:02:13
564500 -- (-1553.241) (-1564.028) (-1563.279) [-1554.223] * (-1561.573) (-1554.689) [-1556.948] (-1548.930) -- 0:02:13
565000 -- (-1564.602) (-1552.967) (-1550.510) [-1542.851] * (-1561.276) (-1553.774) (-1557.510) [-1552.510] -- 0:02:13
Average standard deviation of split frequencies: 0.005295
565500 -- (-1546.818) (-1553.692) [-1547.162] (-1550.613) * [-1550.980] (-1547.517) (-1557.148) (-1554.072) -- 0:02:12
566000 -- (-1557.064) [-1553.633] (-1555.438) (-1557.951) * (-1558.506) [-1546.363] (-1547.286) (-1549.655) -- 0:02:12
566500 -- (-1555.523) [-1551.923] (-1564.336) (-1557.573) * [-1547.734] (-1545.227) (-1559.514) (-1549.139) -- 0:02:12
567000 -- (-1573.749) [-1551.472] (-1551.662) (-1560.124) * (-1554.957) (-1555.009) (-1553.172) [-1552.617] -- 0:02:12
567500 -- (-1549.840) (-1556.054) [-1546.110] (-1552.136) * (-1556.639) (-1562.004) (-1562.529) [-1555.309] -- 0:02:12
568000 -- (-1560.037) (-1555.032) (-1558.316) [-1562.335] * [-1550.840] (-1557.017) (-1551.250) (-1561.256) -- 0:02:12
568500 -- (-1550.568) [-1543.278] (-1560.616) (-1561.183) * (-1555.473) [-1555.406] (-1552.783) (-1549.072) -- 0:02:12
569000 -- [-1547.101] (-1552.619) (-1544.339) (-1552.324) * (-1551.794) (-1558.648) [-1547.171] (-1559.683) -- 0:02:11
569500 -- (-1561.504) (-1549.641) (-1549.881) [-1545.916] * (-1568.730) (-1561.699) [-1546.686] (-1555.879) -- 0:02:11
570000 -- [-1547.377] (-1547.177) (-1548.421) (-1565.768) * (-1572.935) [-1559.386] (-1557.464) (-1559.763) -- 0:02:11
Average standard deviation of split frequencies: 0.005959
570500 -- [-1555.576] (-1557.818) (-1552.068) (-1558.721) * (-1562.957) (-1567.559) (-1550.069) [-1557.606] -- 0:02:11
571000 -- (-1558.540) [-1547.551] (-1553.941) (-1551.486) * (-1550.090) (-1557.920) (-1559.662) [-1550.822] -- 0:02:11
571500 -- (-1563.288) (-1548.580) (-1559.450) [-1546.983] * (-1548.638) (-1559.760) [-1555.081] (-1556.008) -- 0:02:11
572000 -- (-1565.890) (-1554.716) (-1561.550) [-1549.425] * [-1540.383] (-1552.425) (-1572.454) (-1551.936) -- 0:02:10
572500 -- (-1557.932) [-1551.253] (-1556.436) (-1549.753) * (-1544.904) (-1553.336) (-1565.577) [-1551.212] -- 0:02:10
573000 -- (-1561.480) [-1549.523] (-1549.290) (-1549.471) * [-1546.767] (-1564.743) (-1566.041) (-1554.695) -- 0:02:10
573500 -- (-1561.705) (-1556.866) [-1547.221] (-1551.446) * [-1549.781] (-1553.028) (-1570.213) (-1563.478) -- 0:02:10
574000 -- [-1545.852] (-1557.758) (-1549.746) (-1544.012) * [-1555.518] (-1557.908) (-1559.244) (-1558.738) -- 0:02:10
574500 -- (-1561.624) [-1558.115] (-1546.820) (-1552.490) * (-1549.113) (-1564.080) (-1561.337) [-1548.299] -- 0:02:10
575000 -- (-1551.664) (-1560.119) (-1552.165) [-1554.870] * (-1559.352) (-1555.320) [-1554.061] (-1552.217) -- 0:02:10
Average standard deviation of split frequencies: 0.006197
575500 -- (-1565.885) (-1553.233) [-1544.820] (-1550.557) * [-1545.301] (-1559.991) (-1559.988) (-1553.055) -- 0:02:09
576000 -- (-1549.682) [-1547.793] (-1557.687) (-1568.777) * [-1553.079] (-1559.190) (-1564.987) (-1558.423) -- 0:02:09
576500 -- (-1555.438) [-1543.080] (-1543.302) (-1556.078) * [-1550.689] (-1549.573) (-1566.756) (-1559.283) -- 0:02:09
577000 -- (-1554.434) (-1573.910) [-1551.242] (-1556.143) * [-1555.691] (-1554.946) (-1556.870) (-1551.308) -- 0:02:09
577500 -- (-1560.873) [-1561.803] (-1548.042) (-1562.689) * (-1548.987) [-1551.318] (-1562.301) (-1566.520) -- 0:02:09
578000 -- (-1565.035) (-1557.615) [-1553.921] (-1563.510) * (-1550.579) (-1558.954) [-1549.515] (-1564.166) -- 0:02:09
578500 -- (-1552.743) (-1561.407) (-1569.951) [-1543.412] * (-1546.147) [-1542.460] (-1562.412) (-1548.682) -- 0:02:08
579000 -- [-1551.050] (-1573.748) (-1555.920) (-1558.643) * [-1553.799] (-1550.963) (-1557.273) (-1560.927) -- 0:02:08
579500 -- [-1547.922] (-1561.524) (-1556.972) (-1554.899) * (-1558.228) [-1558.110] (-1558.266) (-1550.819) -- 0:02:08
580000 -- [-1550.833] (-1558.817) (-1547.792) (-1544.543) * (-1543.995) [-1552.525] (-1563.141) (-1553.712) -- 0:02:08
Average standard deviation of split frequencies: 0.006147
580500 -- (-1553.757) (-1560.083) (-1551.485) [-1551.825] * (-1562.828) (-1558.830) [-1561.799] (-1550.325) -- 0:02:08
581000 -- (-1551.955) (-1562.188) (-1548.555) [-1547.598] * (-1552.916) (-1568.520) [-1553.688] (-1556.706) -- 0:02:08
581500 -- [-1553.160] (-1566.297) (-1564.146) (-1561.421) * [-1556.735] (-1544.630) (-1569.058) (-1550.380) -- 0:02:08
582000 -- [-1549.064] (-1556.508) (-1559.129) (-1560.771) * [-1548.935] (-1561.947) (-1546.102) (-1553.983) -- 0:02:07
582500 -- (-1548.037) (-1553.785) (-1560.846) [-1554.744] * (-1552.652) (-1548.211) (-1548.373) [-1555.438] -- 0:02:07
583000 -- (-1551.944) (-1553.471) (-1546.886) [-1552.757] * [-1549.365] (-1561.467) (-1551.064) (-1554.617) -- 0:02:07
583500 -- [-1549.635] (-1570.588) (-1546.884) (-1552.913) * [-1550.524] (-1547.217) (-1545.005) (-1549.389) -- 0:02:07
584000 -- (-1553.210) (-1572.344) [-1554.494] (-1565.010) * (-1555.087) (-1559.695) [-1550.815] (-1557.367) -- 0:02:07
584500 -- (-1559.750) (-1568.319) [-1550.248] (-1558.338) * (-1552.869) (-1553.205) (-1552.519) [-1556.796] -- 0:02:07
585000 -- [-1557.978] (-1557.002) (-1550.168) (-1573.606) * [-1545.769] (-1563.343) (-1553.560) (-1573.048) -- 0:02:06
Average standard deviation of split frequencies: 0.005861
585500 -- [-1550.506] (-1556.243) (-1550.969) (-1546.296) * (-1548.946) (-1559.011) [-1550.954] (-1554.515) -- 0:02:06
586000 -- (-1554.697) (-1555.627) (-1565.623) [-1551.165] * (-1547.947) (-1549.080) (-1566.021) [-1544.566] -- 0:02:06
586500 -- (-1548.229) (-1559.760) [-1555.151] (-1554.570) * (-1563.005) [-1547.073] (-1552.026) (-1560.753) -- 0:02:06
587000 -- [-1546.570] (-1558.979) (-1552.802) (-1549.720) * [-1555.277] (-1549.559) (-1551.261) (-1559.149) -- 0:02:06
587500 -- (-1555.378) (-1550.167) (-1541.049) [-1550.523] * (-1551.936) [-1551.312] (-1562.100) (-1555.254) -- 0:02:06
588000 -- (-1556.695) (-1557.643) [-1541.355] (-1562.867) * [-1547.048] (-1555.995) (-1556.217) (-1570.251) -- 0:02:06
588500 -- (-1554.147) (-1567.341) (-1550.644) [-1552.203] * (-1552.876) (-1553.803) (-1548.761) [-1553.710] -- 0:02:05
589000 -- (-1555.767) (-1555.011) [-1550.770] (-1555.448) * (-1573.047) (-1553.037) [-1547.780] (-1557.159) -- 0:02:05
589500 -- [-1543.044] (-1558.082) (-1556.268) (-1551.649) * (-1552.788) (-1557.273) (-1563.634) [-1549.008] -- 0:02:05
590000 -- (-1548.500) (-1553.429) (-1558.752) [-1553.608] * (-1558.957) (-1556.164) (-1550.989) [-1545.417] -- 0:02:05
Average standard deviation of split frequencies: 0.005758
590500 -- (-1558.229) (-1562.566) (-1565.341) [-1557.294] * [-1553.684] (-1559.665) (-1560.982) (-1551.134) -- 0:02:05
591000 -- [-1542.228] (-1563.602) (-1566.372) (-1553.974) * [-1550.573] (-1542.672) (-1556.723) (-1569.698) -- 0:02:05
591500 -- (-1552.102) [-1547.070] (-1571.974) (-1557.645) * (-1555.260) (-1547.080) (-1570.955) [-1550.197] -- 0:02:05
592000 -- (-1552.437) [-1547.446] (-1559.210) (-1565.094) * (-1563.499) (-1572.039) [-1549.553] (-1562.593) -- 0:02:04
592500 -- [-1560.366] (-1546.591) (-1552.642) (-1557.102) * (-1560.016) [-1548.075] (-1561.664) (-1558.874) -- 0:02:04
593000 -- [-1547.031] (-1564.264) (-1554.748) (-1560.141) * [-1549.320] (-1559.939) (-1556.873) (-1553.507) -- 0:02:04
593500 -- (-1547.426) [-1552.522] (-1557.757) (-1552.512) * (-1556.284) (-1556.978) (-1561.614) [-1556.985] -- 0:02:04
594000 -- [-1545.972] (-1547.161) (-1559.489) (-1565.502) * (-1548.902) [-1559.470] (-1559.153) (-1560.457) -- 0:02:04
594500 -- [-1542.319] (-1551.279) (-1543.432) (-1564.070) * (-1541.898) (-1558.524) [-1547.341] (-1561.476) -- 0:02:04
595000 -- (-1550.267) (-1548.587) (-1546.004) [-1553.149] * (-1553.596) [-1544.453] (-1565.152) (-1553.869) -- 0:02:03
Average standard deviation of split frequencies: 0.005537
595500 -- [-1547.846] (-1567.679) (-1556.018) (-1546.506) * (-1550.803) [-1550.298] (-1552.029) (-1548.953) -- 0:02:03
596000 -- (-1563.422) (-1557.773) (-1549.550) [-1542.962] * (-1555.807) [-1545.447] (-1568.047) (-1567.648) -- 0:02:03
596500 -- (-1548.472) [-1559.173] (-1551.772) (-1563.058) * (-1544.430) (-1549.762) (-1552.938) [-1554.436] -- 0:02:03
597000 -- (-1559.863) (-1567.573) (-1548.512) [-1546.017] * [-1552.745] (-1554.220) (-1543.553) (-1552.298) -- 0:02:03
597500 -- (-1559.623) (-1552.514) (-1560.124) [-1556.487] * [-1555.003] (-1553.980) (-1561.958) (-1554.195) -- 0:02:03
598000 -- (-1554.126) (-1551.189) [-1545.961] (-1559.128) * (-1553.913) (-1552.838) [-1553.113] (-1564.835) -- 0:02:03
598500 -- (-1557.193) (-1566.462) (-1559.091) [-1549.706] * (-1563.488) (-1557.206) [-1553.080] (-1547.156) -- 0:02:02
599000 -- [-1554.414] (-1556.460) (-1560.180) (-1579.614) * [-1548.574] (-1554.644) (-1566.240) (-1559.704) -- 0:02:02
599500 -- (-1556.855) (-1552.041) (-1558.777) [-1552.687] * (-1542.483) [-1557.000] (-1545.985) (-1554.026) -- 0:02:02
600000 -- (-1554.079) (-1568.128) [-1548.873] (-1566.785) * [-1549.026] (-1556.093) (-1556.658) (-1549.741) -- 0:02:02
Average standard deviation of split frequencies: 0.005886
600500 -- (-1552.207) [-1550.500] (-1563.662) (-1556.881) * (-1549.178) (-1545.575) (-1560.037) [-1557.141] -- 0:02:02
601000 -- [-1551.959] (-1564.085) (-1556.291) (-1550.751) * (-1550.724) [-1550.349] (-1552.697) (-1559.272) -- 0:02:02
601500 -- (-1558.705) (-1569.978) [-1549.826] (-1568.307) * (-1548.808) [-1548.992] (-1552.483) (-1557.060) -- 0:02:01
602000 -- (-1562.076) (-1561.280) [-1551.668] (-1565.221) * (-1550.379) (-1567.077) [-1545.407] (-1562.066) -- 0:02:01
602500 -- (-1561.372) (-1552.726) [-1549.515] (-1546.481) * (-1564.110) (-1554.617) [-1550.530] (-1556.016) -- 0:02:01
603000 -- (-1552.818) (-1576.115) (-1565.411) [-1544.926] * (-1554.183) (-1549.828) (-1550.870) [-1552.473] -- 0:02:01
603500 -- (-1549.349) (-1560.370) [-1559.421] (-1560.834) * (-1550.269) (-1553.577) (-1563.652) [-1547.839] -- 0:02:01
604000 -- (-1551.627) [-1546.341] (-1553.887) (-1565.837) * [-1550.784] (-1558.598) (-1560.601) (-1548.852) -- 0:02:01
604500 -- (-1551.539) (-1550.929) (-1561.763) [-1554.651] * (-1553.739) (-1559.338) (-1555.798) [-1551.704] -- 0:02:01
605000 -- (-1563.666) (-1544.736) (-1552.731) [-1550.534] * (-1559.446) (-1558.676) [-1548.831] (-1549.944) -- 0:02:00
Average standard deviation of split frequencies: 0.005056
605500 -- (-1562.349) [-1544.910] (-1553.613) (-1550.987) * (-1551.592) [-1544.426] (-1554.436) (-1551.091) -- 0:02:00
606000 -- (-1554.605) (-1562.832) [-1547.154] (-1561.774) * (-1550.949) [-1547.659] (-1556.411) (-1550.598) -- 0:02:00
606500 -- [-1553.484] (-1556.420) (-1557.591) (-1561.505) * [-1546.725] (-1551.879) (-1558.301) (-1554.466) -- 0:02:00
607000 -- [-1560.930] (-1568.929) (-1541.134) (-1553.713) * (-1552.522) (-1551.061) [-1547.416] (-1549.949) -- 0:02:00
607500 -- (-1560.307) (-1552.900) (-1558.182) [-1549.018] * [-1550.197] (-1553.837) (-1557.551) (-1565.945) -- 0:02:00
608000 -- (-1563.494) (-1556.486) (-1568.726) [-1543.556] * (-1550.450) (-1548.890) (-1553.395) [-1555.691] -- 0:01:59
608500 -- (-1559.499) (-1557.207) (-1561.916) [-1544.175] * (-1553.640) (-1557.585) [-1547.840] (-1553.913) -- 0:01:59
609000 -- (-1564.454) (-1553.554) (-1553.171) [-1546.941] * (-1561.913) (-1554.265) [-1543.305] (-1562.047) -- 0:01:59
609500 -- (-1547.201) (-1557.938) (-1569.863) [-1541.826] * (-1549.800) [-1551.604] (-1547.509) (-1548.201) -- 0:01:59
610000 -- [-1548.512] (-1553.836) (-1549.600) (-1549.747) * [-1552.610] (-1561.793) (-1553.048) (-1549.179) -- 0:01:59
Average standard deviation of split frequencies: 0.004466
610500 -- [-1548.793] (-1544.065) (-1565.341) (-1551.485) * (-1545.169) (-1560.127) (-1554.724) [-1550.207] -- 0:01:59
611000 -- (-1562.078) [-1549.480] (-1548.424) (-1560.370) * [-1554.681] (-1553.972) (-1553.617) (-1555.825) -- 0:01:59
611500 -- (-1553.190) (-1547.210) [-1545.958] (-1558.006) * (-1548.355) [-1552.773] (-1552.730) (-1557.265) -- 0:01:58
612000 -- (-1560.074) (-1548.819) [-1567.165] (-1551.017) * (-1544.252) [-1551.484] (-1554.390) (-1552.028) -- 0:01:58
612500 -- (-1552.036) (-1557.034) (-1549.605) [-1549.682] * [-1547.186] (-1544.095) (-1563.718) (-1557.799) -- 0:01:58
613000 -- (-1556.432) [-1551.289] (-1555.618) (-1552.408) * (-1548.134) (-1565.653) [-1549.309] (-1554.299) -- 0:01:58
613500 -- [-1550.528] (-1544.683) (-1552.515) (-1564.317) * (-1567.443) [-1544.839] (-1555.824) (-1557.660) -- 0:01:58
614000 -- (-1558.184) (-1557.294) (-1563.092) [-1550.047] * (-1551.275) [-1546.652] (-1553.837) (-1551.071) -- 0:01:58
614500 -- [-1547.994] (-1550.462) (-1556.143) (-1550.577) * (-1563.930) (-1542.731) [-1553.887] (-1550.810) -- 0:01:57
615000 -- [-1547.161] (-1561.467) (-1558.663) (-1557.008) * (-1551.222) [-1550.308] (-1561.894) (-1554.771) -- 0:01:57
Average standard deviation of split frequencies: 0.004428
615500 -- (-1557.857) (-1549.149) [-1546.795] (-1564.940) * (-1550.552) [-1543.873] (-1562.882) (-1553.156) -- 0:01:57
616000 -- (-1556.703) (-1553.798) [-1546.267] (-1560.673) * (-1558.340) (-1558.587) (-1562.042) [-1554.351] -- 0:01:57
616500 -- (-1548.430) (-1564.899) [-1558.783] (-1550.286) * [-1554.005] (-1548.072) (-1556.453) (-1557.735) -- 0:01:57
617000 -- (-1551.526) (-1561.723) (-1562.498) [-1550.994] * (-1554.917) (-1548.835) [-1548.808] (-1559.322) -- 0:01:57
617500 -- (-1559.626) (-1551.027) [-1546.803] (-1576.081) * (-1555.145) (-1570.993) (-1552.987) [-1555.589] -- 0:01:57
618000 -- (-1553.877) (-1547.138) [-1550.733] (-1548.980) * (-1566.607) (-1557.087) (-1564.674) [-1554.198] -- 0:01:56
618500 -- [-1553.561] (-1551.718) (-1550.196) (-1562.813) * (-1562.990) [-1551.666] (-1559.640) (-1559.445) -- 0:01:56
619000 -- (-1548.534) (-1554.686) [-1549.016] (-1548.112) * (-1553.453) (-1552.245) [-1559.863] (-1550.173) -- 0:01:56
619500 -- (-1555.221) (-1548.615) (-1560.140) [-1557.965] * (-1561.596) (-1554.532) [-1550.908] (-1557.374) -- 0:01:56
620000 -- (-1546.022) (-1563.183) (-1556.141) [-1542.539] * [-1543.905] (-1544.689) (-1574.503) (-1556.831) -- 0:01:56
Average standard deviation of split frequencies: 0.004177
620500 -- [-1561.271] (-1563.050) (-1549.360) (-1560.223) * (-1560.023) (-1558.824) (-1558.771) [-1557.132] -- 0:01:56
621000 -- (-1552.871) (-1558.612) (-1557.496) [-1559.077] * (-1559.914) (-1555.387) (-1553.337) [-1555.002] -- 0:01:55
621500 -- (-1554.842) [-1558.778] (-1552.378) (-1551.297) * (-1559.170) (-1560.888) [-1548.231] (-1557.464) -- 0:01:55
622000 -- [-1547.827] (-1548.982) (-1554.867) (-1560.060) * (-1561.288) (-1555.246) (-1557.268) [-1545.137] -- 0:01:55
622500 -- (-1555.479) (-1555.505) [-1552.212] (-1565.266) * (-1567.414) [-1558.793] (-1557.633) (-1555.077) -- 0:01:55
623000 -- (-1562.239) [-1548.873] (-1550.773) (-1551.226) * [-1545.765] (-1551.794) (-1551.447) (-1543.710) -- 0:01:55
623500 -- (-1555.359) (-1550.365) [-1552.445] (-1553.035) * [-1547.765] (-1550.835) (-1551.345) (-1551.139) -- 0:01:55
624000 -- (-1550.409) [-1546.934] (-1556.313) (-1561.912) * (-1548.731) (-1550.652) (-1551.003) [-1548.220] -- 0:01:55
624500 -- (-1551.868) [-1559.923] (-1565.780) (-1563.298) * [-1554.667] (-1557.591) (-1558.665) (-1559.079) -- 0:01:54
625000 -- (-1560.146) (-1558.936) [-1546.520] (-1549.863) * (-1565.816) [-1556.992] (-1551.874) (-1570.276) -- 0:01:54
Average standard deviation of split frequencies: 0.003873
625500 -- (-1566.456) (-1545.956) (-1553.317) [-1553.119] * (-1572.979) [-1545.811] (-1549.763) (-1555.192) -- 0:01:54
626000 -- (-1558.125) [-1547.910] (-1562.526) (-1545.790) * (-1546.690) (-1549.201) (-1548.252) [-1548.160] -- 0:01:54
626500 -- (-1558.293) (-1553.771) (-1563.581) [-1544.806] * (-1554.602) (-1547.663) (-1554.013) [-1547.797] -- 0:01:54
627000 -- (-1544.143) (-1558.281) (-1560.950) [-1540.480] * (-1560.901) (-1560.546) (-1553.653) [-1546.882] -- 0:01:54
627500 -- [-1547.776] (-1552.884) (-1562.216) (-1547.781) * (-1555.930) (-1557.041) [-1552.170] (-1553.114) -- 0:01:53
628000 -- [-1550.882] (-1558.714) (-1547.290) (-1558.919) * (-1556.032) [-1548.290] (-1558.091) (-1560.157) -- 0:01:53
628500 -- (-1560.739) [-1556.817] (-1555.413) (-1555.324) * (-1555.338) (-1563.044) (-1546.643) [-1543.467] -- 0:01:53
629000 -- (-1553.649) (-1564.496) [-1558.743] (-1567.391) * (-1561.697) (-1563.587) (-1547.208) [-1542.828] -- 0:01:53
629500 -- [-1550.609] (-1552.547) (-1561.220) (-1545.404) * [-1551.424] (-1555.677) (-1554.067) (-1543.806) -- 0:01:53
630000 -- [-1549.429] (-1554.345) (-1552.468) (-1563.699) * (-1559.768) [-1549.338] (-1553.490) (-1543.229) -- 0:01:53
Average standard deviation of split frequencies: 0.003951
630500 -- (-1561.351) [-1546.533] (-1566.787) (-1552.533) * [-1552.385] (-1548.329) (-1548.128) (-1551.057) -- 0:01:53
631000 -- (-1559.687) (-1547.997) [-1543.962] (-1555.661) * (-1557.356) [-1553.578] (-1560.026) (-1556.090) -- 0:01:52
631500 -- (-1549.135) (-1556.681) [-1551.007] (-1543.265) * (-1555.044) [-1552.067] (-1563.181) (-1565.757) -- 0:01:52
632000 -- (-1551.305) (-1546.862) (-1552.074) [-1552.853] * (-1553.944) [-1554.679] (-1556.935) (-1559.315) -- 0:01:52
632500 -- (-1555.536) [-1551.221] (-1557.355) (-1557.675) * (-1561.170) (-1564.369) (-1548.760) [-1545.350] -- 0:01:52
633000 -- (-1557.727) [-1547.724] (-1558.718) (-1544.562) * (-1565.432) [-1551.743] (-1554.276) (-1554.694) -- 0:01:52
633500 -- (-1573.352) (-1552.425) (-1553.700) [-1546.331] * [-1552.205] (-1560.161) (-1546.587) (-1549.313) -- 0:01:52
634000 -- (-1573.390) [-1546.569] (-1555.754) (-1552.004) * (-1561.756) [-1553.891] (-1557.592) (-1565.117) -- 0:01:51
634500 -- (-1562.551) (-1554.892) (-1558.984) [-1550.629] * (-1557.437) (-1549.640) (-1556.368) [-1548.914] -- 0:01:51
635000 -- (-1566.294) (-1572.079) (-1572.635) [-1545.758] * (-1557.640) (-1559.613) [-1549.695] (-1558.848) -- 0:01:51
Average standard deviation of split frequencies: 0.004341
635500 -- (-1572.568) (-1554.699) (-1563.546) [-1548.947] * (-1557.636) (-1555.308) (-1549.256) [-1549.468] -- 0:01:51
636000 -- [-1554.275] (-1553.606) (-1557.690) (-1551.021) * (-1557.156) (-1549.525) (-1551.790) [-1544.052] -- 0:01:51
636500 -- (-1550.998) (-1554.967) [-1549.499] (-1552.972) * (-1559.214) [-1550.970] (-1552.928) (-1553.512) -- 0:01:51
637000 -- [-1549.720] (-1546.786) (-1562.196) (-1565.644) * (-1557.396) (-1562.187) [-1547.830] (-1542.528) -- 0:01:51
637500 -- [-1544.821] (-1550.589) (-1564.256) (-1555.034) * (-1552.270) [-1544.385] (-1556.029) (-1546.850) -- 0:01:50
638000 -- (-1544.924) (-1553.287) (-1557.831) [-1551.464] * [-1543.238] (-1555.839) (-1547.764) (-1547.818) -- 0:01:50
638500 -- (-1555.737) (-1562.708) (-1565.657) [-1554.727] * (-1554.075) [-1552.590] (-1559.029) (-1547.535) -- 0:01:50
639000 -- (-1557.424) [-1553.349] (-1555.365) (-1556.131) * (-1556.667) [-1543.575] (-1552.034) (-1546.377) -- 0:01:50
639500 -- (-1549.323) (-1555.615) (-1551.632) [-1546.535] * (-1560.863) (-1541.852) [-1542.328] (-1542.377) -- 0:01:50
640000 -- [-1548.636] (-1556.345) (-1554.990) (-1551.300) * [-1545.465] (-1559.706) (-1549.942) (-1553.451) -- 0:01:50
Average standard deviation of split frequencies: 0.004310
640500 -- [-1558.778] (-1557.175) (-1544.305) (-1561.141) * [-1549.384] (-1550.883) (-1549.309) (-1564.478) -- 0:01:50
641000 -- (-1550.865) [-1553.899] (-1555.147) (-1564.797) * [-1547.215] (-1552.646) (-1554.804) (-1547.388) -- 0:01:49
641500 -- (-1551.803) [-1560.555] (-1556.292) (-1576.199) * (-1553.047) (-1555.727) [-1546.805] (-1555.607) -- 0:01:49
642000 -- (-1560.308) (-1552.766) (-1572.117) [-1560.394] * (-1551.703) [-1552.792] (-1548.586) (-1548.792) -- 0:01:49
642500 -- [-1553.516] (-1549.570) (-1548.794) (-1557.942) * (-1558.892) (-1549.588) (-1555.949) [-1553.327] -- 0:01:49
643000 -- (-1549.291) (-1557.310) (-1558.665) [-1553.811] * (-1549.063) (-1555.226) (-1548.848) [-1548.004] -- 0:01:49
643500 -- (-1547.581) (-1546.942) (-1556.137) [-1548.219] * [-1550.470] (-1554.221) (-1556.511) (-1562.231) -- 0:01:49
644000 -- [-1555.072] (-1553.403) (-1564.782) (-1550.574) * [-1544.958] (-1550.422) (-1558.478) (-1560.346) -- 0:01:48
644500 -- (-1555.393) [-1544.613] (-1547.108) (-1553.554) * (-1553.170) (-1555.019) [-1544.457] (-1562.707) -- 0:01:48
645000 -- (-1551.528) (-1549.837) [-1553.880] (-1570.297) * (-1557.763) (-1548.870) [-1561.338] (-1552.574) -- 0:01:48
Average standard deviation of split frequencies: 0.003909
645500 -- (-1557.980) (-1548.658) [-1549.857] (-1552.171) * [-1547.880] (-1554.360) (-1563.445) (-1560.073) -- 0:01:48
646000 -- (-1548.053) (-1553.215) (-1549.091) [-1555.922] * (-1555.127) (-1553.838) (-1562.998) [-1557.610] -- 0:01:48
646500 -- [-1547.652] (-1551.637) (-1553.929) (-1551.270) * [-1548.177] (-1555.559) (-1552.042) (-1549.055) -- 0:01:48
647000 -- [-1546.374] (-1549.243) (-1558.484) (-1556.150) * [-1555.209] (-1548.442) (-1558.575) (-1553.619) -- 0:01:48
647500 -- [-1558.084] (-1568.311) (-1571.531) (-1551.859) * (-1552.513) (-1553.499) (-1552.903) [-1555.010] -- 0:01:47
648000 -- (-1544.735) [-1559.704] (-1553.550) (-1553.429) * [-1546.812] (-1544.344) (-1556.520) (-1553.469) -- 0:01:47
648500 -- [-1548.288] (-1558.463) (-1558.799) (-1559.176) * [-1550.185] (-1545.468) (-1560.832) (-1554.688) -- 0:01:47
649000 -- (-1557.891) (-1558.682) [-1555.738] (-1548.994) * (-1557.720) [-1549.470] (-1565.061) (-1551.549) -- 0:01:47
649500 -- [-1544.770] (-1545.070) (-1557.195) (-1553.100) * (-1555.155) (-1562.504) [-1560.367] (-1554.511) -- 0:01:47
650000 -- [-1567.255] (-1542.710) (-1557.253) (-1554.907) * (-1561.965) (-1553.987) (-1551.475) [-1543.622] -- 0:01:47
Average standard deviation of split frequencies: 0.004295
650500 -- (-1550.479) (-1546.443) [-1550.198] (-1547.877) * [-1549.021] (-1547.282) (-1567.853) (-1556.366) -- 0:01:46
651000 -- (-1548.955) (-1553.907) [-1548.749] (-1552.253) * (-1571.238) (-1552.719) [-1558.224] (-1557.139) -- 0:01:46
651500 -- (-1556.090) (-1565.947) [-1550.062] (-1557.135) * [-1545.471] (-1568.221) (-1557.811) (-1556.626) -- 0:01:46
652000 -- [-1547.331] (-1556.394) (-1558.786) (-1552.363) * (-1549.133) (-1560.829) (-1559.590) [-1548.386] -- 0:01:46
652500 -- (-1552.276) [-1557.434] (-1553.774) (-1569.008) * [-1548.390] (-1561.561) (-1577.956) (-1560.455) -- 0:01:46
653000 -- (-1548.965) (-1565.520) [-1546.736] (-1557.628) * (-1550.934) (-1551.565) (-1555.239) [-1547.603] -- 0:01:46
653500 -- (-1565.846) (-1543.477) [-1548.410] (-1568.276) * (-1556.813) [-1549.478] (-1557.062) (-1550.437) -- 0:01:46
654000 -- (-1559.743) (-1565.110) (-1554.312) [-1554.485] * (-1555.864) (-1553.839) [-1566.616] (-1553.071) -- 0:01:45
654500 -- [-1548.972] (-1551.671) (-1549.122) (-1543.952) * (-1558.227) [-1553.633] (-1550.390) (-1555.489) -- 0:01:45
655000 -- (-1551.667) (-1549.418) (-1556.362) [-1554.271] * (-1553.689) (-1556.020) (-1565.795) [-1554.304] -- 0:01:45
Average standard deviation of split frequencies: 0.004004
655500 -- (-1559.103) (-1547.395) (-1555.804) [-1554.148] * (-1558.082) (-1563.692) [-1547.944] (-1554.397) -- 0:01:45
656000 -- (-1552.074) (-1556.581) [-1543.698] (-1549.283) * (-1550.856) (-1564.759) [-1547.607] (-1564.827) -- 0:01:45
656500 -- (-1550.790) (-1570.143) [-1548.056] (-1547.923) * (-1548.974) (-1552.374) [-1545.918] (-1548.992) -- 0:01:45
657000 -- (-1555.858) (-1547.513) [-1553.911] (-1559.303) * (-1563.593) (-1554.236) (-1561.968) [-1543.283] -- 0:01:44
657500 -- (-1551.024) (-1552.007) (-1550.976) [-1550.779] * (-1553.408) (-1570.098) (-1542.745) [-1547.257] -- 0:01:44
658000 -- (-1563.792) (-1550.026) (-1556.468) [-1561.483] * (-1551.622) (-1552.785) [-1549.563] (-1551.811) -- 0:01:44
658500 -- (-1553.178) (-1545.196) (-1554.620) [-1555.163] * (-1562.021) [-1549.115] (-1559.426) (-1561.131) -- 0:01:44
659000 -- [-1550.653] (-1570.336) (-1557.236) (-1553.181) * (-1553.899) (-1552.193) [-1551.031] (-1546.555) -- 0:01:44
659500 -- (-1546.154) (-1553.115) [-1560.465] (-1551.351) * (-1558.540) (-1550.890) (-1543.730) [-1549.187] -- 0:01:44
660000 -- (-1551.721) (-1552.438) (-1555.228) [-1547.830] * (-1552.074) [-1551.227] (-1550.689) (-1564.606) -- 0:01:44
Average standard deviation of split frequencies: 0.003924
660500 -- (-1550.005) (-1554.071) [-1561.981] (-1548.907) * (-1557.219) (-1563.355) [-1546.621] (-1548.290) -- 0:01:43
661000 -- (-1551.891) [-1553.701] (-1579.352) (-1551.255) * (-1567.798) (-1556.107) [-1542.923] (-1554.630) -- 0:01:43
661500 -- (-1556.264) (-1570.514) [-1556.018] (-1555.586) * [-1548.442] (-1567.635) (-1567.801) (-1546.167) -- 0:01:43
662000 -- (-1548.349) (-1551.835) [-1556.110] (-1560.320) * (-1546.641) (-1554.666) [-1550.720] (-1549.147) -- 0:01:43
662500 -- (-1551.923) (-1553.992) (-1559.122) [-1556.261] * (-1553.547) (-1557.272) (-1553.566) [-1548.931] -- 0:01:43
663000 -- (-1558.854) (-1546.184) [-1542.471] (-1551.405) * (-1548.636) (-1554.121) [-1551.511] (-1551.842) -- 0:01:43
663500 -- [-1547.740] (-1545.273) (-1550.688) (-1556.733) * [-1552.217] (-1559.818) (-1577.642) (-1553.363) -- 0:01:42
664000 -- (-1542.947) (-1556.362) (-1553.426) [-1550.517] * (-1563.689) (-1560.722) [-1561.623] (-1561.849) -- 0:01:42
664500 -- [-1552.540] (-1564.498) (-1568.811) (-1549.875) * [-1553.146] (-1553.963) (-1554.963) (-1559.836) -- 0:01:42
665000 -- (-1545.730) (-1561.556) (-1554.422) [-1542.525] * [-1547.171] (-1554.397) (-1551.367) (-1558.919) -- 0:01:42
Average standard deviation of split frequencies: 0.003741
665500 -- [-1553.837] (-1570.167) (-1552.285) (-1545.396) * (-1555.944) [-1554.348] (-1560.613) (-1560.532) -- 0:01:42
666000 -- (-1550.671) (-1562.061) [-1550.906] (-1561.879) * (-1551.675) (-1566.298) (-1562.055) [-1551.595] -- 0:01:42
666500 -- [-1551.321] (-1563.702) (-1561.266) (-1552.467) * (-1558.327) (-1548.942) [-1552.822] (-1549.011) -- 0:01:42
667000 -- (-1549.243) (-1568.667) [-1544.735] (-1551.241) * [-1555.602] (-1549.911) (-1563.967) (-1551.175) -- 0:01:41
667500 -- (-1548.641) (-1578.751) (-1557.115) [-1559.446] * (-1557.090) (-1553.224) [-1553.000] (-1550.648) -- 0:01:41
668000 -- (-1570.958) [-1549.926] (-1562.525) (-1564.032) * (-1554.276) (-1556.730) [-1563.091] (-1561.198) -- 0:01:41
668500 -- [-1550.301] (-1560.601) (-1560.549) (-1555.096) * (-1550.168) [-1553.892] (-1556.451) (-1561.067) -- 0:01:41
669000 -- [-1551.348] (-1543.635) (-1562.539) (-1557.195) * (-1557.258) (-1559.863) (-1548.654) [-1548.422] -- 0:01:41
669500 -- (-1552.937) (-1564.740) (-1569.219) [-1568.037] * (-1565.182) [-1560.008] (-1551.885) (-1548.319) -- 0:01:41
670000 -- (-1556.889) (-1558.823) (-1566.774) [-1560.114] * [-1549.305] (-1559.733) (-1561.664) (-1561.625) -- 0:01:40
Average standard deviation of split frequencies: 0.003866
670500 -- (-1554.061) (-1577.241) [-1560.035] (-1548.359) * (-1551.159) (-1561.253) (-1551.046) [-1549.716] -- 0:01:40
671000 -- (-1543.011) (-1563.189) (-1570.767) [-1555.558] * (-1553.661) [-1552.143] (-1558.153) (-1555.424) -- 0:01:40
671500 -- [-1553.039] (-1559.167) (-1559.425) (-1556.618) * [-1557.457] (-1563.615) (-1563.464) (-1560.094) -- 0:01:40
672000 -- (-1562.522) [-1547.552] (-1553.862) (-1558.447) * (-1549.892) (-1570.231) [-1550.002] (-1555.909) -- 0:01:40
672500 -- (-1559.714) (-1555.940) (-1557.985) [-1547.208] * (-1551.270) (-1551.366) (-1562.045) [-1548.503] -- 0:01:40
673000 -- (-1557.543) [-1543.986] (-1562.226) (-1562.673) * (-1559.016) (-1554.017) (-1562.115) [-1546.350] -- 0:01:40
673500 -- (-1556.598) [-1556.981] (-1552.764) (-1553.162) * (-1550.082) (-1558.912) (-1551.546) [-1544.363] -- 0:01:39
674000 -- (-1559.713) (-1555.121) [-1545.485] (-1569.909) * (-1553.431) (-1549.990) [-1549.325] (-1554.562) -- 0:01:39
674500 -- (-1559.822) [-1565.671] (-1551.054) (-1563.295) * (-1550.939) [-1554.541] (-1548.399) (-1568.562) -- 0:01:39
675000 -- (-1556.098) (-1558.720) (-1552.905) [-1554.111] * (-1552.201) (-1561.099) (-1552.946) [-1555.626] -- 0:01:39
Average standard deviation of split frequencies: 0.004084
675500 -- (-1550.652) (-1559.178) (-1543.906) [-1554.646] * (-1552.293) [-1545.967] (-1569.020) (-1552.169) -- 0:01:39
676000 -- (-1554.048) (-1559.599) [-1549.617] (-1552.882) * (-1553.929) (-1554.240) (-1553.642) [-1548.749] -- 0:01:39
676500 -- (-1558.943) (-1567.419) (-1546.148) [-1547.886] * (-1562.249) (-1557.717) [-1555.864] (-1553.427) -- 0:01:38
677000 -- [-1549.318] (-1554.219) (-1559.712) (-1548.868) * [-1543.079] (-1567.977) (-1544.346) (-1556.396) -- 0:01:38
677500 -- (-1562.076) (-1550.169) (-1560.448) [-1547.976] * [-1546.047] (-1556.635) (-1550.760) (-1566.880) -- 0:01:38
678000 -- (-1565.031) (-1546.211) (-1559.828) [-1542.817] * [-1551.331] (-1561.149) (-1553.036) (-1557.799) -- 0:01:38
678500 -- (-1557.216) [-1553.527] (-1564.125) (-1555.757) * (-1551.030) (-1564.857) [-1546.636] (-1551.886) -- 0:01:38
679000 -- (-1549.719) (-1550.555) [-1545.149] (-1546.378) * (-1560.633) (-1555.954) (-1554.217) [-1553.825] -- 0:01:38
679500 -- (-1555.451) (-1546.510) (-1546.546) [-1549.438] * [-1550.236] (-1556.855) (-1556.441) (-1555.230) -- 0:01:38
680000 -- [-1546.598] (-1556.710) (-1553.784) (-1553.405) * [-1546.141] (-1565.244) (-1557.504) (-1569.573) -- 0:01:37
Average standard deviation of split frequencies: 0.004353
680500 -- (-1553.745) [-1547.080] (-1552.974) (-1553.720) * (-1550.903) [-1547.728] (-1556.085) (-1557.396) -- 0:01:37
681000 -- (-1557.937) (-1560.970) (-1566.761) [-1543.983] * (-1550.564) (-1555.880) (-1551.862) [-1560.205] -- 0:01:37
681500 -- [-1548.351] (-1553.914) (-1548.089) (-1550.120) * (-1547.857) (-1564.662) [-1545.034] (-1560.613) -- 0:01:37
682000 -- [-1548.701] (-1558.234) (-1558.031) (-1544.222) * [-1553.236] (-1546.231) (-1563.966) (-1549.478) -- 0:01:37
682500 -- (-1555.379) (-1547.973) [-1556.382] (-1553.091) * (-1549.750) (-1565.137) (-1556.688) [-1546.267] -- 0:01:37
683000 -- (-1555.978) (-1556.667) (-1558.384) [-1551.867] * (-1564.042) (-1549.350) [-1553.530] (-1552.849) -- 0:01:37
683500 -- (-1553.707) (-1556.362) (-1560.930) [-1553.213] * (-1564.856) (-1546.825) (-1550.518) [-1558.810] -- 0:01:36
684000 -- (-1553.633) (-1552.205) [-1553.346] (-1561.724) * [-1554.750] (-1560.545) (-1558.110) (-1565.719) -- 0:01:36
684500 -- (-1544.272) (-1565.493) (-1553.943) [-1556.348] * (-1556.248) (-1556.250) (-1549.076) [-1543.753] -- 0:01:36
685000 -- (-1551.574) (-1550.419) [-1557.039] (-1553.393) * (-1545.066) (-1569.895) [-1552.346] (-1547.516) -- 0:01:36
Average standard deviation of split frequencies: 0.004270
685500 -- (-1546.809) (-1548.851) (-1558.519) [-1545.912] * [-1548.383] (-1556.735) (-1555.353) (-1555.790) -- 0:01:36
686000 -- (-1554.165) [-1550.322] (-1571.333) (-1553.156) * (-1551.017) (-1557.171) [-1551.912] (-1553.013) -- 0:01:36
686500 -- (-1554.833) [-1554.631] (-1549.392) (-1550.103) * (-1557.063) [-1558.331] (-1559.474) (-1560.838) -- 0:01:35
687000 -- [-1543.919] (-1543.229) (-1554.742) (-1558.146) * (-1566.251) (-1553.374) (-1561.507) [-1557.766] -- 0:01:35
687500 -- (-1552.972) [-1558.685] (-1552.946) (-1556.217) * (-1549.614) [-1556.505] (-1553.533) (-1566.779) -- 0:01:35
688000 -- (-1550.256) (-1551.634) (-1557.030) [-1552.800] * [-1551.439] (-1561.130) (-1557.487) (-1565.814) -- 0:01:35
688500 -- (-1551.284) (-1556.727) [-1545.590] (-1544.834) * (-1546.895) (-1550.255) [-1548.258] (-1557.515) -- 0:01:35
689000 -- [-1548.755] (-1566.980) (-1555.921) (-1554.865) * [-1550.396] (-1557.890) (-1554.145) (-1555.856) -- 0:01:35
689500 -- (-1556.782) (-1558.045) [-1551.172] (-1557.023) * (-1548.276) [-1547.412] (-1546.195) (-1559.291) -- 0:01:35
690000 -- (-1559.427) (-1570.100) [-1546.506] (-1551.313) * (-1558.490) [-1555.028] (-1558.100) (-1553.586) -- 0:01:34
Average standard deviation of split frequencies: 0.004436
690500 -- [-1546.007] (-1567.263) (-1551.257) (-1565.534) * (-1562.652) (-1559.364) (-1560.102) [-1549.965] -- 0:01:34
691000 -- [-1560.928] (-1553.240) (-1559.628) (-1557.301) * (-1553.039) [-1555.996] (-1564.209) (-1571.468) -- 0:01:34
691500 -- [-1555.674] (-1549.830) (-1546.291) (-1559.518) * [-1548.748] (-1549.780) (-1560.191) (-1556.296) -- 0:01:34
692000 -- [-1550.122] (-1561.755) (-1552.165) (-1556.557) * (-1548.572) (-1555.859) (-1555.502) [-1552.603] -- 0:01:34
692500 -- (-1559.133) (-1546.783) (-1561.808) [-1553.503] * [-1552.557] (-1567.773) (-1563.885) (-1549.727) -- 0:01:34
693000 -- (-1552.431) [-1545.416] (-1557.557) (-1556.760) * [-1553.438] (-1558.389) (-1562.005) (-1561.760) -- 0:01:33
693500 -- (-1552.666) [-1550.744] (-1561.866) (-1549.575) * (-1549.356) [-1550.492] (-1569.533) (-1556.291) -- 0:01:33
694000 -- [-1561.393] (-1552.839) (-1555.036) (-1566.151) * [-1551.088] (-1556.920) (-1552.595) (-1557.145) -- 0:01:33
694500 -- [-1541.397] (-1559.875) (-1566.829) (-1568.717) * (-1548.256) (-1556.086) [-1544.301] (-1561.231) -- 0:01:33
695000 -- [-1547.009] (-1553.077) (-1553.996) (-1554.490) * (-1556.190) (-1553.064) [-1555.719] (-1552.022) -- 0:01:33
Average standard deviation of split frequencies: 0.004306
695500 -- (-1549.408) (-1554.169) (-1564.453) [-1552.695] * [-1545.940] (-1568.229) (-1546.141) (-1553.095) -- 0:01:33
696000 -- [-1558.378] (-1554.803) (-1548.143) (-1553.992) * [-1541.556] (-1553.734) (-1557.174) (-1552.493) -- 0:01:33
696500 -- [-1549.584] (-1568.350) (-1575.615) (-1552.563) * (-1565.683) (-1559.442) [-1550.579] (-1555.257) -- 0:01:32
697000 -- (-1558.046) [-1555.642] (-1563.948) (-1554.572) * (-1561.425) (-1563.957) [-1553.330] (-1551.819) -- 0:01:32
697500 -- (-1561.787) (-1554.973) (-1558.200) [-1549.600] * (-1552.978) (-1552.631) [-1550.867] (-1546.976) -- 0:01:32
698000 -- (-1551.567) (-1551.327) [-1559.832] (-1557.010) * [-1547.482] (-1560.297) (-1543.604) (-1556.233) -- 0:01:32
698500 -- [-1548.803] (-1552.953) (-1567.959) (-1556.191) * (-1552.003) (-1553.663) (-1552.451) [-1543.349] -- 0:01:32
699000 -- (-1574.519) [-1541.882] (-1549.559) (-1578.289) * [-1570.080] (-1555.850) (-1571.074) (-1559.442) -- 0:01:32
699500 -- (-1559.634) (-1554.523) [-1545.253] (-1570.363) * (-1560.924) (-1552.349) [-1562.279] (-1548.439) -- 0:01:31
700000 -- (-1557.143) (-1552.700) (-1549.630) [-1551.115] * (-1589.584) [-1556.786] (-1564.366) (-1552.322) -- 0:01:31
Average standard deviation of split frequencies: 0.004517
700500 -- (-1549.627) [-1543.749] (-1557.252) (-1561.127) * (-1560.339) (-1547.212) (-1553.009) [-1544.462] -- 0:01:31
701000 -- (-1569.525) (-1549.961) [-1546.501] (-1550.649) * (-1555.354) (-1547.214) (-1566.768) [-1549.412] -- 0:01:31
701500 -- [-1556.360] (-1550.139) (-1555.569) (-1554.742) * (-1552.421) (-1551.505) (-1550.699) [-1551.124] -- 0:01:31
702000 -- (-1554.228) [-1539.370] (-1551.273) (-1555.495) * (-1551.872) [-1552.632] (-1563.470) (-1559.142) -- 0:01:31
702500 -- [-1550.263] (-1551.820) (-1552.776) (-1582.697) * [-1557.777] (-1550.680) (-1558.108) (-1551.118) -- 0:01:31
703000 -- (-1548.501) [-1548.270] (-1562.961) (-1550.186) * (-1548.437) (-1550.260) (-1573.174) [-1545.447] -- 0:01:30
703500 -- (-1560.015) [-1544.143] (-1575.886) (-1557.358) * (-1554.709) (-1554.304) (-1570.962) [-1555.514] -- 0:01:30
704000 -- (-1559.119) (-1552.332) [-1556.257] (-1548.492) * (-1562.393) (-1547.079) (-1570.434) [-1548.904] -- 0:01:30
704500 -- (-1547.720) (-1558.591) [-1565.304] (-1547.381) * (-1556.630) (-1558.166) (-1566.752) [-1552.293] -- 0:01:30
705000 -- (-1546.150) (-1548.970) [-1546.172] (-1553.435) * (-1549.444) (-1549.753) (-1556.206) [-1547.779] -- 0:01:30
Average standard deviation of split frequencies: 0.004197
705500 -- (-1555.478) (-1559.366) (-1561.388) [-1550.962] * (-1558.282) (-1551.408) (-1569.104) [-1549.156] -- 0:01:30
706000 -- (-1553.103) [-1553.255] (-1560.259) (-1544.259) * (-1559.957) [-1551.771] (-1556.826) (-1553.253) -- 0:01:29
706500 -- (-1560.477) [-1543.201] (-1562.589) (-1541.647) * (-1562.062) (-1545.766) [-1548.629] (-1561.790) -- 0:01:29
707000 -- (-1556.781) [-1551.807] (-1548.781) (-1548.361) * [-1550.258] (-1544.324) (-1564.263) (-1557.079) -- 0:01:29
707500 -- (-1563.929) [-1558.520] (-1554.144) (-1548.198) * (-1559.969) [-1550.913] (-1560.755) (-1572.332) -- 0:01:29
708000 -- [-1549.089] (-1553.409) (-1560.077) (-1560.939) * [-1545.312] (-1551.749) (-1559.257) (-1555.662) -- 0:01:29
708500 -- (-1558.507) (-1557.624) [-1544.325] (-1558.931) * (-1557.395) [-1549.201] (-1548.118) (-1558.465) -- 0:01:29
709000 -- [-1554.707] (-1554.249) (-1561.417) (-1563.822) * (-1553.774) (-1558.506) [-1553.006] (-1560.682) -- 0:01:29
709500 -- [-1545.412] (-1563.436) (-1548.461) (-1558.288) * (-1551.776) (-1555.201) (-1551.062) [-1554.069] -- 0:01:28
710000 -- (-1552.931) (-1552.372) [-1548.701] (-1548.654) * (-1546.650) (-1558.535) [-1560.826] (-1545.113) -- 0:01:28
Average standard deviation of split frequencies: 0.004217
710500 -- [-1541.271] (-1542.558) (-1546.911) (-1559.036) * (-1561.561) (-1557.708) (-1560.970) [-1550.701] -- 0:01:28
711000 -- [-1550.146] (-1555.683) (-1559.774) (-1561.602) * [-1550.042] (-1558.983) (-1551.849) (-1556.916) -- 0:01:28
711500 -- (-1548.622) (-1559.733) (-1553.266) [-1544.924] * (-1572.563) (-1549.832) [-1557.976] (-1548.409) -- 0:01:28
712000 -- (-1555.310) (-1559.982) [-1549.016] (-1550.899) * [-1552.819] (-1548.704) (-1569.570) (-1551.493) -- 0:01:28
712500 -- [-1551.364] (-1548.931) (-1555.727) (-1557.408) * [-1547.668] (-1561.120) (-1561.941) (-1550.612) -- 0:01:27
713000 -- (-1550.575) [-1547.850] (-1550.338) (-1548.681) * (-1554.663) (-1572.395) [-1544.882] (-1559.733) -- 0:01:27
713500 -- (-1553.645) [-1550.331] (-1552.539) (-1556.822) * (-1556.420) (-1559.700) (-1559.519) [-1555.519] -- 0:01:27
714000 -- (-1555.515) [-1553.739] (-1555.478) (-1564.351) * (-1554.147) (-1574.005) [-1546.741] (-1563.143) -- 0:01:27
714500 -- (-1562.052) (-1557.121) (-1564.744) [-1546.720] * (-1561.910) [-1546.272] (-1558.283) (-1557.982) -- 0:01:27
715000 -- [-1554.372] (-1551.700) (-1558.959) (-1558.512) * (-1573.023) (-1560.690) (-1555.469) [-1552.462] -- 0:01:27
Average standard deviation of split frequencies: 0.004138
715500 -- (-1551.564) [-1553.264] (-1558.093) (-1563.234) * [-1567.147] (-1559.000) (-1551.449) (-1561.836) -- 0:01:27
716000 -- (-1565.352) (-1558.945) [-1547.949] (-1551.854) * (-1555.422) (-1559.953) (-1543.497) [-1552.106] -- 0:01:26
716500 -- (-1560.250) (-1556.578) (-1556.624) [-1553.722] * (-1546.693) (-1566.378) [-1541.256] (-1546.847) -- 0:01:26
717000 -- [-1553.342] (-1550.169) (-1559.176) (-1550.665) * [-1554.024] (-1555.347) (-1555.650) (-1549.708) -- 0:01:26
717500 -- (-1556.412) (-1548.722) (-1556.142) [-1555.539] * (-1552.824) (-1561.658) (-1549.355) [-1546.521] -- 0:01:26
718000 -- (-1553.295) (-1551.811) [-1557.783] (-1560.353) * [-1546.851] (-1561.168) (-1555.219) (-1561.646) -- 0:01:26
718500 -- [-1557.295] (-1555.600) (-1549.934) (-1551.044) * (-1547.397) [-1555.709] (-1552.386) (-1553.806) -- 0:01:26
719000 -- (-1547.174) [-1551.159] (-1558.038) (-1558.221) * (-1556.239) [-1549.370] (-1551.642) (-1571.122) -- 0:01:25
719500 -- (-1551.368) [-1556.188] (-1563.844) (-1556.426) * [-1554.297] (-1551.528) (-1556.406) (-1553.204) -- 0:01:25
720000 -- (-1550.859) (-1556.610) [-1554.734] (-1556.154) * (-1559.502) [-1558.880] (-1559.035) (-1560.259) -- 0:01:25
Average standard deviation of split frequencies: 0.003738
720500 -- (-1551.596) [-1552.635] (-1572.107) (-1556.859) * [-1548.074] (-1564.611) (-1553.085) (-1546.658) -- 0:01:25
721000 -- (-1558.353) [-1556.273] (-1563.761) (-1550.922) * (-1560.295) (-1566.343) [-1543.842] (-1546.961) -- 0:01:25
721500 -- (-1541.042) (-1543.629) [-1549.272] (-1556.325) * (-1562.528) [-1556.451] (-1553.694) (-1554.060) -- 0:01:25
722000 -- (-1563.107) (-1549.380) [-1554.190] (-1546.354) * (-1558.432) [-1553.589] (-1548.410) (-1562.501) -- 0:01:25
722500 -- (-1551.977) [-1550.590] (-1548.819) (-1552.460) * (-1553.209) [-1553.296] (-1555.884) (-1558.537) -- 0:01:24
723000 -- [-1554.174] (-1567.038) (-1545.550) (-1552.217) * (-1551.079) (-1565.339) [-1550.969] (-1566.352) -- 0:01:24
723500 -- (-1557.842) (-1553.323) [-1546.000] (-1557.936) * (-1551.977) (-1560.753) (-1563.923) [-1549.100] -- 0:01:24
724000 -- (-1553.449) (-1557.753) (-1543.675) [-1550.233] * [-1553.731] (-1552.811) (-1558.870) (-1552.308) -- 0:01:24
724500 -- [-1544.677] (-1549.836) (-1562.628) (-1556.534) * [-1552.319] (-1555.595) (-1558.555) (-1543.357) -- 0:01:24
725000 -- (-1559.886) (-1551.725) [-1553.159] (-1549.975) * [-1551.861] (-1553.764) (-1544.157) (-1554.941) -- 0:01:24
Average standard deviation of split frequencies: 0.003757
725500 -- (-1556.685) (-1552.521) (-1557.073) [-1550.243] * [-1547.895] (-1563.614) (-1549.244) (-1550.393) -- 0:01:23
726000 -- [-1547.912] (-1548.004) (-1549.423) (-1569.677) * [-1544.641] (-1558.083) (-1549.735) (-1556.087) -- 0:01:23
726500 -- (-1555.716) [-1553.755] (-1560.041) (-1557.277) * (-1568.958) (-1554.450) (-1567.816) [-1558.084] -- 0:01:23
727000 -- (-1556.011) [-1555.385] (-1550.317) (-1569.341) * (-1553.356) [-1560.812] (-1552.378) (-1548.140) -- 0:01:23
727500 -- (-1553.881) [-1547.676] (-1545.437) (-1554.967) * (-1563.163) (-1554.778) (-1556.113) [-1558.454] -- 0:01:23
728000 -- [-1548.956] (-1566.091) (-1562.227) (-1552.428) * (-1556.421) (-1556.316) [-1554.136] (-1549.223) -- 0:01:23
728500 -- (-1555.098) (-1548.109) (-1559.320) [-1550.961] * (-1565.485) (-1553.201) [-1551.214] (-1559.237) -- 0:01:23
729000 -- (-1551.585) (-1554.366) [-1554.919] (-1572.950) * (-1556.700) [-1547.530] (-1553.464) (-1554.606) -- 0:01:22
729500 -- (-1556.982) [-1549.846] (-1558.994) (-1565.065) * [-1551.138] (-1568.908) (-1556.157) (-1549.703) -- 0:01:22
730000 -- (-1557.327) (-1544.768) [-1555.744] (-1548.836) * (-1548.389) [-1550.933] (-1549.621) (-1554.925) -- 0:01:22
Average standard deviation of split frequencies: 0.003641
730500 -- (-1556.495) [-1548.373] (-1557.542) (-1553.451) * (-1547.779) (-1555.587) (-1550.286) [-1543.703] -- 0:01:22
731000 -- [-1554.607] (-1557.371) (-1554.132) (-1560.200) * [-1546.260] (-1547.282) (-1561.774) (-1567.946) -- 0:01:22
731500 -- [-1548.936] (-1562.513) (-1552.350) (-1560.878) * (-1549.619) [-1555.215] (-1559.306) (-1549.596) -- 0:01:22
732000 -- [-1554.045] (-1556.444) (-1548.803) (-1558.822) * (-1562.089) (-1555.593) [-1548.983] (-1557.300) -- 0:01:22
732500 -- (-1546.377) (-1553.921) [-1546.765] (-1557.388) * [-1559.169] (-1549.268) (-1552.951) (-1553.713) -- 0:01:21
733000 -- [-1557.541] (-1550.084) (-1557.432) (-1546.719) * (-1569.362) (-1564.441) [-1546.452] (-1552.245) -- 0:01:21
733500 -- (-1558.993) (-1561.366) (-1558.646) [-1546.285] * (-1550.709) (-1553.001) [-1548.270] (-1571.120) -- 0:01:21
734000 -- (-1548.663) [-1549.311] (-1559.919) (-1553.236) * (-1550.532) (-1559.384) (-1548.088) [-1549.946] -- 0:01:21
734500 -- [-1547.089] (-1548.461) (-1548.877) (-1561.851) * (-1556.968) [-1560.564] (-1552.957) (-1548.419) -- 0:01:21
735000 -- [-1549.434] (-1544.608) (-1560.739) (-1553.386) * (-1553.099) (-1550.677) [-1544.087] (-1563.988) -- 0:01:21
Average standard deviation of split frequencies: 0.004529
735500 -- [-1551.953] (-1557.519) (-1559.474) (-1553.806) * (-1556.018) (-1544.413) [-1546.792] (-1553.135) -- 0:01:20
736000 -- [-1548.480] (-1563.375) (-1553.848) (-1562.487) * (-1551.265) [-1546.321] (-1568.863) (-1557.609) -- 0:01:20
736500 -- (-1568.258) [-1548.499] (-1563.371) (-1554.010) * (-1562.779) [-1551.327] (-1546.978) (-1557.887) -- 0:01:20
737000 -- (-1564.636) [-1544.411] (-1552.235) (-1552.431) * (-1559.619) (-1546.950) [-1551.933] (-1567.983) -- 0:01:20
737500 -- (-1551.261) (-1548.464) [-1556.675] (-1552.659) * [-1548.961] (-1551.169) (-1554.585) (-1570.047) -- 0:01:20
738000 -- (-1559.966) (-1544.023) (-1555.661) [-1544.810] * (-1556.092) [-1550.900] (-1573.426) (-1556.646) -- 0:01:20
738500 -- (-1558.687) [-1550.529] (-1556.280) (-1552.533) * [-1554.376] (-1545.989) (-1583.925) (-1549.134) -- 0:01:20
739000 -- (-1555.385) (-1553.691) [-1548.778] (-1547.268) * (-1552.301) [-1548.673] (-1562.000) (-1570.725) -- 0:01:19
739500 -- (-1546.935) (-1557.279) (-1558.253) [-1545.855] * [-1555.875] (-1551.795) (-1559.731) (-1558.689) -- 0:01:19
740000 -- (-1545.009) [-1553.005] (-1550.025) (-1550.355) * (-1567.595) [-1544.491] (-1551.084) (-1540.089) -- 0:01:19
Average standard deviation of split frequencies: 0.004182
740500 -- (-1546.764) [-1547.196] (-1556.258) (-1540.661) * (-1559.933) (-1550.613) (-1559.849) [-1544.501] -- 0:01:19
741000 -- (-1565.606) [-1546.203] (-1553.629) (-1545.161) * [-1546.748] (-1549.525) (-1552.778) (-1559.705) -- 0:01:19
741500 -- (-1553.679) (-1552.313) [-1551.906] (-1557.834) * (-1553.062) [-1541.525] (-1551.414) (-1553.617) -- 0:01:19
742000 -- (-1548.806) (-1563.546) [-1554.007] (-1556.477) * [-1545.802] (-1550.815) (-1553.833) (-1563.041) -- 0:01:18
742500 -- (-1544.339) [-1548.164] (-1552.132) (-1554.701) * (-1557.750) (-1550.696) [-1554.278] (-1554.308) -- 0:01:18
743000 -- [-1545.338] (-1549.163) (-1562.215) (-1554.069) * (-1546.488) [-1547.092] (-1551.097) (-1550.228) -- 0:01:18
743500 -- [-1546.735] (-1554.436) (-1551.954) (-1552.591) * [-1554.624] (-1549.491) (-1557.541) (-1546.673) -- 0:01:18
744000 -- (-1561.035) (-1553.612) [-1548.030] (-1545.820) * (-1560.679) (-1551.756) (-1562.015) [-1549.655] -- 0:01:18
744500 -- (-1550.085) (-1558.956) [-1550.117] (-1566.850) * (-1552.449) [-1556.354] (-1565.649) (-1557.079) -- 0:01:18
745000 -- (-1562.365) (-1554.546) (-1549.022) [-1561.069] * (-1554.011) (-1555.620) [-1544.494] (-1555.911) -- 0:01:18
Average standard deviation of split frequencies: 0.004739
745500 -- [-1555.993] (-1548.827) (-1565.446) (-1569.581) * (-1561.223) (-1553.805) [-1551.449] (-1554.816) -- 0:01:17
746000 -- [-1550.019] (-1544.972) (-1544.503) (-1565.753) * [-1546.487] (-1563.551) (-1562.101) (-1549.143) -- 0:01:17
746500 -- (-1562.006) (-1549.706) [-1548.034] (-1559.025) * (-1550.266) (-1571.668) (-1553.050) [-1547.106] -- 0:01:17
747000 -- (-1554.894) (-1554.653) (-1565.155) [-1554.774] * (-1549.180) [-1544.616] (-1548.574) (-1548.258) -- 0:01:17
747500 -- (-1557.465) (-1549.483) (-1554.481) [-1542.523] * (-1562.689) (-1558.499) [-1549.406] (-1558.067) -- 0:01:17
748000 -- (-1557.153) (-1552.765) (-1565.807) [-1539.037] * (-1563.664) [-1551.866] (-1548.896) (-1555.124) -- 0:01:17
748500 -- (-1574.641) (-1548.265) (-1572.406) [-1550.025] * (-1547.767) (-1555.567) [-1546.336] (-1552.396) -- 0:01:16
749000 -- (-1559.949) (-1563.695) [-1548.109] (-1554.340) * (-1563.795) (-1554.034) [-1551.627] (-1548.766) -- 0:01:16
749500 -- (-1562.610) (-1555.202) [-1552.751] (-1569.151) * (-1557.159) [-1546.489] (-1565.343) (-1550.484) -- 0:01:16
750000 -- (-1564.240) [-1557.952] (-1558.425) (-1567.358) * (-1553.087) (-1556.021) (-1562.720) [-1543.742] -- 0:01:16
Average standard deviation of split frequencies: 0.004575
750500 -- [-1549.951] (-1548.447) (-1552.074) (-1553.726) * (-1569.895) (-1554.702) (-1567.515) [-1544.018] -- 0:01:16
751000 -- (-1555.373) [-1542.920] (-1551.793) (-1554.875) * (-1557.969) (-1565.476) [-1553.759] (-1553.279) -- 0:01:16
751500 -- (-1557.995) [-1548.914] (-1548.428) (-1561.877) * [-1558.092] (-1561.247) (-1550.042) (-1552.233) -- 0:01:16
752000 -- (-1547.371) [-1557.528] (-1556.111) (-1566.442) * (-1554.039) (-1562.247) [-1566.971] (-1549.244) -- 0:01:15
752500 -- [-1545.166] (-1561.872) (-1553.861) (-1547.516) * (-1548.494) (-1557.460) (-1562.983) [-1553.744] -- 0:01:15
753000 -- (-1548.127) (-1558.333) [-1559.267] (-1552.013) * (-1570.974) [-1552.258] (-1557.089) (-1550.281) -- 0:01:15
753500 -- (-1549.365) (-1556.575) (-1562.610) [-1551.161] * (-1567.214) (-1546.516) (-1552.266) [-1548.226] -- 0:01:15
754000 -- [-1548.899] (-1555.078) (-1561.215) (-1548.989) * (-1552.223) [-1559.176] (-1559.149) (-1550.424) -- 0:01:15
754500 -- (-1564.227) (-1549.357) [-1553.286] (-1563.561) * (-1545.296) (-1545.770) [-1561.091] (-1554.292) -- 0:01:15
755000 -- (-1554.934) (-1566.248) (-1554.080) [-1548.232] * (-1553.741) (-1552.248) (-1553.239) [-1548.215] -- 0:01:14
Average standard deviation of split frequencies: 0.004632
755500 -- (-1561.521) [-1545.267] (-1573.684) (-1544.962) * (-1558.224) (-1545.417) [-1550.267] (-1549.138) -- 0:01:14
756000 -- (-1559.994) (-1554.760) [-1542.453] (-1554.146) * (-1553.296) (-1557.636) [-1546.393] (-1546.800) -- 0:01:14
756500 -- [-1544.101] (-1546.859) (-1545.513) (-1549.954) * (-1553.732) [-1558.418] (-1565.619) (-1557.093) -- 0:01:14
757000 -- [-1548.455] (-1561.470) (-1560.612) (-1549.555) * [-1556.480] (-1561.986) (-1559.490) (-1563.884) -- 0:01:14
757500 -- [-1546.973] (-1548.986) (-1559.632) (-1547.978) * (-1546.617) (-1549.906) [-1549.442] (-1559.938) -- 0:01:14
758000 -- (-1560.645) (-1560.932) (-1558.678) [-1549.754] * (-1547.007) (-1544.006) [-1545.092] (-1562.868) -- 0:01:14
758500 -- [-1549.992] (-1566.757) (-1555.984) (-1546.953) * [-1551.319] (-1550.458) (-1542.343) (-1558.207) -- 0:01:13
759000 -- (-1552.094) (-1555.350) [-1549.419] (-1550.411) * [-1549.660] (-1558.789) (-1558.656) (-1563.603) -- 0:01:13
759500 -- (-1554.348) [-1549.097] (-1547.712) (-1555.488) * (-1554.128) (-1551.643) [-1545.609] (-1555.285) -- 0:01:13
760000 -- [-1548.253] (-1560.619) (-1558.731) (-1552.837) * (-1554.884) (-1553.643) (-1557.000) [-1553.123] -- 0:01:13
Average standard deviation of split frequencies: 0.004604
760500 -- (-1549.869) (-1559.851) [-1554.279] (-1561.812) * [-1554.961] (-1567.790) (-1560.344) (-1561.077) -- 0:01:13
761000 -- (-1561.064) (-1578.649) (-1549.694) [-1550.132] * (-1553.230) (-1559.572) [-1553.824] (-1559.577) -- 0:01:13
761500 -- [-1551.490] (-1555.063) (-1555.995) (-1548.950) * (-1554.801) (-1555.362) (-1552.533) [-1546.351] -- 0:01:12
762000 -- (-1553.377) (-1572.235) [-1549.329] (-1556.433) * [-1542.188] (-1552.044) (-1546.985) (-1555.452) -- 0:01:12
762500 -- [-1557.870] (-1575.142) (-1549.795) (-1560.819) * (-1577.482) [-1548.862] (-1549.962) (-1546.193) -- 0:01:12
763000 -- (-1547.179) (-1565.786) (-1565.341) [-1546.553] * [-1547.825] (-1561.909) (-1554.161) (-1560.117) -- 0:01:12
763500 -- (-1554.450) (-1563.774) [-1553.964] (-1558.138) * (-1563.651) (-1546.787) (-1552.890) [-1561.232] -- 0:01:12
764000 -- (-1548.979) (-1551.854) [-1550.531] (-1553.751) * (-1548.845) (-1547.182) [-1549.556] (-1553.282) -- 0:01:12
764500 -- (-1571.164) [-1551.259] (-1546.440) (-1549.768) * (-1554.783) [-1551.837] (-1552.720) (-1565.452) -- 0:01:12
765000 -- (-1551.833) (-1550.173) (-1551.388) [-1554.671] * (-1558.464) [-1546.772] (-1548.705) (-1564.329) -- 0:01:11
Average standard deviation of split frequencies: 0.004791
765500 -- (-1547.311) [-1548.260] (-1549.457) (-1572.572) * (-1552.172) [-1551.034] (-1544.531) (-1560.703) -- 0:01:11
766000 -- (-1561.400) (-1561.238) [-1554.576] (-1552.614) * (-1548.267) (-1562.095) [-1547.857] (-1547.723) -- 0:01:11
766500 -- (-1561.731) [-1543.532] (-1551.833) (-1545.118) * (-1555.927) (-1569.618) [-1560.686] (-1550.709) -- 0:01:11
767000 -- [-1545.917] (-1554.170) (-1554.942) (-1560.633) * (-1555.599) (-1560.333) [-1549.848] (-1558.032) -- 0:01:11
767500 -- (-1559.091) [-1544.856] (-1554.580) (-1562.632) * (-1553.612) (-1551.706) (-1552.185) [-1551.302] -- 0:01:11
768000 -- (-1552.007) [-1549.636] (-1556.020) (-1553.831) * (-1551.507) (-1559.220) (-1556.428) [-1554.433] -- 0:01:10
768500 -- (-1558.938) [-1547.607] (-1556.776) (-1549.816) * (-1563.368) (-1546.202) (-1563.837) [-1556.518] -- 0:01:10
769000 -- (-1558.868) (-1559.425) [-1542.593] (-1554.176) * (-1563.234) (-1560.392) (-1551.956) [-1549.126] -- 0:01:10
769500 -- (-1557.388) [-1551.235] (-1550.871) (-1548.989) * (-1557.977) [-1551.567] (-1553.330) (-1550.077) -- 0:01:10
770000 -- (-1553.379) (-1558.095) [-1551.415] (-1562.127) * (-1558.954) (-1560.680) (-1547.964) [-1550.661] -- 0:01:10
Average standard deviation of split frequencies: 0.004544
770500 -- (-1555.246) (-1563.623) (-1548.191) [-1548.867] * (-1551.663) (-1556.864) (-1557.372) [-1550.740] -- 0:01:10
771000 -- (-1547.975) [-1548.085] (-1552.302) (-1550.978) * (-1558.393) (-1553.099) [-1556.256] (-1544.968) -- 0:01:10
771500 -- [-1552.399] (-1561.024) (-1543.159) (-1565.818) * (-1557.702) (-1554.967) [-1557.251] (-1552.348) -- 0:01:09
772000 -- (-1554.185) (-1562.196) (-1554.287) [-1548.441] * (-1553.292) (-1563.035) [-1544.563] (-1563.305) -- 0:01:09
772500 -- (-1559.538) [-1557.041] (-1557.003) (-1556.048) * (-1554.367) (-1558.276) [-1546.689] (-1556.223) -- 0:01:09
773000 -- (-1556.351) (-1552.510) [-1549.658] (-1548.395) * (-1550.809) [-1546.430] (-1547.506) (-1550.876) -- 0:01:09
773500 -- (-1568.071) (-1561.389) [-1549.355] (-1552.649) * (-1575.178) (-1553.650) (-1556.947) [-1549.893] -- 0:01:09
774000 -- (-1546.904) (-1549.460) [-1549.276] (-1572.957) * [-1554.627] (-1563.066) (-1555.037) (-1561.450) -- 0:01:09
774500 -- [-1548.321] (-1556.993) (-1549.914) (-1558.103) * (-1550.988) (-1549.187) [-1551.837] (-1557.803) -- 0:01:09
775000 -- (-1553.855) (-1557.086) [-1547.128] (-1576.275) * (-1558.309) (-1553.252) (-1554.037) [-1549.978] -- 0:01:08
Average standard deviation of split frequencies: 0.004209
775500 -- (-1559.232) (-1577.555) [-1557.555] (-1568.925) * [-1551.775] (-1559.523) (-1544.389) (-1558.534) -- 0:01:08
776000 -- (-1554.988) [-1549.316] (-1581.255) (-1565.894) * (-1545.791) [-1552.288] (-1549.280) (-1559.642) -- 0:01:08
776500 -- (-1563.354) [-1556.661] (-1554.260) (-1553.878) * (-1549.392) [-1547.643] (-1542.714) (-1559.206) -- 0:01:08
777000 -- (-1558.192) (-1572.039) (-1549.276) [-1548.601] * (-1551.290) (-1556.744) [-1552.557] (-1549.743) -- 0:01:08
777500 -- [-1550.898] (-1569.565) (-1546.354) (-1550.791) * (-1565.082) (-1555.094) [-1547.844] (-1566.672) -- 0:01:08
778000 -- (-1546.534) [-1560.955] (-1572.141) (-1552.680) * [-1551.179] (-1560.450) (-1562.904) (-1562.095) -- 0:01:07
778500 -- (-1552.979) (-1553.178) (-1552.185) [-1555.054] * (-1545.980) (-1560.122) (-1558.985) [-1552.089] -- 0:01:07
779000 -- (-1563.380) (-1556.295) [-1548.278] (-1576.361) * (-1549.167) (-1556.461) (-1560.797) [-1548.555] -- 0:01:07
779500 -- (-1554.057) (-1558.023) (-1551.667) [-1560.633] * [-1547.975] (-1556.933) (-1559.987) (-1559.868) -- 0:01:07
780000 -- (-1555.521) [-1551.077] (-1551.032) (-1563.088) * (-1551.538) [-1555.978] (-1555.342) (-1562.579) -- 0:01:07
Average standard deviation of split frequencies: 0.004788
780500 -- (-1552.236) [-1549.655] (-1548.633) (-1550.110) * (-1547.124) (-1554.259) [-1545.814] (-1553.804) -- 0:01:07
781000 -- (-1546.708) [-1549.409] (-1549.799) (-1550.290) * (-1551.067) (-1552.423) [-1552.669] (-1552.996) -- 0:01:07
781500 -- [-1546.225] (-1552.895) (-1561.271) (-1554.731) * (-1557.254) (-1575.881) [-1556.375] (-1544.330) -- 0:01:06
782000 -- (-1548.711) (-1550.251) [-1553.821] (-1546.383) * (-1553.308) (-1557.120) (-1564.374) [-1544.379] -- 0:01:06
782500 -- (-1561.765) (-1566.761) (-1560.240) [-1543.537] * (-1553.338) (-1552.874) [-1565.243] (-1561.761) -- 0:01:06
783000 -- (-1553.657) (-1555.681) (-1552.661) [-1550.754] * [-1552.375] (-1556.887) (-1560.023) (-1559.043) -- 0:01:06
783500 -- (-1562.973) (-1546.156) (-1552.817) [-1554.303] * (-1556.085) (-1557.125) [-1561.194] (-1556.646) -- 0:01:06
784000 -- [-1547.148] (-1562.470) (-1559.654) (-1575.698) * (-1553.767) (-1555.983) (-1568.538) [-1551.173] -- 0:01:06
784500 -- (-1556.152) (-1567.837) [-1550.842] (-1560.056) * [-1555.707] (-1561.787) (-1552.343) (-1544.345) -- 0:01:05
785000 -- (-1553.599) (-1556.391) (-1553.146) [-1547.214] * (-1553.064) (-1562.104) [-1554.810] (-1546.917) -- 0:01:05
Average standard deviation of split frequencies: 0.005012
785500 -- (-1560.886) (-1552.670) (-1558.800) [-1549.198] * (-1554.042) [-1553.155] (-1556.095) (-1567.460) -- 0:01:05
786000 -- (-1560.012) (-1562.580) [-1558.943] (-1546.048) * (-1550.291) (-1554.074) (-1562.777) [-1549.816] -- 0:01:05
786500 -- (-1558.762) (-1550.854) (-1556.055) [-1555.824] * (-1574.019) (-1551.527) [-1543.531] (-1550.041) -- 0:01:05
787000 -- (-1550.879) (-1554.587) (-1553.765) [-1554.141] * (-1544.171) [-1543.195] (-1554.895) (-1573.102) -- 0:01:05
787500 -- [-1549.580] (-1547.896) (-1556.258) (-1546.901) * [-1553.178] (-1577.392) (-1549.089) (-1562.267) -- 0:01:05
788000 -- [-1549.436] (-1557.562) (-1559.065) (-1561.612) * (-1557.270) (-1555.532) (-1547.695) [-1562.873] -- 0:01:04
788500 -- [-1551.212] (-1545.631) (-1557.880) (-1564.177) * [-1550.431] (-1548.398) (-1549.808) (-1557.978) -- 0:01:04
789000 -- (-1558.466) (-1559.329) (-1555.882) [-1558.816] * [-1548.544] (-1570.477) (-1557.536) (-1548.612) -- 0:01:04
789500 -- (-1546.179) (-1572.595) [-1551.978] (-1559.395) * (-1555.585) (-1556.514) (-1556.739) [-1553.056] -- 0:01:04
790000 -- [-1547.492] (-1557.712) (-1557.967) (-1556.669) * (-1566.510) (-1551.233) (-1564.712) [-1562.654] -- 0:01:04
Average standard deviation of split frequencies: 0.004897
790500 -- [-1551.558] (-1562.935) (-1552.209) (-1559.442) * (-1561.298) (-1557.233) (-1561.559) [-1548.832] -- 0:01:04
791000 -- (-1560.505) (-1554.155) [-1552.589] (-1555.249) * (-1561.469) (-1562.209) (-1559.662) [-1557.999] -- 0:01:03
791500 -- [-1560.079] (-1558.609) (-1558.358) (-1555.160) * (-1561.512) [-1549.824] (-1562.538) (-1568.543) -- 0:01:03
792000 -- (-1551.994) (-1562.690) (-1563.844) [-1542.977] * (-1570.572) (-1555.322) (-1554.656) [-1554.027] -- 0:01:03
792500 -- (-1557.151) (-1556.247) (-1562.021) [-1545.935] * (-1556.118) (-1552.781) [-1551.094] (-1558.074) -- 0:01:03
793000 -- (-1560.400) (-1556.044) (-1553.310) [-1546.796] * (-1557.834) (-1548.032) [-1551.387] (-1574.574) -- 0:01:03
793500 -- (-1554.138) (-1550.136) (-1553.155) [-1545.686] * (-1558.843) (-1563.462) [-1546.690] (-1563.052) -- 0:01:03
794000 -- (-1563.854) (-1551.762) [-1551.084] (-1551.628) * [-1549.092] (-1554.195) (-1551.210) (-1546.515) -- 0:01:03
794500 -- (-1570.670) (-1557.237) (-1546.228) [-1558.278] * (-1546.646) (-1558.248) [-1549.041] (-1552.596) -- 0:01:02
795000 -- (-1558.413) [-1548.952] (-1556.884) (-1559.589) * (-1546.864) (-1571.132) [-1545.496] (-1559.159) -- 0:01:02
Average standard deviation of split frequencies: 0.005245
795500 -- (-1556.709) [-1558.882] (-1561.850) (-1548.079) * (-1560.312) (-1570.768) [-1556.769] (-1552.061) -- 0:01:02
796000 -- (-1566.454) (-1560.352) [-1541.916] (-1549.171) * (-1558.061) (-1558.637) (-1564.903) [-1546.705] -- 0:01:02
796500 -- (-1571.285) (-1544.902) [-1554.327] (-1556.480) * (-1553.669) (-1568.302) [-1560.610] (-1548.445) -- 0:01:02
797000 -- (-1547.224) (-1555.862) [-1548.369] (-1551.115) * [-1550.076] (-1558.018) (-1555.479) (-1551.795) -- 0:01:02
797500 -- (-1555.422) (-1559.228) (-1549.497) [-1559.241] * [-1543.915] (-1544.493) (-1548.706) (-1554.138) -- 0:01:01
798000 -- (-1555.417) (-1556.337) [-1543.269] (-1564.969) * (-1553.123) (-1556.475) (-1551.164) [-1547.302] -- 0:01:01
798500 -- (-1544.540) [-1557.900] (-1552.879) (-1570.316) * (-1568.058) (-1561.285) (-1555.904) [-1553.093] -- 0:01:01
799000 -- [-1547.508] (-1566.380) (-1549.384) (-1555.184) * (-1571.884) (-1551.345) [-1548.684] (-1564.523) -- 0:01:01
799500 -- (-1558.227) (-1558.754) (-1549.324) [-1552.366] * (-1555.197) [-1550.298] (-1557.631) (-1556.206) -- 0:01:01
800000 -- (-1558.908) [-1553.738] (-1555.992) (-1564.875) * (-1549.592) (-1552.494) [-1559.724] (-1547.592) -- 0:01:01
Average standard deviation of split frequencies: 0.005425
800500 -- [-1552.608] (-1562.684) (-1567.392) (-1554.295) * (-1558.497) (-1547.178) [-1552.939] (-1553.964) -- 0:01:01
801000 -- (-1550.218) (-1571.597) [-1555.219] (-1556.964) * [-1542.038] (-1555.832) (-1552.080) (-1552.378) -- 0:01:00
801500 -- (-1558.989) (-1554.087) (-1545.313) [-1556.651] * (-1559.049) [-1553.837] (-1554.549) (-1550.004) -- 0:01:00
802000 -- (-1567.218) (-1548.836) [-1550.111] (-1545.810) * (-1552.577) [-1542.227] (-1555.723) (-1558.228) -- 0:01:00
802500 -- [-1545.903] (-1559.973) (-1544.743) (-1550.281) * (-1549.306) (-1548.600) [-1551.087] (-1555.652) -- 0:01:00
803000 -- (-1551.114) (-1556.010) (-1555.232) [-1550.119] * [-1544.930] (-1544.267) (-1553.040) (-1553.661) -- 0:01:00
803500 -- (-1558.648) (-1548.530) (-1561.126) [-1555.285] * (-1556.449) [-1553.333] (-1553.196) (-1547.676) -- 0:01:00
804000 -- (-1549.700) [-1548.023] (-1555.170) (-1553.856) * (-1550.310) (-1549.689) [-1542.908] (-1562.291) -- 0:00:59
804500 -- (-1552.659) [-1554.895] (-1550.045) (-1563.298) * (-1550.499) [-1547.374] (-1558.853) (-1547.620) -- 0:00:59
805000 -- (-1543.633) (-1567.427) [-1545.415] (-1560.438) * [-1544.536] (-1552.098) (-1561.285) (-1571.652) -- 0:00:59
Average standard deviation of split frequencies: 0.005180
805500 -- (-1551.988) (-1555.573) (-1548.747) [-1548.408] * (-1552.215) (-1556.896) [-1554.990] (-1569.080) -- 0:00:59
806000 -- [-1543.476] (-1555.917) (-1557.776) (-1554.563) * (-1550.048) [-1554.503] (-1559.877) (-1564.667) -- 0:00:59
806500 -- (-1559.517) [-1546.120] (-1558.882) (-1551.406) * [-1558.669] (-1555.302) (-1562.903) (-1564.867) -- 0:00:59
807000 -- (-1553.719) [-1546.122] (-1545.647) (-1562.298) * (-1553.531) [-1560.502] (-1557.314) (-1556.073) -- 0:00:59
807500 -- (-1555.765) [-1547.909] (-1555.935) (-1549.453) * (-1549.384) (-1556.089) [-1558.502] (-1575.984) -- 0:00:58
808000 -- (-1557.243) (-1552.437) (-1551.746) [-1556.538] * (-1554.031) (-1554.890) (-1554.143) [-1546.760] -- 0:00:58
808500 -- (-1552.841) [-1551.557] (-1544.754) (-1547.521) * [-1547.282] (-1572.804) (-1556.670) (-1548.649) -- 0:00:58
809000 -- (-1552.783) (-1554.849) (-1552.448) [-1544.790] * [-1554.243] (-1557.879) (-1563.018) (-1555.061) -- 0:00:58
809500 -- (-1557.974) (-1549.051) [-1549.940] (-1550.563) * (-1553.902) [-1554.187] (-1548.850) (-1554.691) -- 0:00:58
810000 -- [-1548.935] (-1548.740) (-1550.860) (-1575.739) * [-1542.478] (-1558.277) (-1565.399) (-1558.542) -- 0:00:58
Average standard deviation of split frequencies: 0.005857
810500 -- (-1555.537) [-1554.450] (-1543.608) (-1553.886) * (-1557.499) (-1552.843) (-1555.242) [-1545.555] -- 0:00:57
811000 -- (-1543.446) [-1550.046] (-1546.249) (-1556.898) * (-1573.998) [-1545.259] (-1561.138) (-1556.416) -- 0:00:57
811500 -- [-1547.327] (-1554.075) (-1560.070) (-1549.977) * (-1558.792) (-1547.766) (-1543.993) [-1543.479] -- 0:00:57
812000 -- [-1549.797] (-1552.786) (-1565.785) (-1560.956) * (-1562.746) (-1549.423) [-1548.471] (-1544.009) -- 0:00:57
812500 -- [-1549.073] (-1552.885) (-1556.898) (-1556.202) * (-1551.724) [-1556.604] (-1554.697) (-1549.046) -- 0:00:57
813000 -- (-1543.794) (-1547.678) [-1546.831] (-1555.812) * (-1562.326) (-1552.819) (-1562.688) [-1544.640] -- 0:00:57
813500 -- (-1548.672) (-1558.092) [-1555.288] (-1546.489) * (-1554.526) [-1551.879] (-1548.702) (-1552.233) -- 0:00:57
814000 -- [-1554.181] (-1554.793) (-1550.981) (-1558.820) * [-1556.282] (-1553.865) (-1559.912) (-1554.157) -- 0:00:56
814500 -- [-1546.273] (-1562.911) (-1555.505) (-1563.061) * (-1551.674) (-1559.269) (-1554.125) [-1558.654] -- 0:00:56
815000 -- (-1557.495) (-1555.866) (-1562.424) [-1550.181] * (-1564.585) (-1562.651) (-1564.040) [-1559.948] -- 0:00:56
Average standard deviation of split frequencies: 0.005571
815500 -- [-1556.223] (-1547.298) (-1557.275) (-1560.437) * [-1559.199] (-1544.979) (-1558.442) (-1573.671) -- 0:00:56
816000 -- (-1546.000) (-1552.026) [-1548.026] (-1565.819) * [-1563.196] (-1560.675) (-1563.093) (-1558.756) -- 0:00:56
816500 -- (-1551.739) [-1551.581] (-1554.432) (-1558.085) * (-1550.085) (-1555.172) [-1560.562] (-1552.189) -- 0:00:56
817000 -- (-1554.252) [-1544.314] (-1551.292) (-1562.510) * [-1548.019] (-1562.147) (-1562.367) (-1553.197) -- 0:00:55
817500 -- (-1554.114) (-1558.749) [-1555.076] (-1563.278) * (-1560.844) (-1554.356) [-1551.694] (-1554.313) -- 0:00:55
818000 -- [-1556.386] (-1547.744) (-1572.306) (-1569.797) * (-1556.400) [-1553.622] (-1550.453) (-1546.117) -- 0:00:55
818500 -- (-1562.241) [-1549.365] (-1558.369) (-1553.363) * (-1561.347) [-1548.294] (-1554.688) (-1547.678) -- 0:00:55
819000 -- [-1557.710] (-1552.114) (-1549.516) (-1549.765) * (-1552.401) (-1552.523) [-1556.582] (-1560.926) -- 0:00:55
819500 -- (-1568.963) (-1545.278) [-1546.449] (-1551.840) * (-1576.462) (-1549.484) [-1552.013] (-1556.809) -- 0:00:55
820000 -- (-1555.202) (-1547.188) [-1553.066] (-1557.511) * [-1549.934] (-1547.816) (-1557.265) (-1550.291) -- 0:00:55
Average standard deviation of split frequencies: 0.005539
820500 -- (-1559.569) (-1549.900) [-1547.019] (-1547.117) * [-1555.922] (-1551.328) (-1562.569) (-1549.567) -- 0:00:54
821000 -- (-1550.518) [-1549.019] (-1549.188) (-1547.694) * [-1549.177] (-1579.108) (-1551.884) (-1549.587) -- 0:00:54
821500 -- (-1551.429) (-1559.307) (-1548.082) [-1553.593] * (-1555.126) (-1555.000) (-1546.900) [-1556.403] -- 0:00:54
822000 -- (-1564.577) (-1554.063) (-1559.453) [-1551.875] * (-1554.380) (-1550.063) (-1565.470) [-1558.146] -- 0:00:54
822500 -- (-1552.304) [-1546.890] (-1552.034) (-1558.182) * [-1553.407] (-1558.697) (-1552.263) (-1562.649) -- 0:00:54
823000 -- (-1555.797) (-1550.477) [-1551.980] (-1559.509) * (-1553.265) (-1554.661) (-1558.043) [-1555.079] -- 0:00:54
823500 -- (-1549.026) [-1547.867] (-1553.697) (-1558.588) * (-1556.865) (-1561.700) [-1560.034] (-1556.746) -- 0:00:54
824000 -- (-1549.260) (-1549.190) [-1557.296] (-1551.488) * (-1546.596) (-1550.690) (-1560.149) [-1555.323] -- 0:00:53
824500 -- (-1547.207) (-1548.219) [-1555.712] (-1551.528) * [-1552.911] (-1556.715) (-1555.625) (-1555.249) -- 0:00:53
825000 -- [-1549.057] (-1560.567) (-1566.869) (-1548.669) * [-1559.012] (-1559.800) (-1547.759) (-1552.438) -- 0:00:53
Average standard deviation of split frequencies: 0.005748
825500 -- (-1557.794) (-1569.228) (-1567.972) [-1546.561] * (-1551.203) (-1554.051) [-1554.363] (-1556.343) -- 0:00:53
826000 -- (-1554.346) (-1555.780) [-1553.883] (-1544.198) * (-1556.318) (-1550.415) (-1565.226) [-1556.174] -- 0:00:53
826500 -- (-1546.868) (-1561.201) [-1552.738] (-1562.240) * [-1551.186] (-1546.767) (-1553.271) (-1548.250) -- 0:00:53
827000 -- (-1565.974) (-1553.241) (-1556.458) [-1550.201] * [-1544.815] (-1549.520) (-1561.263) (-1549.182) -- 0:00:52
827500 -- (-1552.410) (-1548.244) (-1554.161) [-1547.876] * [-1545.208] (-1547.941) (-1555.008) (-1551.479) -- 0:00:52
828000 -- (-1547.128) (-1553.911) (-1550.723) [-1550.533] * (-1556.649) [-1548.694] (-1543.176) (-1562.781) -- 0:00:52
828500 -- [-1556.977] (-1564.445) (-1557.011) (-1558.459) * (-1560.294) (-1548.054) (-1553.002) [-1555.785] -- 0:00:52
829000 -- (-1556.053) [-1553.040] (-1562.865) (-1564.649) * (-1554.329) (-1544.604) (-1561.496) [-1558.925] -- 0:00:52
829500 -- (-1549.089) [-1549.086] (-1562.699) (-1551.097) * (-1555.825) (-1562.785) [-1545.113] (-1555.467) -- 0:00:52
830000 -- (-1552.770) (-1552.175) [-1544.271] (-1552.470) * (-1559.790) [-1552.666] (-1545.300) (-1546.896) -- 0:00:52
Average standard deviation of split frequencies: 0.005634
830500 -- (-1572.763) (-1555.501) [-1553.355] (-1550.707) * (-1557.968) (-1552.804) [-1548.420] (-1548.796) -- 0:00:51
831000 -- (-1560.995) (-1566.559) [-1547.557] (-1550.393) * (-1555.031) (-1545.428) [-1546.513] (-1548.607) -- 0:00:51
831500 -- (-1552.715) (-1550.738) (-1546.237) [-1545.554] * (-1558.490) [-1555.532] (-1544.720) (-1550.813) -- 0:00:51
832000 -- [-1551.499] (-1572.303) (-1564.991) (-1553.431) * (-1558.979) (-1563.421) (-1553.725) [-1543.635] -- 0:00:51
832500 -- (-1553.425) (-1564.023) (-1555.134) [-1558.564] * (-1549.806) [-1550.356] (-1547.210) (-1555.521) -- 0:00:51
833000 -- (-1550.610) (-1556.572) [-1555.959] (-1554.322) * (-1562.550) (-1546.547) [-1550.066] (-1556.122) -- 0:00:51
833500 -- (-1546.414) (-1568.915) (-1554.829) [-1547.231] * (-1556.550) [-1554.107] (-1567.041) (-1557.243) -- 0:00:50
834000 -- (-1551.313) (-1557.519) [-1548.926] (-1545.945) * (-1560.455) [-1554.047] (-1557.058) (-1568.806) -- 0:00:50
834500 -- [-1547.602] (-1557.768) (-1546.763) (-1551.723) * [-1551.621] (-1548.569) (-1560.048) (-1549.716) -- 0:00:50
835000 -- [-1549.928] (-1555.140) (-1561.935) (-1555.797) * (-1559.423) [-1549.518] (-1560.048) (-1554.792) -- 0:00:50
Average standard deviation of split frequencies: 0.005639
835500 -- (-1551.307) (-1554.862) (-1561.522) [-1555.344] * [-1540.390] (-1555.796) (-1549.674) (-1557.100) -- 0:00:50
836000 -- (-1561.378) (-1560.239) [-1553.829] (-1562.168) * (-1565.539) (-1556.994) [-1555.831] (-1559.929) -- 0:00:50
836500 -- (-1550.366) [-1549.161] (-1548.674) (-1562.344) * [-1553.435] (-1554.151) (-1553.530) (-1567.910) -- 0:00:50
837000 -- (-1549.179) (-1562.051) (-1555.243) [-1561.966] * (-1567.663) (-1552.598) (-1549.343) [-1546.592] -- 0:00:49
837500 -- [-1550.278] (-1563.418) (-1563.962) (-1545.509) * (-1567.661) [-1551.313] (-1549.975) (-1560.730) -- 0:00:49
838000 -- (-1558.274) (-1548.794) (-1554.336) [-1544.885] * (-1552.438) (-1555.978) (-1556.132) [-1554.360] -- 0:00:49
838500 -- (-1557.494) (-1559.399) (-1551.837) [-1545.393] * (-1554.381) [-1550.207] (-1560.860) (-1556.123) -- 0:00:49
839000 -- (-1552.404) (-1549.794) (-1553.573) [-1551.549] * (-1576.270) [-1551.545] (-1558.054) (-1561.194) -- 0:00:49
839500 -- (-1548.809) (-1556.303) [-1543.390] (-1557.144) * (-1557.970) [-1546.615] (-1552.840) (-1555.251) -- 0:00:49
840000 -- (-1562.164) [-1546.063] (-1545.825) (-1552.502) * (-1562.366) [-1552.008] (-1553.888) (-1563.596) -- 0:00:48
Average standard deviation of split frequencies: 0.005527
840500 -- (-1544.971) (-1546.676) (-1555.934) [-1554.641] * (-1558.208) (-1546.501) [-1550.131] (-1559.575) -- 0:00:48
841000 -- (-1559.583) (-1552.421) [-1546.722] (-1553.992) * (-1555.846) [-1549.222] (-1552.205) (-1553.404) -- 0:00:48
841500 -- (-1548.672) [-1551.653] (-1564.691) (-1553.332) * [-1555.717] (-1556.275) (-1550.309) (-1554.578) -- 0:00:48
842000 -- (-1552.327) [-1549.666] (-1546.470) (-1551.024) * (-1564.910) [-1550.261] (-1564.394) (-1548.696) -- 0:00:48
842500 -- (-1562.991) [-1550.583] (-1558.229) (-1548.800) * (-1556.566) [-1554.711] (-1560.429) (-1558.189) -- 0:00:48
843000 -- (-1562.463) [-1546.737] (-1562.542) (-1544.230) * (-1553.009) (-1548.340) [-1544.882] (-1561.401) -- 0:00:48
843500 -- (-1545.284) (-1545.211) (-1556.497) [-1555.590] * (-1558.213) [-1554.743] (-1557.072) (-1563.737) -- 0:00:47
844000 -- (-1560.881) (-1552.365) [-1550.598] (-1545.143) * (-1558.841) [-1549.718] (-1550.596) (-1555.301) -- 0:00:47
844500 -- (-1555.044) (-1559.887) (-1552.592) [-1544.639] * [-1550.679] (-1553.263) (-1565.812) (-1549.629) -- 0:00:47
845000 -- (-1547.631) (-1552.134) [-1545.440] (-1559.945) * [-1546.320] (-1553.468) (-1550.316) (-1549.937) -- 0:00:47
Average standard deviation of split frequencies: 0.006448
845500 -- (-1550.717) [-1552.202] (-1560.064) (-1558.317) * [-1547.939] (-1562.634) (-1555.041) (-1548.948) -- 0:00:47
846000 -- (-1556.062) [-1542.237] (-1552.653) (-1563.363) * [-1554.666] (-1567.008) (-1550.391) (-1546.987) -- 0:00:47
846500 -- (-1554.613) [-1543.541] (-1560.620) (-1544.369) * (-1559.629) (-1560.848) [-1551.235] (-1544.357) -- 0:00:46
847000 -- [-1553.298] (-1572.735) (-1546.496) (-1551.573) * (-1558.975) (-1558.383) [-1546.538] (-1563.739) -- 0:00:46
847500 -- (-1554.844) [-1553.298] (-1560.928) (-1553.376) * (-1559.909) (-1561.062) [-1549.788] (-1559.607) -- 0:00:46
848000 -- (-1550.732) (-1554.051) (-1563.861) [-1547.701] * (-1552.481) (-1550.841) [-1545.996] (-1541.535) -- 0:00:46
848500 -- (-1567.585) (-1550.048) (-1553.856) [-1548.176] * (-1558.927) [-1544.084] (-1551.658) (-1553.702) -- 0:00:46
849000 -- [-1560.685] (-1549.649) (-1559.939) (-1554.838) * [-1556.608] (-1562.186) (-1568.969) (-1564.523) -- 0:00:46
849500 -- (-1550.026) [-1546.824] (-1558.487) (-1548.857) * (-1545.615) (-1550.863) (-1562.221) [-1548.777] -- 0:00:46
850000 -- (-1548.867) (-1546.481) [-1553.527] (-1550.853) * [-1550.414] (-1565.435) (-1579.617) (-1549.533) -- 0:00:45
Average standard deviation of split frequencies: 0.006571
850500 -- (-1556.435) (-1555.300) (-1548.343) [-1548.027] * [-1554.746] (-1556.791) (-1551.218) (-1558.642) -- 0:00:45
851000 -- (-1558.801) (-1547.347) (-1551.248) [-1556.668] * (-1552.460) [-1555.457] (-1554.409) (-1547.221) -- 0:00:45
851500 -- [-1553.621] (-1550.660) (-1558.009) (-1553.323) * (-1573.947) (-1554.802) [-1548.686] (-1551.003) -- 0:00:45
852000 -- (-1558.389) (-1551.047) [-1551.107] (-1550.816) * (-1554.223) (-1556.678) [-1549.193] (-1561.370) -- 0:00:45
852500 -- (-1553.831) [-1545.962] (-1556.395) (-1557.520) * (-1555.334) [-1548.442] (-1566.964) (-1555.860) -- 0:00:45
853000 -- [-1561.752] (-1559.169) (-1556.158) (-1553.890) * (-1567.679) [-1553.782] (-1542.329) (-1560.067) -- 0:00:44
853500 -- (-1551.893) (-1557.489) [-1555.401] (-1559.166) * (-1562.726) (-1556.017) [-1556.857] (-1558.915) -- 0:00:44
854000 -- (-1550.906) [-1548.994] (-1554.383) (-1555.050) * (-1550.783) (-1559.549) (-1564.200) [-1559.245] -- 0:00:44
854500 -- (-1546.637) (-1555.220) (-1565.570) [-1558.136] * (-1555.188) (-1559.531) [-1543.329] (-1561.421) -- 0:00:44
855000 -- (-1550.442) (-1568.305) (-1547.813) [-1544.826] * (-1548.894) (-1552.697) [-1544.888] (-1556.496) -- 0:00:44
Average standard deviation of split frequencies: 0.006608
855500 -- (-1554.524) [-1552.388] (-1572.730) (-1553.389) * (-1551.935) (-1553.305) [-1554.232] (-1568.081) -- 0:00:44
856000 -- (-1547.151) (-1551.648) (-1557.060) [-1545.972] * (-1549.340) (-1556.774) (-1553.674) [-1546.935] -- 0:00:44
856500 -- [-1545.592] (-1557.623) (-1554.812) (-1557.034) * [-1553.332] (-1548.992) (-1553.306) (-1555.178) -- 0:00:43
857000 -- [-1545.858] (-1556.302) (-1568.448) (-1567.475) * (-1555.805) (-1548.062) [-1549.151] (-1563.242) -- 0:00:43
857500 -- (-1552.181) (-1556.457) [-1551.481] (-1550.358) * (-1566.144) (-1558.106) [-1549.012] (-1562.483) -- 0:00:43
858000 -- (-1552.808) [-1545.707] (-1562.243) (-1564.639) * (-1564.626) (-1548.736) (-1562.747) [-1559.515] -- 0:00:43
858500 -- (-1565.415) (-1557.411) (-1565.923) [-1551.523] * (-1557.708) [-1547.785] (-1560.392) (-1574.176) -- 0:00:43
859000 -- (-1557.627) (-1554.998) [-1552.594] (-1554.325) * (-1550.042) [-1564.273] (-1555.333) (-1563.950) -- 0:00:43
859500 -- (-1559.830) (-1565.073) (-1554.544) [-1553.662] * (-1558.528) (-1562.870) (-1564.958) [-1549.916] -- 0:00:42
860000 -- [-1556.479] (-1558.098) (-1577.596) (-1552.864) * [-1544.632] (-1556.449) (-1544.726) (-1550.049) -- 0:00:42
Average standard deviation of split frequencies: 0.006064
860500 -- (-1553.467) [-1548.422] (-1556.168) (-1557.324) * (-1549.980) (-1567.307) (-1553.624) [-1549.050] -- 0:00:42
861000 -- [-1560.884] (-1551.741) (-1554.535) (-1557.714) * (-1551.594) (-1550.658) (-1556.923) [-1551.360] -- 0:00:42
861500 -- (-1581.268) [-1550.222] (-1553.327) (-1558.037) * (-1568.117) [-1555.579] (-1554.315) (-1553.981) -- 0:00:42
862000 -- (-1545.481) [-1551.294] (-1551.703) (-1547.411) * (-1550.363) (-1547.038) (-1548.110) [-1557.888] -- 0:00:42
862500 -- (-1552.705) (-1563.152) [-1555.617] (-1560.503) * (-1570.686) [-1557.974] (-1549.267) (-1566.005) -- 0:00:42
863000 -- (-1569.379) (-1575.201) (-1551.935) [-1545.308] * [-1544.029] (-1553.358) (-1563.257) (-1551.687) -- 0:00:41
863500 -- (-1556.986) (-1563.134) [-1557.033] (-1569.534) * (-1550.612) [-1558.117] (-1554.933) (-1545.965) -- 0:00:41
864000 -- [-1550.998] (-1558.568) (-1559.731) (-1556.537) * (-1554.450) (-1566.749) (-1551.031) [-1545.829] -- 0:00:41
864500 -- (-1565.515) (-1551.690) (-1551.470) [-1551.004] * (-1565.896) (-1553.288) [-1556.334] (-1545.764) -- 0:00:41
865000 -- (-1565.603) (-1552.065) [-1558.983] (-1559.775) * (-1548.958) [-1545.648] (-1567.043) (-1553.146) -- 0:00:41
Average standard deviation of split frequencies: 0.005871
865500 -- (-1566.373) (-1548.564) [-1548.629] (-1548.911) * (-1547.669) [-1548.814] (-1574.205) (-1558.036) -- 0:00:41
866000 -- [-1551.893] (-1553.772) (-1556.520) (-1549.402) * (-1550.912) (-1566.768) (-1568.536) [-1549.176] -- 0:00:41
866500 -- [-1545.793] (-1559.355) (-1553.242) (-1547.738) * [-1552.206] (-1551.363) (-1554.975) (-1560.452) -- 0:00:40
867000 -- [-1545.387] (-1555.580) (-1556.472) (-1553.108) * (-1558.699) (-1556.414) (-1564.054) [-1548.053] -- 0:00:40
867500 -- (-1550.342) [-1560.882] (-1553.329) (-1555.647) * (-1565.442) [-1553.243] (-1553.777) (-1548.968) -- 0:00:40
868000 -- (-1561.731) (-1553.943) (-1550.575) [-1546.524] * (-1543.874) (-1557.503) [-1548.784] (-1554.768) -- 0:00:40
868500 -- (-1567.113) (-1560.670) (-1554.051) [-1549.225] * (-1564.558) [-1554.067] (-1566.062) (-1551.075) -- 0:00:40
869000 -- (-1545.272) [-1551.585] (-1553.312) (-1557.747) * (-1548.046) (-1559.519) (-1561.638) [-1548.004] -- 0:00:40
869500 -- (-1558.913) (-1562.570) (-1551.514) [-1544.312] * (-1555.698) (-1566.158) (-1552.735) [-1555.814] -- 0:00:39
870000 -- (-1572.112) [-1542.719] (-1555.121) (-1560.957) * (-1557.196) (-1558.771) (-1560.497) [-1553.183] -- 0:00:39
Average standard deviation of split frequencies: 0.005956
870500 -- [-1554.702] (-1548.364) (-1554.313) (-1554.266) * (-1545.655) (-1546.411) [-1548.147] (-1572.306) -- 0:00:39
871000 -- (-1556.257) (-1548.631) (-1559.831) [-1557.277] * [-1551.351] (-1548.609) (-1552.180) (-1562.692) -- 0:00:39
871500 -- (-1560.558) (-1551.233) [-1553.878] (-1554.070) * [-1556.030] (-1541.357) (-1575.394) (-1554.059) -- 0:00:39
872000 -- (-1566.263) (-1550.720) [-1551.925] (-1556.714) * [-1552.613] (-1556.263) (-1551.508) (-1550.391) -- 0:00:39
872500 -- (-1553.827) (-1553.319) [-1558.589] (-1554.968) * [-1547.892] (-1558.905) (-1545.709) (-1549.946) -- 0:00:39
873000 -- (-1569.286) [-1555.962] (-1557.106) (-1545.927) * (-1549.866) (-1549.811) (-1565.795) [-1561.593] -- 0:00:38
873500 -- (-1546.921) (-1565.527) (-1561.837) [-1543.379] * (-1559.258) (-1557.912) (-1555.967) [-1553.758] -- 0:00:38
874000 -- [-1555.410] (-1554.636) (-1542.130) (-1551.176) * (-1561.655) (-1553.285) [-1550.885] (-1558.456) -- 0:00:38
874500 -- [-1556.870] (-1563.345) (-1566.017) (-1558.309) * (-1564.246) [-1551.113] (-1547.050) (-1555.007) -- 0:00:38
875000 -- [-1559.135] (-1575.909) (-1551.971) (-1565.355) * (-1556.960) (-1552.332) (-1550.838) [-1549.596] -- 0:00:38
Average standard deviation of split frequencies: 0.006073
875500 -- (-1542.659) [-1544.782] (-1553.364) (-1553.120) * (-1559.429) [-1554.134] (-1550.489) (-1565.577) -- 0:00:38
876000 -- [-1547.767] (-1554.921) (-1561.308) (-1559.250) * [-1546.162] (-1568.407) (-1557.745) (-1558.442) -- 0:00:37
876500 -- (-1559.581) (-1552.592) (-1556.670) [-1548.251] * (-1553.731) (-1563.002) (-1570.360) [-1548.689] -- 0:00:37
877000 -- (-1555.588) [-1553.514] (-1548.456) (-1558.397) * (-1551.148) (-1549.929) (-1546.134) [-1548.709] -- 0:00:37
877500 -- (-1556.896) (-1566.393) [-1546.781] (-1556.282) * [-1560.694] (-1552.295) (-1556.236) (-1546.191) -- 0:00:37
878000 -- (-1547.363) (-1555.779) (-1548.541) [-1545.095] * [-1560.964] (-1557.843) (-1559.402) (-1551.069) -- 0:00:37
878500 -- (-1570.385) (-1552.435) [-1549.318] (-1560.491) * (-1565.573) (-1558.332) [-1546.578] (-1552.378) -- 0:00:37
879000 -- (-1550.433) [-1558.637] (-1552.204) (-1557.565) * [-1544.033] (-1559.952) (-1545.229) (-1563.981) -- 0:00:37
879500 -- (-1567.887) (-1547.614) [-1548.605] (-1551.663) * (-1547.475) (-1559.444) (-1544.537) [-1547.064] -- 0:00:36
880000 -- (-1560.807) (-1555.098) [-1548.850] (-1550.501) * (-1558.442) [-1548.796] (-1555.029) (-1570.205) -- 0:00:36
Average standard deviation of split frequencies: 0.006462
880500 -- (-1549.390) (-1561.936) (-1555.973) [-1545.891] * (-1547.892) [-1547.594] (-1551.292) (-1554.340) -- 0:00:36
881000 -- (-1562.676) (-1560.691) [-1549.398] (-1546.605) * (-1552.803) (-1559.211) (-1557.779) [-1554.057] -- 0:00:36
881500 -- (-1559.383) [-1543.047] (-1557.523) (-1563.266) * (-1557.195) (-1547.663) (-1553.186) [-1551.393] -- 0:00:36
882000 -- (-1562.136) (-1552.282) [-1553.769] (-1548.572) * (-1545.923) (-1555.473) (-1557.369) [-1557.081] -- 0:00:36
882500 -- (-1559.445) (-1556.278) (-1560.162) [-1546.347] * (-1544.544) (-1559.547) (-1556.688) [-1556.480] -- 0:00:35
883000 -- (-1551.076) (-1563.968) (-1561.117) [-1552.062] * [-1545.957] (-1557.792) (-1552.757) (-1551.263) -- 0:00:35
883500 -- (-1551.283) (-1543.034) (-1557.395) [-1548.656] * (-1549.458) [-1554.100] (-1555.383) (-1545.965) -- 0:00:35
884000 -- (-1558.590) (-1559.035) [-1557.208] (-1546.591) * [-1547.547] (-1547.996) (-1560.137) (-1562.624) -- 0:00:35
884500 -- [-1549.007] (-1550.600) (-1556.403) (-1561.343) * (-1544.705) (-1554.564) [-1546.469] (-1558.755) -- 0:00:35
885000 -- (-1551.051) [-1552.180] (-1553.011) (-1557.204) * (-1555.862) [-1549.638] (-1564.104) (-1560.700) -- 0:00:35
Average standard deviation of split frequencies: 0.006461
885500 -- (-1552.794) (-1553.748) (-1555.137) [-1544.009] * (-1569.460) (-1557.379) (-1547.520) [-1551.564] -- 0:00:35
886000 -- [-1549.033] (-1571.713) (-1563.748) (-1553.504) * (-1562.032) [-1556.969] (-1560.943) (-1541.158) -- 0:00:34
886500 -- (-1547.482) (-1552.039) (-1556.773) [-1549.052] * [-1551.174] (-1574.900) (-1554.520) (-1560.661) -- 0:00:34
887000 -- (-1554.154) (-1555.887) (-1563.133) [-1546.706] * (-1554.331) (-1568.269) (-1547.787) [-1554.895] -- 0:00:34
887500 -- [-1551.349] (-1552.949) (-1567.444) (-1556.425) * [-1553.638] (-1557.799) (-1553.931) (-1549.923) -- 0:00:34
888000 -- (-1547.975) (-1558.960) (-1554.493) [-1548.583] * (-1550.130) [-1549.396] (-1558.103) (-1563.692) -- 0:00:34
888500 -- (-1552.083) (-1557.660) (-1561.925) [-1551.862] * (-1547.041) [-1550.033] (-1556.300) (-1559.677) -- 0:00:34
889000 -- (-1545.562) (-1553.072) [-1553.379] (-1551.746) * (-1568.257) (-1545.690) (-1554.276) [-1550.275] -- 0:00:33
889500 -- [-1555.194] (-1561.996) (-1556.611) (-1551.804) * (-1564.923) (-1565.840) [-1560.196] (-1546.978) -- 0:00:33
890000 -- (-1553.502) (-1548.868) [-1552.275] (-1548.385) * (-1550.558) (-1556.016) (-1558.346) [-1549.553] -- 0:00:33
Average standard deviation of split frequencies: 0.006389
890500 -- (-1563.139) (-1554.420) (-1550.174) [-1558.562] * (-1550.839) (-1568.524) (-1547.484) [-1549.632] -- 0:00:33
891000 -- (-1548.724) [-1550.643] (-1561.131) (-1554.783) * [-1545.992] (-1553.956) (-1556.428) (-1560.875) -- 0:00:33
891500 -- (-1544.692) [-1547.045] (-1565.001) (-1557.143) * (-1557.576) (-1562.138) [-1557.563] (-1562.910) -- 0:00:33
892000 -- (-1556.106) (-1552.324) (-1551.970) [-1550.545] * (-1542.684) (-1552.290) [-1547.959] (-1559.742) -- 0:00:33
892500 -- (-1558.952) (-1561.391) [-1546.472] (-1549.378) * [-1560.924] (-1555.991) (-1551.170) (-1555.807) -- 0:00:32
893000 -- (-1551.381) [-1552.988] (-1548.249) (-1553.407) * (-1559.307) [-1556.748] (-1564.209) (-1556.777) -- 0:00:32
893500 -- [-1551.328] (-1548.017) (-1559.367) (-1563.637) * [-1549.924] (-1561.821) (-1552.850) (-1550.519) -- 0:00:32
894000 -- (-1554.748) (-1564.435) (-1556.673) [-1542.356] * (-1548.675) (-1551.214) (-1563.387) [-1550.973] -- 0:00:32
894500 -- (-1552.412) [-1549.085] (-1552.347) (-1554.683) * (-1554.444) (-1553.344) (-1550.596) [-1551.225] -- 0:00:32
895000 -- (-1562.837) [-1547.560] (-1562.200) (-1550.214) * [-1549.489] (-1582.031) (-1552.192) (-1552.006) -- 0:00:32
Average standard deviation of split frequencies: 0.006276
895500 -- (-1560.443) (-1547.017) (-1555.149) [-1546.818] * (-1546.198) [-1547.858] (-1551.023) (-1545.555) -- 0:00:31
896000 -- (-1561.177) (-1558.584) [-1550.601] (-1548.043) * (-1558.890) (-1555.554) [-1551.058] (-1553.065) -- 0:00:31
896500 -- (-1550.279) (-1553.751) [-1554.005] (-1551.703) * (-1564.376) (-1555.131) (-1563.342) [-1555.409] -- 0:00:31
897000 -- (-1546.516) [-1553.382] (-1555.467) (-1557.114) * (-1544.903) (-1557.692) [-1556.321] (-1560.417) -- 0:00:31
897500 -- (-1553.956) (-1551.526) (-1552.358) [-1555.444] * (-1562.208) (-1559.570) (-1549.911) [-1545.115] -- 0:00:31
898000 -- (-1570.527) [-1541.765] (-1563.108) (-1552.272) * (-1556.003) (-1565.467) [-1553.456] (-1550.718) -- 0:00:31
898500 -- (-1556.789) (-1551.088) [-1555.791] (-1551.303) * (-1559.228) (-1552.777) (-1556.794) [-1547.283] -- 0:00:31
899000 -- (-1540.240) (-1558.188) [-1546.190] (-1568.728) * (-1558.612) (-1553.103) (-1562.028) [-1548.399] -- 0:00:30
899500 -- (-1547.680) (-1559.128) [-1556.730] (-1564.586) * [-1558.405] (-1558.393) (-1552.445) (-1546.649) -- 0:00:30
900000 -- (-1557.638) (-1554.567) [-1549.940] (-1557.863) * (-1544.503) (-1567.775) (-1574.658) [-1553.561] -- 0:00:30
Average standard deviation of split frequencies: 0.006356
900500 -- (-1553.262) [-1547.753] (-1559.016) (-1573.090) * [-1551.616] (-1557.148) (-1550.663) (-1545.564) -- 0:00:30
901000 -- (-1553.755) [-1549.851] (-1549.778) (-1552.167) * (-1568.686) (-1550.756) [-1550.327] (-1556.209) -- 0:00:30
901500 -- (-1561.328) (-1549.079) (-1541.625) [-1547.783] * (-1558.175) (-1561.330) (-1548.569) [-1546.566] -- 0:00:30
902000 -- (-1547.531) [-1547.568] (-1558.547) (-1559.044) * (-1556.381) [-1548.747] (-1550.302) (-1559.619) -- 0:00:29
902500 -- (-1544.161) [-1544.517] (-1549.290) (-1556.524) * (-1552.594) (-1544.425) (-1550.985) [-1547.196] -- 0:00:29
903000 -- [-1554.482] (-1556.869) (-1544.190) (-1560.707) * (-1571.663) [-1548.690] (-1548.437) (-1561.403) -- 0:00:29
903500 -- (-1544.785) [-1550.202] (-1561.591) (-1560.879) * (-1564.003) (-1556.541) [-1550.954] (-1558.464) -- 0:00:29
904000 -- (-1561.236) (-1554.080) [-1550.437] (-1557.017) * (-1557.262) [-1550.482] (-1543.227) (-1546.618) -- 0:00:29
904500 -- (-1559.817) [-1558.767] (-1550.306) (-1566.651) * (-1561.977) (-1546.548) (-1541.141) [-1550.032] -- 0:00:29
905000 -- (-1553.078) (-1551.927) [-1563.590] (-1567.037) * (-1555.381) (-1545.437) (-1559.579) [-1549.704] -- 0:00:29
Average standard deviation of split frequencies: 0.005946
905500 -- [-1554.893] (-1551.651) (-1570.169) (-1559.245) * (-1560.747) (-1559.092) [-1544.827] (-1559.891) -- 0:00:28
906000 -- [-1553.685] (-1547.271) (-1566.199) (-1546.413) * (-1555.522) [-1545.860] (-1545.972) (-1558.613) -- 0:00:28
906500 -- [-1550.430] (-1559.570) (-1557.564) (-1547.870) * (-1563.488) (-1557.877) (-1556.178) [-1562.288] -- 0:00:28
907000 -- [-1565.910] (-1562.554) (-1551.702) (-1558.070) * [-1546.752] (-1551.115) (-1545.459) (-1558.069) -- 0:00:28
907500 -- (-1562.918) (-1561.360) (-1548.697) [-1554.760] * (-1557.264) (-1551.533) [-1549.884] (-1557.352) -- 0:00:28
908000 -- (-1564.200) (-1554.697) (-1566.613) [-1551.743] * (-1575.239) [-1549.034] (-1556.462) (-1568.143) -- 0:00:28
908500 -- (-1565.041) (-1556.160) [-1556.998] (-1555.186) * (-1547.178) (-1559.105) (-1551.826) [-1549.722] -- 0:00:27
909000 -- (-1561.229) [-1550.061] (-1549.190) (-1551.715) * (-1555.986) [-1544.696] (-1553.213) (-1560.611) -- 0:00:27
909500 -- (-1579.059) [-1544.402] (-1550.786) (-1551.665) * (-1552.007) [-1556.337] (-1569.890) (-1559.862) -- 0:00:27
910000 -- (-1563.889) (-1553.898) [-1553.459] (-1569.828) * [-1540.660] (-1551.614) (-1562.270) (-1556.392) -- 0:00:27
Average standard deviation of split frequencies: 0.005768
910500 -- (-1557.872) (-1570.628) [-1549.492] (-1561.893) * (-1557.885) (-1566.215) [-1546.807] (-1559.561) -- 0:00:27
911000 -- (-1562.112) (-1565.973) [-1554.121] (-1555.756) * (-1565.337) [-1551.236] (-1552.863) (-1557.326) -- 0:00:27
911500 -- (-1557.487) [-1541.320] (-1554.831) (-1559.130) * (-1549.639) [-1554.876] (-1549.939) (-1560.233) -- 0:00:27
912000 -- (-1567.986) (-1552.339) (-1560.725) [-1548.050] * (-1547.543) [-1563.588] (-1560.226) (-1548.828) -- 0:00:26
912500 -- (-1548.443) (-1554.988) (-1555.156) [-1548.367] * (-1560.703) (-1551.820) [-1551.567] (-1565.039) -- 0:00:26
913000 -- (-1554.944) [-1552.374] (-1559.423) (-1548.709) * [-1546.649] (-1548.439) (-1556.683) (-1547.840) -- 0:00:26
913500 -- [-1546.861] (-1558.552) (-1552.578) (-1554.726) * [-1547.668] (-1555.098) (-1545.368) (-1553.182) -- 0:00:26
914000 -- (-1551.440) (-1552.628) [-1547.066] (-1549.933) * (-1552.236) (-1556.716) [-1562.466] (-1554.831) -- 0:00:26
914500 -- [-1550.251] (-1557.288) (-1549.480) (-1549.044) * (-1550.061) (-1562.038) [-1542.126] (-1549.155) -- 0:00:26
915000 -- (-1560.968) (-1550.949) [-1551.094] (-1552.247) * [-1550.031] (-1548.068) (-1554.731) (-1558.651) -- 0:00:26
Average standard deviation of split frequencies: 0.005918
915500 -- (-1556.100) (-1549.254) (-1559.257) [-1553.391] * (-1548.389) (-1557.916) (-1551.187) [-1548.832] -- 0:00:25
916000 -- [-1543.282] (-1556.363) (-1559.368) (-1550.183) * (-1555.141) (-1559.504) [-1551.596] (-1559.390) -- 0:00:25
916500 -- (-1554.211) (-1574.193) [-1554.887] (-1562.646) * (-1557.657) (-1556.928) [-1550.294] (-1550.523) -- 0:00:25
917000 -- (-1544.453) (-1561.052) (-1551.102) [-1544.443] * (-1551.379) (-1543.457) [-1567.184] (-1554.068) -- 0:00:25
917500 -- (-1551.071) (-1560.323) [-1559.298] (-1555.373) * [-1547.650] (-1551.612) (-1563.262) (-1555.661) -- 0:00:25
918000 -- (-1554.757) (-1550.397) [-1557.235] (-1559.876) * (-1561.196) [-1550.031] (-1552.875) (-1560.358) -- 0:00:25
918500 -- (-1559.150) [-1558.173] (-1556.649) (-1551.542) * (-1551.904) (-1563.508) [-1547.321] (-1570.265) -- 0:00:24
919000 -- [-1545.445] (-1546.210) (-1543.780) (-1566.178) * (-1550.279) (-1567.193) (-1554.413) [-1546.033] -- 0:00:24
919500 -- (-1556.802) (-1556.924) [-1551.023] (-1551.038) * (-1564.859) (-1555.024) (-1557.413) [-1543.742] -- 0:00:24
920000 -- (-1558.378) (-1559.166) [-1550.477] (-1549.781) * (-1573.518) (-1559.983) (-1545.906) [-1550.852] -- 0:00:24
Average standard deviation of split frequencies: 0.005523
920500 -- (-1558.560) [-1561.958] (-1558.514) (-1565.454) * (-1563.484) [-1553.512] (-1555.069) (-1556.735) -- 0:00:24
921000 -- (-1556.890) (-1549.615) [-1544.602] (-1550.437) * (-1560.094) (-1559.078) (-1561.533) [-1569.429] -- 0:00:24
921500 -- [-1558.198] (-1550.387) (-1557.267) (-1549.562) * (-1564.900) [-1558.079] (-1559.345) (-1548.816) -- 0:00:24
922000 -- (-1552.163) [-1556.545] (-1554.896) (-1547.464) * (-1550.498) (-1555.481) [-1547.855] (-1563.272) -- 0:00:23
922500 -- (-1566.816) [-1542.036] (-1558.013) (-1546.827) * (-1550.390) (-1572.109) [-1545.578] (-1556.431) -- 0:00:23
923000 -- (-1569.915) (-1549.291) (-1567.615) [-1553.293] * (-1563.037) [-1567.330] (-1542.607) (-1558.528) -- 0:00:23
923500 -- (-1555.205) (-1558.264) (-1561.491) [-1553.814] * [-1544.540] (-1551.227) (-1549.591) (-1556.934) -- 0:00:23
924000 -- (-1558.167) (-1552.453) [-1552.832] (-1551.227) * (-1552.690) (-1568.977) (-1553.304) [-1548.565] -- 0:00:23
924500 -- (-1549.163) [-1549.442] (-1568.508) (-1560.861) * [-1551.694] (-1557.588) (-1557.443) (-1569.230) -- 0:00:23
925000 -- (-1555.316) (-1566.481) (-1548.838) [-1548.042] * [-1551.027] (-1557.253) (-1563.433) (-1558.019) -- 0:00:22
Average standard deviation of split frequencies: 0.005818
925500 -- (-1559.557) (-1552.717) (-1550.027) [-1546.705] * (-1559.907) [-1546.180] (-1565.345) (-1565.342) -- 0:00:22
926000 -- (-1558.683) [-1549.586] (-1554.749) (-1552.657) * [-1549.458] (-1557.585) (-1554.621) (-1556.383) -- 0:00:22
926500 -- (-1565.359) (-1549.694) [-1550.352] (-1551.592) * [-1548.521] (-1557.453) (-1552.691) (-1559.863) -- 0:00:22
927000 -- (-1568.682) [-1560.856] (-1548.572) (-1561.137) * (-1555.864) (-1568.142) (-1561.972) [-1548.566] -- 0:00:22
927500 -- (-1555.525) (-1554.751) [-1543.206] (-1552.754) * (-1552.829) [-1549.875] (-1557.462) (-1550.079) -- 0:00:22
928000 -- (-1550.940) [-1548.007] (-1552.819) (-1569.598) * (-1549.478) (-1554.158) (-1552.239) [-1547.293] -- 0:00:22
928500 -- (-1549.644) (-1572.834) [-1551.843] (-1549.557) * (-1546.958) [-1549.126] (-1556.006) (-1554.843) -- 0:00:21
929000 -- (-1550.421) (-1562.859) [-1557.160] (-1553.715) * (-1548.044) (-1556.682) (-1558.131) [-1550.681] -- 0:00:21
929500 -- (-1560.538) (-1551.674) [-1546.245] (-1556.036) * (-1563.318) (-1561.192) (-1551.899) [-1550.277] -- 0:00:21
930000 -- [-1553.457] (-1573.969) (-1561.280) (-1550.938) * (-1558.964) (-1554.040) [-1548.866] (-1559.858) -- 0:00:21
Average standard deviation of split frequencies: 0.006078
930500 -- (-1560.263) (-1559.532) [-1554.380] (-1558.362) * [-1542.676] (-1553.942) (-1553.872) (-1553.340) -- 0:00:21
931000 -- [-1552.539] (-1547.353) (-1567.045) (-1557.224) * (-1555.276) [-1552.848] (-1549.993) (-1556.512) -- 0:00:21
931500 -- [-1547.213] (-1549.975) (-1564.573) (-1557.118) * (-1551.725) (-1548.661) (-1551.466) [-1553.375] -- 0:00:20
932000 -- (-1556.660) (-1555.434) (-1558.356) [-1551.682] * (-1552.493) (-1554.154) [-1550.961] (-1551.481) -- 0:00:20
932500 -- (-1553.037) (-1562.887) [-1543.192] (-1555.333) * (-1574.488) [-1548.722] (-1556.804) (-1554.257) -- 0:00:20
933000 -- (-1546.937) [-1547.346] (-1551.888) (-1563.528) * (-1575.433) (-1551.054) (-1562.843) [-1547.787] -- 0:00:20
933500 -- [-1548.866] (-1553.465) (-1560.292) (-1555.650) * (-1557.593) (-1556.014) [-1548.132] (-1549.081) -- 0:00:20
934000 -- (-1562.552) [-1555.963] (-1551.717) (-1572.597) * [-1559.726] (-1553.174) (-1553.386) (-1548.385) -- 0:00:20
934500 -- (-1547.714) (-1556.434) [-1547.028] (-1560.422) * (-1563.234) (-1558.562) (-1567.011) [-1555.907] -- 0:00:20
935000 -- [-1547.862] (-1568.669) (-1560.032) (-1557.693) * (-1550.636) (-1551.044) [-1548.472] (-1548.519) -- 0:00:19
Average standard deviation of split frequencies: 0.005972
935500 -- (-1561.514) (-1568.487) (-1559.868) [-1555.166] * (-1549.593) (-1549.885) [-1545.921] (-1555.264) -- 0:00:19
936000 -- [-1550.274] (-1558.155) (-1560.803) (-1552.300) * (-1551.532) (-1561.490) [-1554.301] (-1577.445) -- 0:00:19
936500 -- (-1555.980) (-1562.532) [-1549.728] (-1545.131) * [-1546.454] (-1550.982) (-1553.683) (-1552.363) -- 0:00:19
937000 -- [-1543.383] (-1563.362) (-1564.248) (-1563.424) * (-1547.027) [-1566.110] (-1558.040) (-1559.458) -- 0:00:19
937500 -- (-1556.542) (-1564.085) (-1553.145) [-1547.380] * [-1544.213] (-1549.640) (-1549.571) (-1554.152) -- 0:00:19
938000 -- (-1549.969) (-1559.267) (-1558.513) [-1556.256] * (-1551.389) (-1551.037) (-1555.657) [-1553.530] -- 0:00:18
938500 -- [-1554.369] (-1550.438) (-1556.470) (-1549.634) * (-1550.367) (-1546.539) (-1567.841) [-1540.235] -- 0:00:18
939000 -- [-1559.889] (-1555.955) (-1555.175) (-1558.068) * (-1563.488) (-1554.782) [-1548.024] (-1553.365) -- 0:00:18
939500 -- [-1553.252] (-1559.643) (-1547.554) (-1556.337) * (-1547.063) (-1542.904) [-1545.884] (-1570.788) -- 0:00:18
940000 -- (-1559.269) (-1559.035) (-1548.712) [-1547.140] * (-1541.472) (-1546.100) [-1553.279] (-1550.966) -- 0:00:18
Average standard deviation of split frequencies: 0.005405
940500 -- (-1551.617) (-1564.799) (-1545.350) [-1547.503] * (-1549.628) [-1547.289] (-1550.010) (-1571.627) -- 0:00:18
941000 -- (-1552.339) (-1551.782) (-1552.725) [-1547.845] * (-1548.544) [-1543.251] (-1552.431) (-1552.057) -- 0:00:18
941500 -- (-1554.265) [-1559.527] (-1553.246) (-1548.813) * (-1555.548) [-1541.349] (-1545.955) (-1556.496) -- 0:00:17
942000 -- [-1545.496] (-1547.794) (-1566.244) (-1583.327) * [-1550.170] (-1551.600) (-1547.788) (-1559.401) -- 0:00:17
942500 -- [-1558.669] (-1548.044) (-1570.593) (-1555.128) * (-1548.084) (-1546.513) [-1550.301] (-1563.743) -- 0:00:17
943000 -- (-1563.567) (-1545.956) (-1553.125) [-1555.194] * (-1556.531) [-1547.130] (-1556.447) (-1563.614) -- 0:00:17
943500 -- (-1546.952) (-1551.863) [-1562.402] (-1550.743) * (-1551.721) [-1549.578] (-1562.991) (-1571.666) -- 0:00:17
944000 -- (-1553.628) [-1553.810] (-1555.736) (-1563.866) * (-1558.329) (-1552.572) [-1548.212] (-1554.168) -- 0:00:17
944500 -- (-1551.007) (-1573.014) (-1569.805) [-1545.527] * (-1548.541) [-1557.208] (-1563.578) (-1546.104) -- 0:00:16
945000 -- (-1550.420) [-1560.910] (-1567.878) (-1550.196) * (-1541.873) (-1560.964) [-1558.064] (-1556.119) -- 0:00:16
Average standard deviation of split frequencies: 0.005766
945500 -- (-1550.792) (-1556.656) (-1558.846) [-1549.524] * (-1564.951) [-1549.812] (-1544.214) (-1561.892) -- 0:00:16
946000 -- (-1550.041) (-1554.552) (-1565.619) [-1559.043] * (-1558.620) [-1540.769] (-1557.410) (-1566.049) -- 0:00:16
946500 -- [-1551.844] (-1550.378) (-1554.987) (-1553.082) * (-1553.411) [-1549.454] (-1550.947) (-1562.430) -- 0:00:16
947000 -- (-1544.328) (-1546.616) [-1554.043] (-1559.422) * (-1555.660) (-1555.726) [-1554.179] (-1562.565) -- 0:00:16
947500 -- (-1545.883) (-1550.297) [-1546.326] (-1563.653) * [-1539.791] (-1564.923) (-1546.516) (-1566.329) -- 0:00:16
948000 -- (-1559.096) (-1553.796) (-1549.919) [-1549.221] * [-1553.420] (-1557.864) (-1552.326) (-1556.413) -- 0:00:15
948500 -- (-1554.436) [-1543.278] (-1551.007) (-1547.439) * (-1555.676) [-1544.951] (-1557.785) (-1548.324) -- 0:00:15
949000 -- (-1571.947) [-1545.519] (-1555.048) (-1547.774) * (-1561.616) (-1551.943) [-1545.349] (-1560.693) -- 0:00:15
949500 -- (-1566.854) (-1555.571) (-1551.956) [-1557.695] * (-1553.670) [-1551.920] (-1557.804) (-1559.341) -- 0:00:15
950000 -- [-1549.685] (-1560.391) (-1544.545) (-1549.147) * [-1552.208] (-1556.848) (-1551.639) (-1549.366) -- 0:00:15
Average standard deviation of split frequencies: 0.006163
950500 -- (-1560.969) (-1549.509) [-1552.764] (-1555.969) * (-1564.852) (-1552.612) [-1549.024] (-1562.381) -- 0:00:15
951000 -- [-1547.046] (-1550.977) (-1544.889) (-1562.355) * (-1550.106) (-1552.444) [-1544.079] (-1559.997) -- 0:00:14
951500 -- [-1554.643] (-1551.058) (-1555.526) (-1558.855) * (-1553.246) [-1550.626] (-1555.615) (-1560.635) -- 0:00:14
952000 -- [-1551.599] (-1558.939) (-1551.093) (-1547.539) * (-1563.219) (-1553.773) [-1553.426] (-1563.326) -- 0:00:14
952500 -- (-1552.765) (-1555.859) [-1547.136] (-1551.295) * (-1548.725) [-1558.634] (-1552.862) (-1561.695) -- 0:00:14
953000 -- (-1558.225) (-1551.163) (-1562.523) [-1551.353] * [-1556.004] (-1555.160) (-1555.471) (-1564.981) -- 0:00:14
953500 -- (-1557.358) (-1559.292) [-1562.510] (-1551.589) * (-1555.217) [-1549.285] (-1557.023) (-1555.955) -- 0:00:14
954000 -- (-1560.588) (-1555.668) (-1544.371) [-1549.626] * (-1558.524) [-1547.168] (-1568.285) (-1545.885) -- 0:00:14
954500 -- [-1569.392] (-1552.049) (-1552.356) (-1559.101) * (-1551.995) (-1551.061) [-1552.791] (-1548.806) -- 0:00:13
955000 -- [-1549.051] (-1564.698) (-1551.688) (-1558.786) * [-1548.310] (-1563.372) (-1546.918) (-1559.303) -- 0:00:13
Average standard deviation of split frequencies: 0.006129
955500 -- (-1553.805) [-1547.297] (-1560.344) (-1563.002) * (-1558.280) (-1556.959) [-1544.396] (-1549.855) -- 0:00:13
956000 -- (-1548.494) (-1553.723) (-1563.989) [-1551.665] * (-1545.867) (-1549.490) (-1555.703) [-1550.208] -- 0:00:13
956500 -- (-1558.923) (-1555.665) (-1550.303) [-1544.698] * (-1549.366) (-1556.951) (-1552.929) [-1546.353] -- 0:00:13
957000 -- (-1558.953) (-1547.321) (-1558.974) [-1549.831] * (-1557.844) [-1548.790] (-1556.682) (-1563.664) -- 0:00:13
957500 -- (-1550.334) (-1551.210) (-1564.412) [-1551.212] * [-1540.817] (-1555.863) (-1555.784) (-1557.128) -- 0:00:13
958000 -- (-1551.817) (-1563.337) (-1558.554) [-1552.455] * (-1555.057) (-1553.213) (-1558.240) [-1555.068] -- 0:00:12
958500 -- (-1547.057) (-1570.945) (-1555.401) [-1554.137] * (-1548.984) [-1548.051] (-1569.280) (-1558.262) -- 0:00:12
959000 -- [-1551.166] (-1554.230) (-1559.582) (-1542.214) * (-1554.110) (-1548.634) (-1551.115) [-1547.995] -- 0:00:12
959500 -- (-1554.328) [-1544.640] (-1555.763) (-1548.958) * [-1555.489] (-1553.814) (-1560.255) (-1562.685) -- 0:00:12
960000 -- [-1547.419] (-1551.490) (-1553.562) (-1561.854) * (-1557.719) (-1540.455) [-1546.281] (-1559.786) -- 0:00:12
Average standard deviation of split frequencies: 0.006099
960500 -- [-1541.352] (-1560.108) (-1547.602) (-1558.287) * (-1555.713) (-1552.603) (-1552.973) [-1546.719] -- 0:00:12
961000 -- (-1559.391) (-1550.575) [-1550.284] (-1566.732) * (-1555.199) (-1560.036) [-1551.455] (-1558.425) -- 0:00:11
961500 -- (-1564.709) [-1553.413] (-1560.702) (-1547.969) * [-1547.489] (-1552.986) (-1564.341) (-1551.600) -- 0:00:11
962000 -- (-1577.303) (-1548.138) [-1564.437] (-1559.205) * (-1547.841) (-1551.371) (-1548.994) [-1546.184] -- 0:00:11
962500 -- (-1560.098) [-1555.746] (-1548.410) (-1558.419) * [-1550.051] (-1558.522) (-1579.324) (-1551.589) -- 0:00:11
963000 -- [-1555.543] (-1550.491) (-1557.557) (-1586.228) * (-1555.017) (-1558.774) (-1562.200) [-1561.971] -- 0:00:11
963500 -- (-1559.215) (-1545.236) [-1549.605] (-1561.895) * [-1553.515] (-1562.190) (-1556.201) (-1565.799) -- 0:00:11
964000 -- (-1566.609) (-1560.756) [-1549.614] (-1562.862) * [-1548.449] (-1563.624) (-1549.478) (-1559.634) -- 0:00:11
964500 -- (-1553.537) (-1559.399) (-1562.730) [-1548.367] * [-1549.759] (-1554.394) (-1557.303) (-1559.388) -- 0:00:10
965000 -- [-1552.210] (-1557.461) (-1553.973) (-1554.989) * (-1557.137) (-1547.185) [-1552.228] (-1560.073) -- 0:00:10
Average standard deviation of split frequencies: 0.006274
965500 -- (-1551.860) (-1549.272) [-1542.072] (-1561.622) * [-1551.170] (-1552.833) (-1549.535) (-1561.245) -- 0:00:10
966000 -- (-1551.273) (-1549.306) (-1552.131) [-1558.399] * (-1556.354) (-1556.977) (-1551.685) [-1552.142] -- 0:00:10
966500 -- (-1568.646) [-1550.870] (-1549.942) (-1545.532) * (-1556.386) [-1552.750] (-1551.701) (-1553.918) -- 0:00:10
967000 -- (-1551.964) (-1555.397) (-1553.111) [-1550.542] * [-1551.578] (-1552.492) (-1554.883) (-1557.917) -- 0:00:10
967500 -- [-1546.026] (-1563.187) (-1563.829) (-1545.313) * (-1561.572) (-1556.085) (-1551.330) [-1550.203] -- 0:00:09
968000 -- (-1557.358) (-1543.988) (-1573.186) [-1553.142] * [-1548.360] (-1553.738) (-1554.716) (-1553.860) -- 0:00:09
968500 -- [-1550.909] (-1549.700) (-1551.153) (-1554.303) * [-1555.916] (-1558.464) (-1564.223) (-1553.517) -- 0:00:09
969000 -- (-1550.835) [-1548.854] (-1565.079) (-1558.218) * (-1548.548) (-1551.327) (-1564.195) [-1546.213] -- 0:00:09
969500 -- (-1560.392) (-1551.611) (-1554.964) [-1550.640] * (-1554.733) (-1557.749) (-1549.386) [-1548.734] -- 0:00:09
970000 -- (-1547.406) (-1558.367) (-1566.546) [-1549.267] * (-1556.677) (-1550.389) [-1553.491] (-1557.213) -- 0:00:09
Average standard deviation of split frequencies: 0.006660
970500 -- [-1545.497] (-1545.421) (-1550.885) (-1550.142) * (-1563.483) [-1543.137] (-1555.289) (-1553.614) -- 0:00:09
971000 -- (-1542.749) (-1552.690) (-1558.050) [-1552.763] * (-1554.424) (-1561.587) (-1548.289) [-1546.409] -- 0:00:08
971500 -- (-1542.714) [-1557.052] (-1566.425) (-1553.281) * [-1548.318] (-1558.363) (-1562.991) (-1549.301) -- 0:00:08
972000 -- (-1553.665) (-1556.988) (-1568.417) [-1545.321] * (-1548.681) (-1553.539) [-1552.213] (-1553.241) -- 0:00:08
972500 -- [-1549.775] (-1557.691) (-1565.048) (-1548.124) * [-1553.231] (-1556.850) (-1542.535) (-1563.671) -- 0:00:08
973000 -- (-1548.956) (-1558.367) [-1545.078] (-1563.740) * [-1554.778] (-1564.001) (-1551.124) (-1552.722) -- 0:00:08
973500 -- [-1555.034] (-1550.530) (-1557.171) (-1564.714) * (-1555.287) [-1553.276] (-1557.926) (-1559.472) -- 0:00:08
974000 -- [-1543.960] (-1558.084) (-1547.483) (-1563.556) * (-1554.650) (-1559.126) [-1550.691] (-1545.370) -- 0:00:07
974500 -- (-1549.405) (-1551.094) (-1561.984) [-1551.411] * (-1563.571) (-1571.085) (-1545.641) [-1553.362] -- 0:00:07
975000 -- (-1553.208) (-1565.285) (-1550.619) [-1555.047] * [-1549.524] (-1571.270) (-1543.245) (-1558.146) -- 0:00:07
Average standard deviation of split frequencies: 0.006520
975500 -- (-1561.970) (-1559.520) [-1554.319] (-1551.335) * (-1559.494) (-1560.384) (-1548.229) [-1549.559] -- 0:00:07
976000 -- (-1561.108) (-1545.729) [-1552.753] (-1555.322) * (-1551.063) [-1549.943] (-1551.700) (-1557.010) -- 0:00:07
976500 -- [-1550.173] (-1555.140) (-1553.115) (-1557.780) * (-1561.026) [-1551.992] (-1577.464) (-1566.197) -- 0:00:07
977000 -- (-1558.829) [-1554.220] (-1571.285) (-1561.551) * [-1556.959] (-1542.460) (-1557.520) (-1549.250) -- 0:00:07
977500 -- (-1562.992) (-1559.618) (-1554.287) [-1547.659] * (-1552.440) [-1547.938] (-1556.675) (-1545.112) -- 0:00:06
978000 -- (-1551.538) [-1556.316] (-1546.343) (-1549.950) * (-1558.875) [-1549.191] (-1550.140) (-1555.297) -- 0:00:06
978500 -- (-1562.107) (-1544.741) (-1552.923) [-1544.700] * (-1555.181) [-1543.963] (-1545.610) (-1553.360) -- 0:00:06
979000 -- (-1547.178) [-1550.254] (-1581.786) (-1554.841) * (-1552.123) [-1541.998] (-1553.594) (-1550.885) -- 0:00:06
979500 -- [-1557.023] (-1551.130) (-1562.235) (-1556.852) * (-1558.466) [-1544.847] (-1545.845) (-1548.010) -- 0:00:06
980000 -- (-1553.709) (-1558.563) (-1550.264) [-1543.943] * (-1553.442) (-1559.268) [-1549.441] (-1556.659) -- 0:00:06
Average standard deviation of split frequencies: 0.006009
980500 -- (-1556.657) [-1554.575] (-1558.611) (-1552.933) * (-1559.245) (-1556.820) [-1547.575] (-1556.153) -- 0:00:05
981000 -- (-1565.341) [-1546.841] (-1560.714) (-1546.753) * (-1559.245) (-1542.619) (-1548.062) [-1550.443] -- 0:00:05
981500 -- [-1548.863] (-1561.225) (-1552.249) (-1559.367) * (-1562.165) (-1547.025) [-1550.452] (-1553.854) -- 0:00:05
982000 -- (-1551.233) (-1561.072) (-1572.192) [-1542.422] * [-1547.509] (-1545.393) (-1551.818) (-1555.661) -- 0:00:05
982500 -- [-1551.266] (-1556.512) (-1553.186) (-1550.178) * (-1551.192) (-1545.682) [-1552.922] (-1551.467) -- 0:00:05
983000 -- (-1575.069) [-1545.842] (-1570.133) (-1556.199) * (-1550.571) [-1543.853] (-1556.388) (-1561.159) -- 0:00:05
983500 -- [-1549.126] (-1550.743) (-1551.390) (-1552.524) * (-1547.123) [-1545.616] (-1560.530) (-1555.983) -- 0:00:05
984000 -- (-1563.040) (-1550.990) (-1555.529) [-1549.398] * (-1548.536) [-1557.083] (-1563.033) (-1554.805) -- 0:00:04
984500 -- (-1549.338) (-1552.539) [-1546.719] (-1555.007) * [-1549.929] (-1566.038) (-1548.950) (-1556.596) -- 0:00:04
985000 -- (-1553.919) [-1548.317] (-1549.082) (-1553.584) * [-1553.191] (-1552.518) (-1559.831) (-1553.392) -- 0:00:04
Average standard deviation of split frequencies: 0.006113
985500 -- (-1553.965) [-1549.337] (-1560.178) (-1555.638) * (-1548.502) (-1552.348) (-1565.191) [-1550.681] -- 0:00:04
986000 -- (-1560.040) [-1548.940] (-1565.233) (-1553.758) * (-1551.148) [-1547.287] (-1559.548) (-1540.286) -- 0:00:04
986500 -- [-1551.057] (-1554.801) (-1558.582) (-1562.944) * (-1543.970) (-1565.054) [-1545.752] (-1555.522) -- 0:00:04
987000 -- (-1561.066) [-1547.519] (-1562.054) (-1549.634) * [-1551.358] (-1548.173) (-1545.553) (-1562.355) -- 0:00:03
987500 -- (-1567.623) (-1549.205) (-1565.391) [-1552.565] * (-1545.840) (-1547.102) [-1546.956] (-1555.406) -- 0:00:03
988000 -- (-1563.099) [-1547.664] (-1556.228) (-1554.874) * [-1543.816] (-1562.143) (-1553.176) (-1561.439) -- 0:00:03
988500 -- [-1552.133] (-1542.993) (-1552.685) (-1553.245) * [-1548.516] (-1563.584) (-1561.557) (-1548.305) -- 0:00:03
989000 -- [-1545.852] (-1556.856) (-1556.204) (-1568.802) * [-1547.698] (-1563.341) (-1558.675) (-1558.204) -- 0:00:03
989500 -- [-1545.539] (-1555.225) (-1569.996) (-1565.858) * (-1551.012) (-1553.606) [-1558.695] (-1556.874) -- 0:00:03
990000 -- [-1551.352] (-1551.585) (-1551.103) (-1563.424) * (-1547.239) (-1544.357) (-1559.092) [-1556.140] -- 0:00:03
Average standard deviation of split frequencies: 0.005778
990500 -- (-1557.485) (-1574.606) (-1548.750) [-1552.137] * [-1552.915] (-1569.604) (-1550.686) (-1561.769) -- 0:00:02
991000 -- (-1552.205) [-1556.114] (-1552.693) (-1557.474) * (-1561.517) (-1556.698) (-1557.549) [-1551.584] -- 0:00:02
991500 -- (-1552.995) [-1554.471] (-1558.332) (-1549.862) * [-1565.475] (-1553.610) (-1553.066) (-1567.810) -- 0:00:02
992000 -- [-1549.443] (-1564.083) (-1559.415) (-1560.659) * (-1547.422) [-1552.524] (-1561.266) (-1546.398) -- 0:00:02
992500 -- (-1555.505) (-1558.549) (-1552.372) [-1554.892] * (-1553.418) (-1552.983) [-1544.527] (-1546.797) -- 0:00:02
993000 -- [-1540.425] (-1562.694) (-1559.125) (-1547.148) * (-1549.998) (-1562.749) (-1555.667) [-1545.178] -- 0:00:02
993500 -- [-1553.684] (-1555.100) (-1553.769) (-1543.623) * (-1551.046) (-1564.538) [-1544.763] (-1549.279) -- 0:00:01
994000 -- [-1544.780] (-1559.703) (-1556.523) (-1542.231) * (-1553.657) (-1556.497) (-1558.203) [-1548.644] -- 0:00:01
994500 -- (-1563.235) (-1550.686) (-1556.951) [-1550.893] * (-1559.662) [-1552.308] (-1554.759) (-1555.500) -- 0:00:01
995000 -- [-1552.358] (-1560.245) (-1564.313) (-1552.705) * (-1546.767) [-1552.220] (-1561.211) (-1553.806) -- 0:00:01
Average standard deviation of split frequencies: 0.005984
995500 -- (-1553.404) [-1542.682] (-1549.365) (-1564.656) * (-1545.239) (-1556.999) [-1544.997] (-1559.923) -- 0:00:01
996000 -- (-1550.272) (-1545.927) [-1551.433] (-1566.001) * (-1566.347) [-1546.097] (-1558.843) (-1561.176) -- 0:00:01
996500 -- (-1555.765) (-1562.317) (-1562.127) [-1556.371] * (-1565.157) [-1553.574] (-1559.142) (-1554.913) -- 0:00:01
997000 -- [-1547.643] (-1555.708) (-1552.888) (-1565.407) * [-1558.222] (-1548.128) (-1552.570) (-1558.203) -- 0:00:00
997500 -- [-1548.414] (-1563.712) (-1560.035) (-1569.199) * (-1551.467) (-1550.761) (-1553.674) [-1553.133] -- 0:00:00
998000 -- [-1545.647] (-1563.668) (-1549.302) (-1548.310) * [-1556.239] (-1570.145) (-1549.018) (-1550.511) -- 0:00:00
998500 -- [-1553.410] (-1561.392) (-1546.532) (-1549.863) * (-1543.502) (-1556.121) [-1547.296] (-1552.578) -- 0:00:00
999000 -- [-1560.313] (-1562.128) (-1572.151) (-1548.154) * (-1574.345) [-1548.632] (-1553.159) (-1552.369) -- 0:00:00
999500 -- (-1560.993) (-1554.905) (-1560.426) [-1545.606] * [-1550.095] (-1554.396) (-1554.881) (-1563.112) -- 0:00:00
1000000 -- (-1554.524) [-1552.981] (-1558.079) (-1551.862) * (-1554.667) [-1551.567] (-1545.239) (-1549.166) -- 0:00:00
Average standard deviation of split frequencies: 0.006124
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1554.524411 -- 25.455919
Chain 1 -- -1554.524412 -- 25.455919
Chain 2 -- -1552.980884 -- 30.617514
Chain 2 -- -1552.980896 -- 30.617514
Chain 3 -- -1558.079192 -- 30.287201
Chain 3 -- -1558.079197 -- 30.287201
Chain 4 -- -1551.861569 -- 28.576283
Chain 4 -- -1551.861579 -- 28.576283
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1554.666662 -- 31.799340
Chain 1 -- -1554.666657 -- 31.799340
Chain 2 -- -1551.566566 -- 28.298884
Chain 2 -- -1551.566566 -- 28.298884
Chain 3 -- -1545.239314 -- 31.247315
Chain 3 -- -1545.239306 -- 31.247315
Chain 4 -- -1549.166107 -- 25.543556
Chain 4 -- -1549.166105 -- 25.543556
Analysis completed in 5 mins 6 seconds
Analysis used 306.04 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1536.06
Likelihood of best state for "cold" chain of run 2 was -1535.59
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.8 % ( 58 %) Dirichlet(Revmat{all})
71.4 % ( 59 %) Slider(Revmat{all})
26.6 % ( 21 %) Dirichlet(Pi{all})
28.5 % ( 24 %) Slider(Pi{all})
67.3 % ( 40 %) Multiplier(Alpha{1,2})
48.8 % ( 30 %) Multiplier(Alpha{3})
61.8 % ( 29 %) Slider(Pinvar{all})
16.7 % ( 13 %) ExtSPR(Tau{all},V{all})
3.8 % ( 5 %) ExtTBR(Tau{all},V{all})
23.1 % ( 21 %) NNI(Tau{all},V{all})
19.8 % ( 20 %) ParsSPR(Tau{all},V{all})
27.0 % ( 22 %) Multiplier(V{all})
49.6 % ( 44 %) Nodeslider(V{all})
25.7 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
59.3 % ( 44 %) Dirichlet(Revmat{all})
72.9 % ( 55 %) Slider(Revmat{all})
26.7 % ( 26 %) Dirichlet(Pi{all})
28.8 % ( 22 %) Slider(Pi{all})
67.4 % ( 33 %) Multiplier(Alpha{1,2})
48.2 % ( 17 %) Multiplier(Alpha{3})
62.2 % ( 27 %) Slider(Pinvar{all})
16.7 % ( 17 %) ExtSPR(Tau{all},V{all})
4.0 % ( 5 %) ExtTBR(Tau{all},V{all})
23.0 % ( 22 %) NNI(Tau{all},V{all})
19.8 % ( 23 %) ParsSPR(Tau{all},V{all})
27.1 % ( 26 %) Multiplier(V{all})
49.6 % ( 55 %) Nodeslider(V{all})
25.7 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.73 0.51 0.33
2 | 166456 0.75 0.53
3 | 167064 166905 0.76
4 | 167105 166120 166350
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.73 0.51 0.34
2 | 166202 0.75 0.53
3 | 167272 166799 0.76
4 | 167062 165975 166690
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1548.29
| 2 2 |
|2 2 1 |
| 2 1 1 2 1 1 2 2 |
| 1 1 2 2 12 22 111 2 1 |
|1 112 2 2* 1 1 1 1 2 2 1 1 1|
| 11 *22 2 1 1 11 12 2 1 1 2 2|
| 1 1 1 12 22 12 21 22 1 1* 2 2 |
| 2 1 * 21 1 1 22 2222 12 * 1 |
| 2 2 12 2 1 1 21 21 |
| 1 * 1 |
| 2 2 |
| 2 1 1 |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1554.70
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1544.40 -1562.83
2 -1544.56 -1563.72
--------------------------------------
TOTAL -1544.48 -1563.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.247920 0.001647 0.176359 0.333366 0.244050 1307.41 1310.60 1.000
r(A<->C){all} 0.111095 0.001122 0.050567 0.178397 0.108058 747.82 835.04 1.000
r(A<->G){all} 0.152878 0.001703 0.077245 0.231470 0.148975 860.48 1021.09 1.000
r(A<->T){all} 0.067466 0.001098 0.012128 0.133970 0.062763 572.59 693.46 1.000
r(C<->G){all} 0.061421 0.000641 0.016602 0.111196 0.058105 899.13 1064.58 1.000
r(C<->T){all} 0.558366 0.004760 0.430141 0.696077 0.558382 677.21 764.72 1.000
r(G<->T){all} 0.048773 0.000730 0.003535 0.099599 0.044829 649.11 806.42 1.001
pi(A){all} 0.285953 0.000252 0.253916 0.314870 0.285640 1172.42 1266.40 1.003
pi(C){all} 0.261314 0.000221 0.232901 0.290045 0.260857 1057.87 1220.34 1.000
pi(G){all} 0.258237 0.000240 0.228554 0.287916 0.258559 1103.28 1177.05 1.001
pi(T){all} 0.194496 0.000198 0.166689 0.220516 0.194117 1180.49 1220.57 1.000
alpha{1,2} 0.056370 0.001757 0.000143 0.134510 0.048662 1226.83 1234.60 1.000
alpha{3} 2.077090 0.654349 0.694719 3.637498 1.954483 1378.89 1439.94 1.000
pinvar{all} 0.475676 0.008692 0.280469 0.634387 0.488729 1139.60 1235.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
12 -- C12
Key to taxon bipartitions (saved to file "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------------
1 -- .***********
2 -- .*..........
3 -- ..*.........
4 -- ...*........
5 -- ....*.......
6 -- .....*......
7 -- ......*.....
8 -- .......*....
9 -- ........*...
10 -- .........*..
11 -- ..........*.
12 -- ...........*
13 -- .....*******
14 -- ...*********
15 -- .*.*********
16 -- ..........**
17 -- .....***....
18 -- .....***.***
19 -- .....*.*....
20 -- ...**.......
21 -- .........***
22 -- .....***.*..
23 -- .....***..**
24 -- ...*.*******
25 -- ......**....
26 -- ....********
------------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 3002 1.000000 0.000000 1.000000 1.000000 2
15 2968 0.988674 0.000942 0.988008 0.989340 2
16 2961 0.986342 0.000471 0.986009 0.986676 2
17 2960 0.986009 0.002827 0.984011 0.988008 2
18 2838 0.945370 0.002827 0.943371 0.947368 2
19 2165 0.721186 0.004240 0.718188 0.724184 2
20 1432 0.477015 0.023555 0.460360 0.493671 2
21 1094 0.364424 0.003769 0.361759 0.367089 2
22 927 0.308794 0.003298 0.306462 0.311126 2
23 875 0.291472 0.001413 0.290473 0.292472 2
24 847 0.282145 0.030621 0.260493 0.303797 2
25 810 0.269820 0.004711 0.266489 0.273151 2
26 723 0.240839 0.007066 0.235843 0.245836 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.003687 0.000010 0.000007 0.009816 0.002858 1.000 2
length{all}[2] 0.003723 0.000010 0.000000 0.009994 0.002897 1.000 2
length{all}[3] 0.050277 0.000190 0.025293 0.077764 0.048342 1.001 2
length{all}[4] 0.002107 0.000005 0.000000 0.006383 0.001443 1.000 2
length{all}[5] 0.004000 0.000009 0.000010 0.009511 0.003369 1.000 2
length{all}[6] 0.005429 0.000013 0.000214 0.012773 0.004684 1.000 2
length{all}[7] 0.005174 0.000014 0.000008 0.012324 0.004340 1.000 2
length{all}[8] 0.005040 0.000013 0.000019 0.012156 0.004217 1.000 2
length{all}[9] 0.013386 0.000035 0.003978 0.025438 0.012486 1.000 2
length{all}[10] 0.008621 0.000022 0.001316 0.017936 0.007631 1.000 2
length{all}[11] 0.008730 0.000021 0.001569 0.018026 0.007926 1.000 2
length{all}[12] 0.008747 0.000022 0.001221 0.017592 0.007963 1.001 2
length{all}[13] 0.020129 0.000059 0.005901 0.035267 0.019138 1.000 2
length{all}[14] 0.071651 0.000387 0.036125 0.110356 0.068653 1.000 2
length{all}[15] 0.007483 0.000020 0.000756 0.016609 0.006700 1.000 2
length{all}[16] 0.006241 0.000015 0.000400 0.013249 0.005521 1.000 2
length{all}[17] 0.007539 0.000019 0.000574 0.015885 0.006769 1.000 2
length{all}[18] 0.006692 0.000018 0.000316 0.015130 0.005775 1.000 2
length{all}[19] 0.004501 0.000011 0.000029 0.011057 0.003664 1.000 2
length{all}[20] 0.003395 0.000009 0.000003 0.009527 0.002597 0.999 2
length{all}[21] 0.002552 0.000006 0.000001 0.007438 0.001814 1.000 2
length{all}[22] 0.002232 0.000006 0.000003 0.007347 0.001468 0.999 2
length{all}[23] 0.002133 0.000005 0.000001 0.006525 0.001441 0.999 2
length{all}[24] 0.002433 0.000005 0.000008 0.007105 0.001740 1.000 2
length{all}[25] 0.004287 0.000009 0.000068 0.010211 0.003649 1.000 2
length{all}[26] 0.002185 0.000005 0.000018 0.006851 0.001483 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006124
Maximum standard deviation of split frequencies = 0.030621
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C3 (3)
|
| /------------------------------------------------------------ C2 (2)
+ |
| | /-------------------------------------------------- C4 (4)
| | |
| | |-------------------------------------------------- C5 (5)
\----99---+ |
| | /---------- C6 (6)
| | /----72---+
| | | \---------- C8 (8)
\---100---+ /----99---+
| | \-------------------- C7 (7)
| |
| /----95---+------------------------------ C10 (10)
| | |
| | | /---------- C11 (11)
\---100---+ \---------99--------+
| \---------- C12 (12)
|
\---------------------------------------- C9 (9)
Phylogram (based on average branch lengths):
/-- C1 (1)
|
|------------------------------ C3 (3)
|
| /-- C2 (2)
+ |
| | /- C4 (4)
| | |
| | |-- C5 (5)
\---+ |
| | /--- C6 (6)
| | /-+
| | | \--- C8 (8)
\-----------------------------------------+ /---+
| | \--- C7 (7)
| |
| /---+---- C10 (10)
| | |
| | | /----- C11 (11)
\-----------+ \--+
| \----- C12 (12)
|
\-------- C9 (9)
|-----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (161 trees sampled):
50 % credible set contains 6 trees
90 % credible set contains 18 trees
95 % credible set contains 47 trees
99 % credible set contains 131 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 12 ls = 744
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Reading seq #12: C12
Sequences read..
Counting site patterns.. 0:00
111 patterns at 248 / 248 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11 12
528 bytes for distance
108336 bytes for conP
15096 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
433344 bytes for conP, adjusted
0.000792 0.082797 0.010577 0.001860 0.107536 0.000217 0.004775 0.030035 0.007079 0.009329 0.001496 0.004645 0.007594 0.006696 0.013668 0.006112 0.010104 0.014496 0.023969 0.300000 1.300000
ntime & nrate & np: 19 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 21
lnL0 = -1583.931122
Iterating by ming2
Initial: fx= 1583.931122
x= 0.00079 0.08280 0.01058 0.00186 0.10754 0.00022 0.00478 0.03003 0.00708 0.00933 0.00150 0.00465 0.00759 0.00670 0.01367 0.00611 0.01010 0.01450 0.02397 0.30000 1.30000
1 h-m-p 0.0000 0.0000 1150.3606 ++ 1583.138549 m 0.0000 26 | 1/21
2 h-m-p 0.0000 0.0000 382.2836 YCYC 1582.653073 3 0.0000 54 | 1/21
3 h-m-p 0.0000 0.0001 258.1054 +YYCCCCC 1581.259394 6 0.0001 89 | 1/21
4 h-m-p 0.0000 0.0000 591.3203 +YYCCCC 1579.765311 5 0.0000 122 | 1/21
5 h-m-p 0.0000 0.0001 968.8223 +YYYYYCC 1574.956619 6 0.0001 154 | 1/21
6 h-m-p 0.0000 0.0000 3918.3752 YCCCC 1570.469270 4 0.0000 185 | 1/21
7 h-m-p 0.0000 0.0001 3112.8014 +CCCC 1553.126173 3 0.0001 216 | 1/21
8 h-m-p 0.0000 0.0001 2039.5577 +YYCCCC 1548.228344 5 0.0000 249 | 1/21
9 h-m-p 0.0000 0.0000 1773.1846 +YYYYYYY 1543.634952 6 0.0000 280 | 1/21
10 h-m-p 0.0000 0.0000 10298.3059 YCYCCC 1541.997989 5 0.0000 312 | 1/21
11 h-m-p 0.0000 0.0000 1040.1563 +YCYCCC 1540.127896 5 0.0000 345 | 1/21
12 h-m-p 0.0000 0.0001 970.2550 +YYCCCC 1536.182715 5 0.0001 378 | 1/21
13 h-m-p 0.0000 0.0000 2455.2633 CCCCC 1534.988195 4 0.0000 410 | 1/21
14 h-m-p 0.0000 0.0001 121.5246 CC 1534.855369 1 0.0000 436 | 1/21
15 h-m-p 0.0000 0.0002 154.1383 +YYCCC 1534.505465 4 0.0001 467 | 1/21
16 h-m-p 0.0001 0.0010 189.7975 +YCYCCC 1532.306785 5 0.0005 500 | 1/21
17 h-m-p 0.0002 0.0013 602.2225 YCYCCC 1529.350136 5 0.0003 532 | 1/21
18 h-m-p 0.0002 0.0011 690.4659 +YYYCYYYYCC 1486.816953 10 0.0010 569 | 1/21
19 h-m-p 0.0000 0.0000 1555.9705 YYYCCC 1486.459203 5 0.0000 600 | 1/21
20 h-m-p 0.0090 0.5140 1.6165 CYC 1486.209937 2 0.0107 627 | 1/21
21 h-m-p 0.0046 0.0229 3.6704 +YYYYYCCCCC 1475.147583 9 0.0189 665 | 1/21
22 h-m-p 0.1631 0.8153 0.1524 +YYYYC 1464.628316 4 0.6357 694 | 1/21
23 h-m-p 0.0368 0.1840 0.4228 CCC 1463.677676 2 0.0355 742 | 1/21
24 h-m-p 0.4119 2.7488 0.0364 +YYCCC 1461.790537 4 1.2547 793 | 1/21
25 h-m-p 0.8250 4.1251 0.0435 CYC 1461.232452 2 0.8056 840 | 1/21
26 h-m-p 0.5214 2.6254 0.0671 YCCCC 1460.475516 4 1.1085 891 | 1/21
27 h-m-p 0.9440 6.4198 0.0788 YCY 1459.800735 2 1.6625 938 | 1/21
28 h-m-p 1.3991 6.9956 0.0888 CCCC 1459.324359 3 1.9571 988 | 1/21
29 h-m-p 0.8873 4.4366 0.1091 CCC 1459.081884 2 1.0910 1036 | 1/21
30 h-m-p 1.6000 8.0000 0.0389 CC 1459.015066 1 1.6474 1082 | 1/21
31 h-m-p 1.6000 8.0000 0.0172 YC 1458.972202 1 3.1216 1127 | 1/21
32 h-m-p 1.6000 8.0000 0.0087 CC 1458.946278 1 1.6559 1173 | 1/21
33 h-m-p 1.6000 8.0000 0.0025 CC 1458.937330 1 1.6959 1219 | 1/21
34 h-m-p 1.3365 8.0000 0.0031 YC 1458.928969 1 3.0238 1264 | 1/21
35 h-m-p 1.6000 8.0000 0.0053 YC 1458.926734 1 1.2173 1309 | 1/21
36 h-m-p 1.6000 8.0000 0.0029 C 1458.925495 0 1.7373 1353 | 1/21
37 h-m-p 1.6000 8.0000 0.0007 CC 1458.924362 1 2.3711 1399 | 1/21
38 h-m-p 1.6000 8.0000 0.0010 C 1458.924092 0 1.8293 1443 | 1/21
39 h-m-p 1.6000 8.0000 0.0001 YC 1458.923915 1 3.5326 1488 | 1/21
40 h-m-p 0.4187 8.0000 0.0011 +C 1458.923867 0 1.6951 1533 | 1/21
41 h-m-p 1.6000 8.0000 0.0004 Y 1458.923848 0 2.5757 1577 | 1/21
42 h-m-p 1.6000 8.0000 0.0001 Y 1458.923833 0 2.5777 1621 | 1/21
43 h-m-p 1.6000 8.0000 0.0001 +Y 1458.923825 0 4.0394 1666 | 1/21
44 h-m-p 1.5080 8.0000 0.0002 C 1458.923821 0 2.0321 1710 | 1/21
45 h-m-p 1.6000 8.0000 0.0000 C 1458.923821 0 1.6659 1754 | 1/21
46 h-m-p 0.5494 8.0000 0.0000 +C 1458.923820 0 2.1976 1799 | 1/21
47 h-m-p 1.6000 8.0000 0.0000 Y 1458.923820 0 1.1074 1843 | 1/21
48 h-m-p 1.6000 8.0000 0.0000 C 1458.923820 0 0.6369 1887 | 1/21
49 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/21
50 h-m-p 0.0015 0.7598 0.0074 ----Y 1458.923820 0 0.0000 1993 | 1/21
51 h-m-p 0.0158 7.9054 0.0026 -------------.. | 1/21
52 h-m-p 0.0017 0.8316 0.0069 ----------- | 1/21
53 h-m-p 0.0017 0.8316 0.0069 -----------
Out..
lnL = -1458.923820
2155 lfun, 2155 eigenQcodon, 40945 P(t)
Time used: 0:13
Model 1: NearlyNeutral
TREE # 1
(1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
0.000792 0.082797 0.010577 0.001860 0.107536 0.000217 0.004775 0.030035 0.007079 0.009329 0.001496 0.004645 0.007594 0.006696 0.013668 0.006112 0.010104 0.014496 0.023969 1.860255 0.822315 0.590611
ntime & nrate & np: 19 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.181990
np = 22
lnL0 = -1498.896785
Iterating by ming2
Initial: fx= 1498.896785
x= 0.00079 0.08280 0.01058 0.00186 0.10754 0.00022 0.00478 0.03003 0.00708 0.00933 0.00150 0.00465 0.00759 0.00670 0.01367 0.00611 0.01010 0.01450 0.02397 1.86025 0.82232 0.59061
1 h-m-p 0.0000 0.0000 999.1964 ++ 1498.244062 m 0.0000 49 | 1/22
2 h-m-p 0.0000 0.0000 309.8421 CC 1497.980000 1 0.0000 98 | 1/22
3 h-m-p 0.0000 0.0001 168.5607 YCCC 1497.695684 3 0.0000 149 | 1/22
4 h-m-p 0.0000 0.0001 170.3656 CCCC 1497.511543 3 0.0000 201 | 1/22
5 h-m-p 0.0000 0.0003 129.3923 +YYC 1497.131140 2 0.0001 250 | 1/22
6 h-m-p 0.0000 0.0002 300.5188 +YCYCC 1496.059094 4 0.0001 303 | 1/22
7 h-m-p 0.0000 0.0004 1068.6377 +YCYCCC 1489.307238 5 0.0003 358 | 1/22
8 h-m-p 0.0000 0.0000 8853.4644 ++ 1483.407734 m 0.0000 404 | 2/22
9 h-m-p 0.0000 0.0001 3472.1744 CYCCC 1481.066294 4 0.0000 458 | 2/22
10 h-m-p 0.0000 0.0001 593.7133 YCCC 1480.900573 3 0.0000 508 | 2/22
11 h-m-p 0.0001 0.0025 57.8844 CCC 1480.793742 2 0.0001 557 | 1/22
12 h-m-p 0.0000 0.0018 155.1001 +YCYCC 1478.384347 4 0.0003 609 | 1/22
13 h-m-p 0.0008 0.0042 18.7685 YCCC 1478.226091 3 0.0006 660 | 1/22
14 h-m-p 0.0004 0.0018 23.2809 CC 1478.064514 1 0.0004 708 | 1/22
15 h-m-p 0.0003 0.0016 29.2813 YCCC 1477.917099 3 0.0002 759 | 1/22
16 h-m-p 0.0002 0.0017 29.6967 +CCYC 1474.463047 3 0.0014 812 | 1/22
17 h-m-p 0.0000 0.0001 1147.6624 +YCYCCC 1471.870262 5 0.0000 867 | 1/22
18 h-m-p 0.0000 0.0002 398.8838 YCYCCC 1467.717769 5 0.0001 921 | 1/22
19 h-m-p 0.0001 0.0003 170.0597 +YYYYCYCCC 1461.700353 8 0.0003 979 | 1/22
20 h-m-p 0.0000 0.0001 800.4836 +YYCCCC 1458.295185 5 0.0000 1034 | 1/22
21 h-m-p 0.0000 0.0000 423.6112 YCYCCC 1457.539720 5 0.0000 1088 | 1/22
22 h-m-p 0.0026 0.0978 3.8745 +++ 1454.998718 m 0.0978 1135 | 2/22
23 h-m-p 0.0889 0.4446 1.2844 YCYCCC 1453.787106 5 0.2358 1189 | 1/22
24 h-m-p 0.0003 0.0014 190.1457 CC 1453.779412 1 0.0001 1236 | 1/22
25 h-m-p 0.0360 1.5150 0.4091 +YCCC 1452.466149 3 0.3051 1288 | 1/22
26 h-m-p 0.1022 0.5110 0.4643 ++ 1451.910776 m 0.5110 1334 | 2/22
27 h-m-p 0.2712 1.3561 0.3557 CCCC 1451.634742 3 0.3675 1386 | 2/22
28 h-m-p 1.0693 7.7438 0.1222 YCC 1451.481966 2 0.7610 1434 | 2/22
29 h-m-p 1.6000 8.0000 0.0482 YC 1451.416589 1 1.0351 1480 | 2/22
30 h-m-p 1.6000 8.0000 0.0166 YCC 1451.393551 2 0.9823 1528 | 2/22
31 h-m-p 1.3734 8.0000 0.0119 CC 1451.372556 1 1.5371 1575 | 2/22
32 h-m-p 1.6000 8.0000 0.0057 CC 1451.363953 1 1.3679 1622 | 2/22
33 h-m-p 1.6000 8.0000 0.0007 YC 1451.362332 1 1.0579 1668 | 2/22
34 h-m-p 0.2714 8.0000 0.0026 +CC 1451.361806 1 1.3388 1716 | 2/22
35 h-m-p 1.6000 8.0000 0.0012 YC 1451.361368 1 2.6157 1762 | 2/22
36 h-m-p 1.6000 8.0000 0.0010 YC 1451.361230 1 3.0519 1808 | 2/22
37 h-m-p 1.6000 8.0000 0.0003 C 1451.361190 0 1.6326 1853 | 2/22
38 h-m-p 0.8215 8.0000 0.0005 C 1451.361184 0 1.1077 1898 | 2/22
39 h-m-p 1.6000 8.0000 0.0001 C 1451.361180 0 2.3190 1943 | 2/22
40 h-m-p 1.6000 8.0000 0.0001 C 1451.361180 0 1.3726 1988 | 2/22
41 h-m-p 1.6000 8.0000 0.0000 C 1451.361180 0 1.7221 2033 | 2/22
42 h-m-p 0.9449 8.0000 0.0000 C 1451.361180 0 0.9201 2078 | 2/22
43 h-m-p 1.6000 8.0000 0.0000 C 1451.361180 0 1.6930 2123 | 2/22
44 h-m-p 0.7848 8.0000 0.0000 +C 1451.361180 0 3.8802 2169 | 2/22
45 h-m-p 1.6000 8.0000 0.0000 ----Y 1451.361180 0 0.0016 2218
Out..
lnL = -1451.361180
2219 lfun, 6657 eigenQcodon, 84322 P(t)
Time used: 0:39
Model 2: PositiveSelection
TREE # 1
(1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
initial w for M2:NSpselection reset.
0.000792 0.082797 0.010577 0.001860 0.107536 0.000217 0.004775 0.030035 0.007079 0.009329 0.001496 0.004645 0.007594 0.006696 0.013668 0.006112 0.010104 0.014496 0.023969 1.928818 0.862503 0.107410 0.336572 2.818396
ntime & nrate & np: 19 3 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.331442
np = 24
lnL0 = -1510.452953
Iterating by ming2
Initial: fx= 1510.452953
x= 0.00079 0.08280 0.01058 0.00186 0.10754 0.00022 0.00478 0.03003 0.00708 0.00933 0.00150 0.00465 0.00759 0.00670 0.01367 0.00611 0.01010 0.01450 0.02397 1.92882 0.86250 0.10741 0.33657 2.81840
1 h-m-p 0.0000 0.0000 1083.5884 ++ 1509.634379 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0000 352.8202 YCCC 1509.244703 3 0.0000 109 | 1/24
3 h-m-p 0.0000 0.0001 189.3611 YCCC 1508.875263 3 0.0000 164 | 1/24
4 h-m-p 0.0000 0.0001 154.8109 CYCCC 1508.700076 4 0.0000 221 | 1/24
5 h-m-p 0.0000 0.0004 116.5341 +YYYC 1508.270296 3 0.0001 275 | 1/24
6 h-m-p 0.0001 0.0005 175.3065 CCC 1507.799646 2 0.0001 329 | 1/24
7 h-m-p 0.0001 0.0003 274.2226 CCCC 1507.172888 3 0.0001 385 | 1/24
8 h-m-p 0.0000 0.0002 352.4327 +YYCCCC 1505.868363 5 0.0001 444 | 1/24
9 h-m-p 0.0000 0.0001 1453.4780 +YYCCC 1503.464405 4 0.0001 501 | 1/24
10 h-m-p 0.0000 0.0001 3687.3664 ++ 1498.070711 m 0.0001 551 | 2/24
11 h-m-p 0.0012 0.0061 11.0684 YCCC 1497.834473 3 0.0006 606 | 2/24
12 h-m-p 0.0000 0.0007 199.8170 ++YCYCCC 1492.923656 5 0.0004 665 | 2/24
13 h-m-p 0.0000 0.0001 704.6159 YCCCC 1491.445731 4 0.0000 721 | 2/24
14 h-m-p 0.0000 0.0002 164.9070 CCCC 1491.176525 3 0.0001 776 | 2/24
15 h-m-p 0.0000 0.0002 283.4291 CYCCC 1490.798848 4 0.0001 832 | 2/24
16 h-m-p 0.0000 0.0003 446.3070 +YYYYYCCCC 1489.612959 8 0.0002 893 | 2/24
17 h-m-p 0.0000 0.0003 1434.0741 +YYCCC 1485.857987 4 0.0002 949 | 2/24
18 h-m-p 0.0000 0.0001 4030.4822 +YCYCCC 1479.716664 5 0.0001 1007 | 2/24
19 h-m-p 0.0000 0.0002 1224.2400 YCYCCC 1478.107512 5 0.0001 1064 | 2/24
20 h-m-p 0.0001 0.0006 306.5588 +YYCCC 1476.811078 4 0.0004 1120 | 2/24
21 h-m-p 0.0006 0.0066 201.7244 +YYYYC 1472.440578 4 0.0022 1174 | 2/24
22 h-m-p 0.0671 0.4070 6.5856 +YCCCC 1462.453365 4 0.1700 1231 | 2/24
23 h-m-p 0.0438 0.2189 4.4697 ++ 1459.166927 m 0.2189 1280 | 3/24
24 h-m-p 0.1346 0.6729 2.0459 +YCYCCC 1455.751925 5 0.3972 1338 | 3/24
25 h-m-p 0.3803 1.9016 1.2215 YYYYC 1454.962305 4 0.3753 1390 | 3/24
26 h-m-p 0.9433 4.7165 0.3528 YCCC 1454.347933 3 0.6992 1443 | 3/24
27 h-m-p 0.8816 4.4081 0.0867 CCCC 1453.455231 3 1.4992 1497 | 3/24
28 h-m-p 0.6270 5.0898 0.2073 CCC 1453.247889 2 0.5344 1549 | 3/24
29 h-m-p 0.8532 8.0000 0.1299 CC 1453.128678 1 1.1251 1599 | 3/24
30 h-m-p 1.6000 8.0000 0.0440 CCC 1453.031629 2 1.6657 1651 | 3/24
31 h-m-p 1.6000 8.0000 0.0362 YCC 1452.877392 2 2.5347 1702 | 2/24
32 h-m-p 0.0153 0.0927 5.9883 --C 1452.877100 0 0.0002 1752 | 2/24
33 h-m-p 0.0278 0.2957 0.0487 ++ 1452.825043 m 0.2957 1801 | 3/24
34 h-m-p 0.1068 8.0000 0.1349 ++YC 1452.538474 1 1.1878 1853 | 3/24
35 h-m-p 1.2824 8.0000 0.1250 YCCC 1452.333278 3 2.0614 1906 | 2/24
36 h-m-p 0.0033 0.1282 77.3663 -CC 1452.329713 1 0.0003 1957 | 2/24
37 h-m-p 0.2807 1.4037 0.0340 ++ 1452.144040 m 1.4037 2006 | 3/24
38 h-m-p 0.3590 8.0000 0.1330 +YC 1451.933147 1 1.0587 2057 | 3/24
39 h-m-p 0.5939 8.0000 0.2372 YCCC 1451.825518 3 1.2191 2110 | 3/24
40 h-m-p 1.6000 8.0000 0.0444 +YC 1451.719497 1 4.3451 2160 | 3/24
41 h-m-p 1.6000 8.0000 0.0522 YCCC 1451.606104 3 3.1690 2213 | 3/24
42 h-m-p 1.6000 8.0000 0.0760 +YC 1451.441878 1 4.0172 2263 | 3/24
43 h-m-p 1.4086 7.0430 0.0653 CCC 1451.378795 2 1.5734 2315 | 3/24
44 h-m-p 1.6000 8.0000 0.0131 CC 1451.366720 1 1.5425 2365 | 3/24
45 h-m-p 0.4978 8.0000 0.0406 +YC 1451.362371 1 1.6503 2415 | 3/24
46 h-m-p 1.6000 8.0000 0.0121 C 1451.361461 0 1.8515 2463 | 3/24
47 h-m-p 1.6000 8.0000 0.0103 C 1451.361219 0 1.7095 2511 | 3/24
48 h-m-p 1.6000 8.0000 0.0025 C 1451.361184 0 1.7975 2559 | 3/24
49 h-m-p 1.6000 8.0000 0.0008 C 1451.361180 0 1.4368 2607 | 3/24
50 h-m-p 1.6000 8.0000 0.0001 C 1451.361180 0 1.3087 2655 | 3/24
51 h-m-p 0.8598 8.0000 0.0001 Y 1451.361180 0 1.6586 2703 | 3/24
52 h-m-p 1.6000 8.0000 0.0000 C 1451.361180 0 1.6000 2751 | 3/24
53 h-m-p 0.3985 8.0000 0.0000 Y 1451.361180 0 0.9341 2799 | 3/24
54 h-m-p 1.3446 8.0000 0.0000 ---------Y 1451.361180 0 0.0000 2856
Out..
lnL = -1451.361180
2857 lfun, 11428 eigenQcodon, 162849 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1462.465115 S = -1412.417691 -41.407939
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 111 patterns 1:29
did 20 / 111 patterns 1:29
did 30 / 111 patterns 1:29
did 40 / 111 patterns 1:29
did 50 / 111 patterns 1:29
did 60 / 111 patterns 1:29
did 70 / 111 patterns 1:29
did 80 / 111 patterns 1:29
did 90 / 111 patterns 1:29
did 100 / 111 patterns 1:29
did 110 / 111 patterns 1:29
did 111 / 111 patterns 1:29
Time used: 1:29
Model 3: discrete
TREE # 1
(1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
0.000792 0.082797 0.010577 0.001860 0.107536 0.000217 0.004775 0.030035 0.007079 0.009329 0.001496 0.004645 0.007594 0.006696 0.013668 0.006112 0.010104 0.014496 0.023969 1.928818 0.335590 0.845675 0.039347 0.100780 0.142035
ntime & nrate & np: 19 4 25
Bounds (np=25):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 14.648365
np = 25
lnL0 = -1460.014570
Iterating by ming2
Initial: fx= 1460.014570
x= 0.00079 0.08280 0.01058 0.00186 0.10754 0.00022 0.00478 0.03003 0.00708 0.00933 0.00150 0.00465 0.00759 0.00670 0.01367 0.00611 0.01010 0.01450 0.02397 1.92882 0.33559 0.84567 0.03935 0.10078 0.14204
1 h-m-p 0.0000 0.0000 824.9504 ++ 1459.530028 m 0.0000 55 | 1/25
2 h-m-p 0.0000 0.0000 232.8464 YCCC 1459.361906 3 0.0000 113 | 1/25
3 h-m-p 0.0000 0.0000 192.4517 CCCC 1459.191787 3 0.0000 171 | 1/25
4 h-m-p 0.0000 0.0001 133.9041 CCCC 1459.073309 3 0.0000 229 | 1/25
5 h-m-p 0.0000 0.0004 62.8816 CC 1459.004817 1 0.0001 283 | 1/25
6 h-m-p 0.0000 0.0003 68.3244 CCCC 1458.932852 3 0.0001 341 | 1/25
7 h-m-p 0.0000 0.0004 105.0202 +YCC 1458.759735 2 0.0001 397 | 1/25
8 h-m-p 0.0000 0.0001 245.5391 ++ 1458.228946 m 0.0001 449 | 2/25
9 h-m-p 0.0002 0.0017 56.6075 YC 1458.202375 1 0.0001 502 | 2/25
10 h-m-p 0.0001 0.0011 79.6954 +CCC 1458.087523 2 0.0004 558 | 2/25
11 h-m-p 0.0000 0.0001 652.8034 ++ 1457.722347 m 0.0001 609 | 3/25
12 h-m-p 0.0000 0.0000 26547.9199 YCC 1457.607776 2 0.0000 663 | 3/25
13 h-m-p 0.0009 0.0043 8.7022 YCC 1457.595999 2 0.0002 716 | 3/25
14 h-m-p 0.0001 0.0011 15.6749 YCC 1457.566607 2 0.0002 769 | 3/25
15 h-m-p 0.0001 0.0011 33.9694 CC 1457.526835 1 0.0001 821 | 3/25
16 h-m-p 0.0001 0.0013 31.2447 YC 1457.503316 1 0.0001 872 | 3/25
17 h-m-p 0.0002 0.0034 16.1351 CC 1457.485908 1 0.0002 924 | 3/25
18 h-m-p 0.0001 0.0024 29.7623 CC 1457.467290 1 0.0001 976 | 3/25
19 h-m-p 0.0003 0.0033 12.5004 C 1457.463827 0 0.0001 1026 | 3/25
20 h-m-p 0.0002 0.0085 5.4722 CC 1457.461452 1 0.0001 1078 | 3/25
21 h-m-p 0.0004 0.1401 2.2534 +++YCC 1457.289488 2 0.0184 1134 | 2/25
22 h-m-p 0.0115 1.0692 3.6044 YCC 1457.279985 2 0.0016 1187 | 2/25
23 h-m-p 0.0041 2.0376 2.9114 +++CCCCC 1456.238992 4 0.3287 1249 | 1/25
24 h-m-p 0.0112 0.0600 85.4525 -CYC 1456.173016 2 0.0010 1304 | 1/25
25 h-m-p 0.2840 2.6798 0.2887 YC 1455.891233 1 0.6416 1357 | 1/25
26 h-m-p 0.2039 1.0197 0.6605 ++ 1455.443917 m 1.0197 1409 | 2/25
27 h-m-p 1.6000 8.0000 0.1749 YCC 1455.321937 2 0.9320 1464 | 2/25
28 h-m-p 0.3654 3.6365 0.4462 YC 1455.189337 1 0.6782 1516 | 2/25
29 h-m-p 0.5827 3.4633 0.5192 YCCC 1455.118388 3 0.4039 1572 | 2/25
30 h-m-p 1.6000 8.0000 0.1056 YCCC 1454.891987 3 3.3135 1628 | 2/25
31 h-m-p 1.5774 8.0000 0.2219 CYCCC 1454.401991 4 2.9536 1686 | 2/25
32 h-m-p 1.6000 8.0000 0.1790 CCCC 1453.918578 3 1.1746 1743 | 2/25
33 h-m-p 0.2067 4.5656 1.0175 +YCCC 1453.456883 3 0.5472 1800 | 2/25
34 h-m-p 0.9799 4.8994 0.1609 CCC 1452.897042 2 1.5856 1855 | 2/25
35 h-m-p 1.6000 8.0000 0.1458 CCCC 1452.569839 3 1.8755 1912 | 2/25
36 h-m-p 1.5574 7.7871 0.0992 YYC 1452.283992 2 1.2760 1965 | 2/25
37 h-m-p 0.3180 8.0000 0.3982 +YCCC 1452.048320 3 0.9526 2022 | 2/25
38 h-m-p 1.6000 8.0000 0.0901 CCC 1451.825592 2 1.5465 2077 | 2/25
39 h-m-p 0.8949 6.7264 0.1557 YCCC 1451.486361 3 2.2753 2133 | 2/25
40 h-m-p 0.8576 4.2880 0.1467 CCCC 1451.381406 3 1.2689 2190 | 2/25
41 h-m-p 1.6000 8.0000 0.0485 CYC 1451.346441 2 1.5134 2244 | 2/25
42 h-m-p 0.5153 8.0000 0.1426 YC 1451.334368 1 1.0596 2296 | 2/25
43 h-m-p 1.6000 8.0000 0.0106 YC 1451.333183 1 0.9603 2348 | 2/25
44 h-m-p 1.6000 8.0000 0.0031 Y 1451.333007 0 1.2408 2399 | 2/25
45 h-m-p 1.6000 8.0000 0.0022 C 1451.332947 0 1.4077 2450 | 2/25
46 h-m-p 1.6000 8.0000 0.0004 C 1451.332933 0 1.2961 2501 | 2/25
47 h-m-p 0.8261 8.0000 0.0007 C 1451.332931 0 1.0861 2552 | 2/25
48 h-m-p 1.6000 8.0000 0.0002 Y 1451.332930 0 1.1959 2603 | 2/25
49 h-m-p 1.6000 8.0000 0.0001 Y 1451.332930 0 3.9986 2654 | 2/25
50 h-m-p 1.1302 8.0000 0.0004 ++ 1451.332930 m 8.0000 2705 | 2/25
51 h-m-p 0.2604 8.0000 0.0126 +Y 1451.332925 0 2.4477 2757 | 2/25
52 h-m-p 1.6000 8.0000 0.0098 Y 1451.332921 0 2.8542 2808 | 2/25
53 h-m-p 1.6000 8.0000 0.0007 Y 1451.332921 0 1.0657 2859 | 2/25
54 h-m-p 1.6000 8.0000 0.0003 Y 1451.332921 0 0.8823 2910 | 2/25
55 h-m-p 1.6000 8.0000 0.0001 -Y 1451.332921 0 0.1000 2962 | 2/25
56 h-m-p 0.0267 8.0000 0.0002 -C 1451.332921 0 0.0017 3014 | 2/25
57 h-m-p 0.0160 8.0000 0.0000 ----Y 1451.332921 0 0.0000 3069
Out..
lnL = -1451.332921
3070 lfun, 12280 eigenQcodon, 174990 P(t)
Time used: 2:23
Model 7: beta
TREE # 1
(1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
0.000792 0.082797 0.010577 0.001860 0.107536 0.000217 0.004775 0.030035 0.007079 0.009329 0.001496 0.004645 0.007594 0.006696 0.013668 0.006112 0.010104 0.014496 0.023969 1.906611 0.637551 1.244267
ntime & nrate & np: 19 1 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.164723
np = 22
lnL0 = -1474.091300
Iterating by ming2
Initial: fx= 1474.091300
x= 0.00079 0.08280 0.01058 0.00186 0.10754 0.00022 0.00478 0.03003 0.00708 0.00933 0.00150 0.00465 0.00759 0.00670 0.01367 0.00611 0.01010 0.01450 0.02397 1.90661 0.63755 1.24427
1 h-m-p 0.0000 0.0000 939.3656 ++ 1473.475295 m 0.0000 49 | 1/22
2 h-m-p 0.0000 0.0000 287.5303 YC 1473.241711 1 0.0000 97 | 1/22
3 h-m-p 0.0000 0.0001 170.9835 YCCC 1473.030085 3 0.0000 148 | 1/22
4 h-m-p 0.0000 0.0001 135.8706 CCCC 1472.909141 3 0.0000 200 | 1/22
5 h-m-p 0.0000 0.0004 74.0556 YC 1472.772804 1 0.0001 247 | 1/22
6 h-m-p 0.0001 0.0003 106.7709 CCCC 1472.584582 3 0.0001 299 | 1/22
7 h-m-p 0.0000 0.0006 240.5184 +YCYC 1472.177083 3 0.0001 350 | 1/22
8 h-m-p 0.0001 0.0003 452.5699 +YYCCC 1470.695913 4 0.0002 403 | 1/22
9 h-m-p 0.0000 0.0002 1639.5266 +YYCCCC 1467.179975 5 0.0001 458 | 1/22
10 h-m-p 0.0000 0.0001 7126.5768 YCYCCC 1464.041447 5 0.0000 512 | 1/22
11 h-m-p 0.0000 0.0001 2477.8035 CYCCCC 1462.747360 5 0.0000 567 | 1/22
12 h-m-p 0.0001 0.0003 307.9359 CCCC 1462.429948 3 0.0001 619 | 1/22
13 h-m-p 0.0002 0.0010 40.9907 YCC 1462.361220 2 0.0002 668 | 1/22
14 h-m-p 0.0003 0.0015 20.4599 YC 1462.341498 1 0.0001 715 | 1/22
15 h-m-p 0.0000 0.0017 58.1798 +YC 1462.288317 1 0.0001 763 | 1/22
16 h-m-p 0.0001 0.0021 83.4921 +CYC 1462.104283 2 0.0004 813 | 1/22
17 h-m-p 0.0001 0.0010 259.1424 CCC 1461.884849 2 0.0001 863 | 1/22
18 h-m-p 0.0003 0.0090 120.6925 +YCCCC 1460.111622 4 0.0024 917 | 1/22
19 h-m-p 0.0001 0.0004 608.1084 CCC 1459.702921 2 0.0001 967 | 1/22
20 h-m-p 0.0002 0.0016 433.0612 +YYYYCC 1457.784466 5 0.0007 1020 | 1/22
21 h-m-p 0.3495 1.7476 0.7530 YCCCCC 1454.722130 5 0.7517 1075 | 1/22
22 h-m-p 0.4831 2.4156 0.9867 CYCC 1454.360542 3 0.3541 1126 | 1/22
23 h-m-p 1.1372 5.6861 0.2609 YCY 1454.094761 2 0.6593 1175 | 1/22
24 h-m-p 1.1197 8.0000 0.1536 CCCC 1453.832821 3 1.5511 1227 | 1/22
25 h-m-p 1.0479 5.2393 0.1824 CCCC 1453.557899 3 1.5281 1279 | 1/22
26 h-m-p 0.5906 3.5700 0.4719 +YCYC 1452.966904 3 1.8150 1331 | 1/22
27 h-m-p 0.0748 0.3740 2.2173 CYCYC 1452.743869 4 0.1590 1384 | 1/22
28 h-m-p 0.0412 0.2062 2.0998 +CYC 1452.378085 2 0.1588 1434 | 1/22
29 h-m-p 0.9695 4.8475 0.0901 YYCC 1451.847396 3 0.8315 1484 | 1/22
30 h-m-p 1.6000 8.0000 0.0405 CYC 1451.604638 2 1.4909 1533 | 1/22
31 h-m-p 0.2364 1.1818 0.1537 +Y 1451.487275 0 1.0535 1580 | 1/22
32 h-m-p 1.2023 6.0113 0.0729 YCCC 1451.394149 3 0.8457 1631 | 1/22
33 h-m-p 1.2027 8.0000 0.0512 CCC 1451.386398 2 0.3685 1681 | 1/22
34 h-m-p 0.2413 8.0000 0.0783 YC 1451.373090 1 0.4952 1728 | 1/22
35 h-m-p 1.6000 8.0000 0.0066 CCC 1451.358241 2 2.0618 1778 | 1/22
36 h-m-p 0.9643 6.1791 0.0142 CC 1451.340832 1 0.9806 1826 | 1/22
37 h-m-p 0.6366 5.3461 0.0219 YC 1451.334652 1 1.1095 1873 | 1/22
38 h-m-p 1.6000 8.0000 0.0055 YC 1451.334001 1 1.0234 1920 | 1/22
39 h-m-p 1.4679 8.0000 0.0039 C 1451.333838 0 1.3216 1966 | 1/22
40 h-m-p 1.6000 8.0000 0.0017 C 1451.333793 0 1.5992 2012 | 1/22
41 h-m-p 1.2974 8.0000 0.0021 C 1451.333759 0 1.4197 2058 | 1/22
42 h-m-p 1.6000 8.0000 0.0001 Y 1451.333756 0 0.9658 2104 | 1/22
43 h-m-p 0.1487 8.0000 0.0006 ++Y 1451.333747 0 3.5503 2152 | 1/22
44 h-m-p 1.6000 8.0000 0.0012 Y 1451.333747 0 0.2130 2198 | 1/22
45 h-m-p 0.2992 8.0000 0.0009 Y 1451.333747 0 0.1219 2244 | 1/22
46 h-m-p 0.1449 8.0000 0.0007 Y 1451.333747 0 0.0588 2290 | 1/22
47 h-m-p 0.0667 8.0000 0.0006 C 1451.333747 0 0.0820 2336 | 1/22
48 h-m-p 0.0937 8.0000 0.0006 Y 1451.333747 0 0.0562 2382 | 1/22
49 h-m-p 0.0619 8.0000 0.0005 Y 1451.333747 0 0.0467 2428 | 1/22
50 h-m-p 0.0504 8.0000 0.0005 Y 1451.333747 0 0.0291 2474 | 1/22
51 h-m-p 0.0312 8.0000 0.0004 Y 1451.333747 0 0.0613 2520 | 1/22
52 h-m-p 0.0664 8.0000 0.0004 Y 1451.333747 0 0.0093 2566 | 1/22
53 h-m-p 0.0160 8.0000 0.0004 -------------.. | 1/22
54 h-m-p 0.0002 0.1173 0.2599 -Y 1451.333746 0 0.0000 2670 | 1/22
55 h-m-p 0.0002 0.0811 0.1206 Y 1451.333746 0 0.0000 2716 | 1/22
56 h-m-p 0.0010 0.4896 0.0297 -C 1451.333746 0 0.0001 2763 | 1/22
57 h-m-p 0.0032 1.5972 0.0213 ------C 1451.333746 0 0.0000 2815 | 1/22
58 h-m-p 0.0058 2.8813 0.0148 --C 1451.333746 0 0.0001 2863 | 1/22
59 h-m-p 0.0037 1.8280 0.0042 ----Y 1451.333746 0 0.0000 2913 | 1/22
60 h-m-p 0.0160 8.0000 0.0033 -------Y 1451.333746 0 0.0000 2966 | 1/22
61 h-m-p 0.0136 6.8164 0.0042 --C 1451.333746 0 0.0002 3014 | 1/22
62 h-m-p 0.0156 7.8079 0.0035 --C 1451.333746 0 0.0003 3062 | 1/22
63 h-m-p 0.0160 8.0000 0.0050 -----C 1451.333746 0 0.0000 3113 | 1/22
64 h-m-p 0.0160 8.0000 0.0018 --Y 1451.333746 0 0.0002 3161 | 1/22
65 h-m-p 0.0160 8.0000 0.0014 ------C 1451.333746 0 0.0000 3213 | 1/22
66 h-m-p 0.0160 8.0000 0.0075 -----------Y 1451.333746 0 0.0000 3270 | 1/22
67 h-m-p 0.0160 8.0000 0.0083 -------Y 1451.333746 0 0.0000 3323 | 1/22
68 h-m-p 0.0160 8.0000 0.0096 -------------.. | 1/22
69 h-m-p 0.0060 3.0217 0.0561 ------------
Out..
lnL = -1451.333746
3437 lfun, 37807 eigenQcodon, 653030 P(t)
Time used: 5:43
Model 8: beta&w>1
TREE # 1
(1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
initial w for M8:NSbetaw>1 reset.
0.000792 0.082797 0.010577 0.001860 0.107536 0.000217 0.004775 0.030035 0.007079 0.009329 0.001496 0.004645 0.007594 0.006696 0.013668 0.006112 0.010104 0.014496 0.023969 1.906728 0.900000 0.681712 1.353905 2.843187
ntime & nrate & np: 19 2 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.641308
np = 24
lnL0 = -1485.006746
Iterating by ming2
Initial: fx= 1485.006746
x= 0.00079 0.08280 0.01058 0.00186 0.10754 0.00022 0.00478 0.03003 0.00708 0.00933 0.00150 0.00465 0.00759 0.00670 0.01367 0.00611 0.01010 0.01450 0.02397 1.90673 0.90000 0.68171 1.35390 2.84319
1 h-m-p 0.0000 0.0000 1038.7860 ++ 1484.215469 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0000 372.4110 YCCC 1483.703578 3 0.0000 109 | 1/24
3 h-m-p 0.0000 0.0001 303.8185 +YCYCCC 1482.751359 5 0.0000 168 | 1/24
4 h-m-p 0.0000 0.0000 439.3636 +YYCCC 1481.653033 4 0.0000 225 | 1/24
5 h-m-p 0.0000 0.0002 467.1109 +CYYCCC 1476.906152 5 0.0001 284 | 1/24
6 h-m-p 0.0000 0.0000 1349.1470 ++ 1474.869724 m 0.0000 334 | 2/24
7 h-m-p 0.0001 0.0003 174.6947 CCC 1474.399441 2 0.0001 388 | 2/24
8 h-m-p 0.0000 0.0002 210.0045 CCCC 1473.905623 3 0.0001 443 | 2/24
9 h-m-p 0.0000 0.0002 123.7276 +YCYCCC 1473.173098 5 0.0001 501 | 2/24
10 h-m-p 0.0000 0.0001 1190.8831 YCCCC 1471.703408 4 0.0000 557 | 2/24
11 h-m-p 0.0000 0.0002 568.4493 CCCCC 1471.014143 4 0.0000 614 | 2/24
12 h-m-p 0.0001 0.0008 201.2914 +YCCC 1469.317968 3 0.0003 669 | 2/24
13 h-m-p 0.0001 0.0003 601.6038 YCCCC 1467.466647 4 0.0001 725 | 2/24
14 h-m-p 0.0000 0.0002 261.3248 CCCC 1467.074999 3 0.0001 780 | 2/24
15 h-m-p 0.0001 0.0007 243.7210 +YCCC 1466.151335 3 0.0002 835 | 2/24
16 h-m-p 0.0001 0.0003 523.9218 CCCC 1465.472578 3 0.0001 890 | 2/24
17 h-m-p 0.0001 0.0003 459.1081 YCCC 1464.496017 3 0.0001 944 | 2/24
18 h-m-p 0.0001 0.0003 648.7638 YCYCCC 1462.763900 5 0.0001 1001 | 2/24
19 h-m-p 0.0000 0.0001 2005.2250 CYCYC 1460.325052 4 0.0001 1057 | 2/24
20 h-m-p 0.0003 0.0017 65.1850 YCCC 1460.283411 3 0.0001 1111 | 1/24
21 h-m-p 0.0000 0.0041 128.8991 +YCCC 1459.880460 3 0.0001 1166 | 1/24
22 h-m-p 0.0014 0.2515 5.5976 ++++ 1456.904052 m 0.2515 1218 | 1/24
23 h-m-p 0.4597 2.2984 1.1165 CYCCCC 1454.440079 5 0.7435 1277 | 1/24
24 h-m-p 0.1884 0.9422 1.5347 YCYCCC 1453.112409 5 0.4550 1335 | 1/24
25 h-m-p 0.3119 1.5594 0.6414 CYCCC 1452.602573 4 0.5827 1392 | 1/24
26 h-m-p 0.1638 0.8191 1.1483 YCCC 1452.230952 3 0.3757 1447 | 1/24
27 h-m-p 1.3991 6.9956 0.1007 CYC 1452.061049 2 1.3270 1500 | 1/24
28 h-m-p 1.5773 7.8866 0.0696 CYC 1451.941152 2 1.6009 1553 | 1/24
29 h-m-p 1.3904 6.9520 0.0585 YCCC 1451.770727 3 2.2304 1608 | 1/24
30 h-m-p 0.1510 0.7548 0.3415 +YCCC 1451.720298 3 0.4274 1664 | 1/24
31 h-m-p 0.4800 2.4000 0.0726 YC 1451.568401 1 1.0017 1715 | 1/24
32 h-m-p 0.1597 0.7986 0.1516 ++ 1451.484656 m 0.7986 1765 | 1/24
33 h-m-p -0.0000 -0.0000 0.3274
h-m-p: -0.00000000e+00 -0.00000000e+00 3.27449201e-01 1451.484656
.. | 1/24
34 h-m-p 0.0000 0.0001 71.3809 YCCC 1451.415482 3 0.0000 1867 | 1/24
35 h-m-p 0.0001 0.0018 16.4104 YC 1451.407758 1 0.0001 1918 | 1/24
36 h-m-p 0.0000 0.0008 22.2374 C 1451.401876 0 0.0000 1968 | 1/24
37 h-m-p 0.0000 0.0010 21.0045 YC 1451.394564 1 0.0001 2019 | 1/24
38 h-m-p 0.0000 0.0000 20.0865 ++ 1451.390485 m 0.0000 2069 | 2/24
39 h-m-p 0.0000 0.0009 21.3497 C 1451.388132 0 0.0000 2119 | 2/24
40 h-m-p 0.0001 0.0033 9.8613 CC 1451.386692 1 0.0001 2170 | 2/24
41 h-m-p 0.0001 0.0022 10.4100 CC 1451.385042 1 0.0001 2221 | 2/24
42 h-m-p 0.0000 0.0009 20.7918 YC 1451.381765 1 0.0001 2271 | 2/24
43 h-m-p 0.0000 0.0003 52.6831 CC 1451.377190 1 0.0001 2322 | 2/24
44 h-m-p 0.0001 0.0005 28.3815 CC 1451.371440 1 0.0001 2373 | 2/24
45 h-m-p 0.0001 0.0003 32.7708 CC 1451.368202 1 0.0001 2424 | 2/24
46 h-m-p 0.0001 0.0007 9.3526 YC 1451.367003 1 0.0001 2474 | 2/24
47 h-m-p 0.0001 0.0005 11.3565 CC 1451.366088 1 0.0001 2525 | 2/24
48 h-m-p 0.0001 0.0005 10.8233 CC 1451.364952 1 0.0001 2576 | 2/24
49 h-m-p 0.0001 0.0005 8.2130 YC 1451.364528 1 0.0001 2626
QuantileBeta(0.05, 0.00787, 2.63314) = 2.106501e-161 2000 rounds
| 2/24
50 h-m-p 0.0005 0.0079 0.8796
QuantileBeta(0.05, 0.00788, 2.63314) = 2.808552e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
C 1451.364477 0 0.0002 2675
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63327) = 2.024071e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63301) = 2.024318e-161 2000 rounds
QuantileBeta(0.05, 0.00787, 2.63314) = 2.024195e-161 2000 rounds
| 2/24
51 h-m-p 0.0001 0.0033 2.2657 YC 1451.364381 1 0.0001 2725 | 2/24
52 h-m-p 0.0004 0.0143 0.7466 Y 1451.364373 0 0.0001 2774 | 2/24
53 h-m-p 0.0160 8.0000 0.0504 ++CC 1451.362228 1 0.3844 2827 | 2/24
54 h-m-p 0.0021 0.0106 8.3685 --C 1451.362179 0 0.0001 2878 | 2/24
55 h-m-p 0.0129 2.5934 0.0341 ++YC 1451.361512 1 0.3748 2930 | 2/24
56 h-m-p 0.7703 3.8515 0.0017 C 1451.361304 0 0.8341 2979 | 2/24
57 h-m-p 0.5462 2.7310 0.0009 +
QuantileBeta(0.15, 0.00500, 2.63113) = 9.574026e-161 2000 rounds
C 1451.361207 0 2.0589 3029 | 2/24
58 h-m-p 0.2652 1.3260 0.0004 +
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
+ 1451.361180 m 1.3260 3078
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63140) = 9.572825e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63114) = 9.573995e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63127) = 9.573410e-161 2000 rounds
| 3/24
59 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.63136) = 9.573021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63162) = 9.571853e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
Y 1451.361179 0 1.0147 3127
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.907359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63146) = 9.572578e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63119) = 9.573748e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573163e-161 2000 rounds
| 3/24
60 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573157e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573161e-161 2000 rounds
C 1451.361179 0 0.1000 3176
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.907357e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63146) = 9.572576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63119) = 9.573747e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
| 3/24
61 h-m-p 0.0367 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573160e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573161e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573161e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
Y 1451.361179 0 0.0000 3237
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
Out..
lnL = -1451.361179
3238 lfun, 38856 eigenQcodon, 676742 P(t)
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1463.764729 S = -1412.429963 -43.345754
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 111 patterns 9:16
did 20 / 111 patterns 9:16
did 30 / 111 patterns 9:16
did 40 / 111 patterns 9:17
did 50 / 111 patterns 9:17
did 60 / 111 patterns 9:17
did 70 / 111 patterns 9:17
did 80 / 111 patterns 9:17
did 90 / 111 patterns 9:18
did 100 / 111 patterns 9:18
did 110 / 111 patterns 9:18
did 111 / 111 patterns 9:18
QuantileBeta(0.15, 0.00500, 2.63133) = 9.573162e-161 2000 rounds
Time used: 9:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=248
D_melanogaster_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_sechellia_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_simulans_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_yakuba_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_erecta_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_takahashii_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_biarmipes_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_suzukii_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_eugracilis_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_ficusphila_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_rhopaloa_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
D_elegans_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
**************************************************
D_melanogaster_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_sechellia_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_simulans_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_yakuba_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_erecta_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_takahashii_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_biarmipes_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_suzukii_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_eugracilis_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_ficusphila_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_rhopaloa_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
D_elegans_14-3-3zeta-PG YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
**************************************************
D_melanogaster_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN
D_sechellia_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKN
D_simulans_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT
D_yakuba_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_erecta_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_takahashii_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_biarmipes_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_suzukii_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_eugracilis_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_ficusphila_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_rhopaloa_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
D_elegans_14-3-3zeta-PG LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK
*********************************************:**:.
D_melanogaster_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
D_sechellia_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
D_simulans_14-3-3zeta-PG AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
D_yakuba_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_erecta_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_takahashii_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_biarmipes_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_suzukii_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_eugracilis_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_ficusphila_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_rhopaloa_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
D_elegans_14-3-3zeta-PG AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD
***:****:* ***********************:*** :**:*******
D_melanogaster_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_sechellia_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_simulans_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_yakuba_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_erecta_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN
D_takahashii_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_biarmipes_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_suzukii_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_eugracilis_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_ficusphila_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_rhopaloa_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN
D_elegans_14-3-3zeta-PG DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
**********************************:*** ********
>D_melanogaster_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTTTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGATGACTCGAAAAAT GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCAACACA TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC >D_sechellia_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAT GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA TCTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC >D_simulans_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAGTCAGAACGTTACGATGATATGGCCCAGGCCATGAAGTCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGCGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG AGGTTGCCACAGGAGATGCACGCAACACCGTTGTCGATGACTCGCAAACC GCTTACCAGGATGCATTTGACATTAGCAAGGGTAAAATGCAGCCAACACA TCCCATCCGTTTGGGTCTGGCCCTTAACTTCTCAGTCTTCTACTATGAGA TTTTGAACTCACCAGACAAAGCTTGCCAATTGGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC >D_yakuba_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG ACACCCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC >D_erecta_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAGTCAGAACGTTACGATGACATGGCCCAGGCCATGAAGTCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTGAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCCG ACACTCAAGGCGACGAAGCTGAGCCACAGGAGGGCGGCGACAAC >D_takahashii_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATCGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTATGGACGTCCG ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC >D_biarmipes_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT CTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC >D_suzukii_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATCGAGCAGAAAACCGAGGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG AGGTTGCCACAGGAGACGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG ACACCCAAGGCGACGGCGATGAGCCTCAGGAGGGCGGCGACAAC >D_eugracilis_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAATTGGCCGA GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAACCTACTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCTCTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACTCTCTGGACGTCGG ACACCCAAGGCGATGGCGATGAGCCACAGGAGGGCGGCGACAAC >D_ficusphila_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAGTCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTCTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTGGCCG AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GACGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTCTGGACGTCCG ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC >D_rhopaloa_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAATCCGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTGGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTACTACAGGTATTTAGCCG AGGTTGCCACCGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GATGCGATAGCCGAGCTGGACACACTCAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG ACACCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC >D_elegans_14-3-3zeta-PG ATGTCGACAGTCGATAAGGAAGAGCTGGTCCAGAAGGCTAAACTGGCCGA GCAATCAGAACGCTACGATGACATGGCCCAGGCCATGAAATCCGTCACAG AGACTGGCGTTGAGCTCTCAAATGAGGAAAGAAATCTGCTCTCCGTTGCC TACAAAAATGTGGTCGGTGCCCGCAGGTCATCGTGGCGTGTCATCTCCTC CATTGAGCAGAAAACCGAAGCATCCGCTAGAAAACAGCAGCTCGCCCGTG AGTACAGAGAGCGTGTGGAGAAGGAGCTGAGGGAAATCTGCTACGAAGTT TTGGGACTTCTAGACAAATACCTTATTCCAAAAGCCAGCAATCCCGAGAG CAAGGTGTTCTACCTGAAGATGAAGGGTGATTATTACAGGTATTTAGCCG AGGTTGCCACAGGAGATGCACGCAACACCGTCGTTGAGGACTCGAAAAAA GCCTATCAGGAGGCGTTCGATATTGCAAAAACCAAAATGCAGCCCACACA TCCAATCAGATTAGGTCTTGCACTCAACTTTTCCGTCTTCTATTACGAAA TTATCAATTCACCAGCGAGGGCTTGTCACTTAGCTAAACAGGCGTTCGAT GATGCGATAGCCGAACTGGACACACTCAACGAGGACTCCTACAAGGACTC GACACTCATCATGCAGCTGTTGAGGGACAACCTGACCCTTTGGACGTCCG ACGCCCAAGGCGACGGCGATGAGCCACAGGAGGGCGGCGACAAC
>D_melanogaster_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN >D_sechellia_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKN AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN >D_simulans_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQT AYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN >D_yakuba_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN >D_erecta_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN >D_takahashii_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN >D_biarmipes_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN >D_suzukii_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN >D_eugracilis_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN >D_ficusphila_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN >D_rhopaloa_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEPQEGGDN >D_elegans_14-3-3zeta-PG MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVEDSKK AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEIINSPARACHLAKQAFD DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAQGDGDEPQEGGDN
#NEXUS
[ID: 6322150943]
begin taxa;
dimensions ntax=12;
taxlabels
D_melanogaster_14-3-3zeta-PG
D_sechellia_14-3-3zeta-PG
D_simulans_14-3-3zeta-PG
D_yakuba_14-3-3zeta-PG
D_erecta_14-3-3zeta-PG
D_takahashii_14-3-3zeta-PG
D_biarmipes_14-3-3zeta-PG
D_suzukii_14-3-3zeta-PG
D_eugracilis_14-3-3zeta-PG
D_ficusphila_14-3-3zeta-PG
D_rhopaloa_14-3-3zeta-PG
D_elegans_14-3-3zeta-PG
;
end;
begin trees;
translate
1 D_melanogaster_14-3-3zeta-PG,
2 D_sechellia_14-3-3zeta-PG,
3 D_simulans_14-3-3zeta-PG,
4 D_yakuba_14-3-3zeta-PG,
5 D_erecta_14-3-3zeta-PG,
6 D_takahashii_14-3-3zeta-PG,
7 D_biarmipes_14-3-3zeta-PG,
8 D_suzukii_14-3-3zeta-PG,
9 D_eugracilis_14-3-3zeta-PG,
10 D_ficusphila_14-3-3zeta-PG,
11 D_rhopaloa_14-3-3zeta-PG,
12 D_elegans_14-3-3zeta-PG
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.002858479,3:0.04834164,(2:0.00289667,(4:0.001443066,5:0.003369308,((((6:0.004684008,8:0.004216621)0.721:0.003664389,7:0.004340026)0.986:0.006768925,10:0.007631441,(11:0.007925676,12:0.007963242)0.986:0.005521447)0.945:0.005774821,9:0.01248631)1.000:0.01913844)1.000:0.06865344)0.989:0.006700406);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.002858479,3:0.04834164,(2:0.00289667,(4:0.001443066,5:0.003369308,((((6:0.004684008,8:0.004216621):0.003664389,7:0.004340026):0.006768925,10:0.007631441,(11:0.007925676,12:0.007963242):0.005521447):0.005774821,9:0.01248631):0.01913844):0.06865344):0.006700406);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1544.40 -1562.83
2 -1544.56 -1563.72
--------------------------------------
TOTAL -1544.48 -1563.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.247920 0.001647 0.176359 0.333366 0.244050 1307.41 1310.60 1.000
r(A<->C){all} 0.111095 0.001122 0.050567 0.178397 0.108058 747.82 835.04 1.000
r(A<->G){all} 0.152878 0.001703 0.077245 0.231470 0.148975 860.48 1021.09 1.000
r(A<->T){all} 0.067466 0.001098 0.012128 0.133970 0.062763 572.59 693.46 1.000
r(C<->G){all} 0.061421 0.000641 0.016602 0.111196 0.058105 899.13 1064.58 1.000
r(C<->T){all} 0.558366 0.004760 0.430141 0.696077 0.558382 677.21 764.72 1.000
r(G<->T){all} 0.048773 0.000730 0.003535 0.099599 0.044829 649.11 806.42 1.001
pi(A){all} 0.285953 0.000252 0.253916 0.314870 0.285640 1172.42 1266.40 1.003
pi(C){all} 0.261314 0.000221 0.232901 0.290045 0.260857 1057.87 1220.34 1.000
pi(G){all} 0.258237 0.000240 0.228554 0.287916 0.258559 1103.28 1177.05 1.001
pi(T){all} 0.194496 0.000198 0.166689 0.220516 0.194117 1180.49 1220.57 1.000
alpha{1,2} 0.056370 0.001757 0.000143 0.134510 0.048662 1226.83 1234.60 1.000
alpha{3} 2.077090 0.654349 0.694719 3.637498 1.954483 1378.89 1439.94 1.000
pinvar{all} 0.475676 0.008692 0.280469 0.634387 0.488729 1139.60 1235.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/14-3-3zeta-PG/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 12 ls = 248
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 0 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 2 3 3 4 | Cys TGT 0 0 0 1 1 1
TTC 4 5 4 4 4 4 | TCC 7 7 7 8 8 8 | TAC 10 10 11 10 10 9 | TGC 2 2 2 1 1 1
Leu TTA 1 1 1 3 3 3 | TCA 5 5 5 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 2 2 2 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 1 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 4 4 4 3
CTC 5 5 5 6 6 6 | CCC 2 3 2 2 2 2 | CAC 0 0 0 1 1 1 | CGC 2 2 3 2 2 3
CTA 0 0 0 0 0 1 | CCA 4 3 4 4 4 3 | Gln CAA 2 2 3 1 1 1 | CGA 0 0 0 0 0 0
CTG 11 11 11 10 10 9 | CCG 0 0 0 0 0 0 | CAG 11 11 11 11 11 11 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 3 4 4 4 3 | Thr ACT 2 2 2 2 3 1 | Asn AAT 5 5 4 5 5 5 | Ser AGT 0 0 0 0 0 0
ATC 4 5 4 5 5 6 | ACC 4 4 4 4 3 5 | AAC 6 6 6 5 5 5 | AGC 2 2 3 2 2 2
ATA 1 1 1 1 1 1 | ACA 6 6 6 6 6 6 | Lys AAA 11 11 9 11 11 12 | Arg AGA 3 3 3 4 4 4
Met ATG 6 6 6 6 6 6 | ACG 1 1 1 1 1 1 | AAG 8 8 9 8 8 7 | AGG 4 4 4 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 5 5 6 6 6 4 | Asp GAT 9 8 9 6 6 7 | Gly GGT 3 3 4 3 3 3
GTC 7 7 7 7 7 7 | GCC 12 12 11 11 11 11 | GAC 10 10 11 11 11 11 | GGC 4 4 4 4 4 5
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 4 | Glu GAA 7 7 7 8 8 7 | GGA 2 2 2 2 2 2
GTG 3 3 3 3 3 3 | GCG 3 3 2 4 4 4 | GAG 18 19 17 18 18 18 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 4 4 4 4 3 4 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 8 8 7 8 9 8 | TAC 9 9 9 9 10 9 | TGC 1 1 1 1 1 1
Leu TTA 3 3 3 2 3 3 | TCA 4 4 4 4 3 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 2 3 3 2 2 | TCG 4 4 5 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 4 4 | Pro CCT 0 1 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 7 7 7 7 6 6 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 0 0 1 0 0 1 | CCA 4 3 4 4 4 4 | Gln CAA 1 2 1 1 2 2 | CGA 0 0 0 0 0 0
CTG 10 9 7 9 9 8 | CCG 0 0 0 0 0 0 | CAG 11 10 11 11 10 10 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 4 4 4 4 | Thr ACT 1 1 2 1 1 1 | Asn AAT 5 5 4 5 5 5 | Ser AGT 0 0 0 0 0 0
ATC 6 6 5 5 5 5 | ACC 5 5 4 5 6 4 | AAC 5 5 6 5 5 5 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 6 6 6 6 5 6 | Lys AAA 12 12 12 12 12 12 | Arg AGA 4 4 4 4 4 4
Met ATG 6 6 6 6 6 6 | ACG 1 1 1 1 1 1 | AAG 7 7 7 7 7 7 | AGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 4 4 5 4 4 4 | Asp GAT 7 7 9 7 8 8 | Gly GGT 3 3 3 3 3 3
GTC 7 7 7 8 7 7 | GCC 11 11 11 11 11 12 | GAC 11 11 9 11 10 10 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 4 4 3 4 4 4 | Glu GAA 6 6 7 7 7 8 | GGA 2 2 2 2 2 2
GTG 3 3 3 2 3 3 | GCG 4 4 4 4 4 4 | GAG 19 19 18 18 18 17 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_14-3-3zeta-PG
position 1: T:0.17742 C:0.18548 A:0.27016 G:0.36694
position 2: T:0.24194 C:0.23387 A:0.40726 G:0.11694
position 3: T:0.18548 C:0.32661 A:0.18145 G:0.30645
Average T:0.20161 C:0.24866 A:0.28629 G:0.26344
#2: D_sechellia_14-3-3zeta-PG
position 1: T:0.17742 C:0.18548 A:0.27016 G:0.36694
position 2: T:0.24194 C:0.23387 A:0.40726 G:0.11694
position 3: T:0.17339 C:0.33871 A:0.17742 G:0.31048
Average T:0.19758 C:0.25269 A:0.28495 G:0.26478
#3: D_simulans_14-3-3zeta-PG
position 1: T:0.17742 C:0.18952 A:0.26613 G:0.36694
position 2: T:0.24194 C:0.22984 A:0.40323 G:0.12500
position 3: T:0.18145 C:0.33871 A:0.17742 G:0.30242
Average T:0.20027 C:0.25269 A:0.28226 G:0.26478
#4: D_yakuba_14-3-3zeta-PG
position 1: T:0.17339 C:0.18145 A:0.27823 G:0.36694
position 2: T:0.24194 C:0.23790 A:0.39919 G:0.12097
position 3: T:0.17742 C:0.33468 A:0.18952 G:0.29839
Average T:0.19758 C:0.25134 A:0.28898 G:0.26210
#5: D_erecta_14-3-3zeta-PG
position 1: T:0.17339 C:0.18145 A:0.27823 G:0.36694
position 2: T:0.24194 C:0.23790 A:0.39919 G:0.12097
position 3: T:0.18145 C:0.33065 A:0.18952 G:0.29839
Average T:0.19892 C:0.25000 A:0.28898 G:0.26210
#6: D_takahashii_14-3-3zeta-PG
position 1: T:0.17339 C:0.18145 A:0.27823 G:0.36694
position 2: T:0.24194 C:0.23387 A:0.39919 G:0.12500
position 3: T:0.16935 C:0.34677 A:0.19355 G:0.29032
Average T:0.19489 C:0.25403 A:0.29032 G:0.26075
#7: D_biarmipes_14-3-3zeta-PG
position 1: T:0.16935 C:0.18548 A:0.27823 G:0.36694
position 2: T:0.24194 C:0.23387 A:0.39919 G:0.12500
position 3: T:0.16532 C:0.35081 A:0.18952 G:0.29435
Average T:0.19220 C:0.25672 A:0.28898 G:0.26210
#8: D_suzukii_14-3-3zeta-PG
position 1: T:0.17339 C:0.18145 A:0.27823 G:0.36694
position 2: T:0.24194 C:0.23387 A:0.39919 G:0.12500
position 3: T:0.16935 C:0.35081 A:0.18952 G:0.29032
Average T:0.19489 C:0.25538 A:0.28898 G:0.26075
#9: D_eugracilis_14-3-3zeta-PG
position 1: T:0.17742 C:0.17742 A:0.27823 G:0.36694
position 2: T:0.24194 C:0.23387 A:0.39919 G:0.12500
position 3: T:0.18145 C:0.33468 A:0.19355 G:0.29032
Average T:0.20027 C:0.24866 A:0.29032 G:0.26075
#10: D_ficusphila_14-3-3zeta-PG
position 1: T:0.17339 C:0.18145 A:0.27823 G:0.36694
position 2: T:0.24194 C:0.23387 A:0.39919 G:0.12500
position 3: T:0.16935 C:0.35081 A:0.18952 G:0.29032
Average T:0.19489 C:0.25538 A:0.28898 G:0.26075
#11: D_rhopaloa_14-3-3zeta-PG
position 1: T:0.17339 C:0.18145 A:0.27823 G:0.36694
position 2: T:0.24194 C:0.23387 A:0.39919 G:0.12500
position 3: T:0.17339 C:0.35081 A:0.18952 G:0.28629
Average T:0.19624 C:0.25538 A:0.28898 G:0.25941
#12: D_elegans_14-3-3zeta-PG
position 1: T:0.17339 C:0.18145 A:0.27419 G:0.37097
position 2: T:0.24194 C:0.23387 A:0.39919 G:0.12500
position 3: T:0.17742 C:0.33871 A:0.20565 G:0.27823
Average T:0.19758 C:0.25134 A:0.29301 G:0.25806
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 11 | Ser S TCT 0 | Tyr Y TAT 41 | Cys C TGT 9
TTC 49 | TCC 93 | TAC 115 | TGC 15
Leu L TTA 29 | TCA 50 | *** * TAA 0 | *** * TGA 0
TTG 34 | TCG 49 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 38 | Pro P CCT 2 | His H CAT 12 | Arg R CGT 43
CTC 73 | CCC 25 | CAC 9 | CGC 32
CTA 3 | CCA 45 | Gln Q CAA 19 | CGA 0
CTG 114 | CCG 0 | CAG 129 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 44 | Thr T ACT 19 | Asn N AAT 58 | Ser S AGT 0
ATC 61 | ACC 53 | AAC 64 | AGC 25
ATA 12 | ACA 71 | Lys K AAA 137 | Arg R AGA 45
Met M ATG 72 | ACG 12 | AAG 90 | AGG 57
------------------------------------------------------------------------------
Val V GTT 60 | Ala A GCT 57 | Asp D GAT 91 | Gly G GGT 37
GTC 85 | GCC 135 | GAC 126 | GGC 55
GTA 0 | GCA 42 | Glu E GAA 85 | GGA 24
GTG 35 | GCG 44 | GAG 217 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17440 C:0.18280 A:0.27554 G:0.36727
position 2: T:0.24194 C:0.23421 A:0.40087 G:0.12298
position 3: T:0.17540 C:0.34106 A:0.18884 G:0.29469
Average T:0.19724 C:0.25269 A:0.28842 G:0.26165
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_14-3-3zeta-PG
D_sechellia_14-3-3zeta-PG 0.0991 (0.0017 0.0177)
D_simulans_14-3-3zeta-PG 0.1666 (0.0129 0.0776) 0.1750 (0.0147 0.0841)
D_yakuba_14-3-3zeta-PG 0.1221 (0.0150 0.1229) 0.1140 (0.0132 0.1160) 0.1393 (0.0273 0.1960)
D_erecta_14-3-3zeta-PG 0.1157 (0.0150 0.1298) 0.1077 (0.0132 0.1229) 0.1341 (0.0273 0.2036)-1.0000 (0.0000 0.0058)
D_takahashii_14-3-3zeta-PG 0.1061 (0.0195 0.1835) 0.1005 (0.0177 0.1761) 0.1210 (0.0318 0.2632) 0.0765 (0.0044 0.0573) 0.0689 (0.0044 0.0636)
D_biarmipes_14-3-3zeta-PG 0.1063 (0.0195 0.1834) 0.1006 (0.0177 0.1759) 0.1211 (0.0318 0.2629) 0.0766 (0.0044 0.0573) 0.0690 (0.0044 0.0636)-1.0000 (0.0000 0.0236)
D_suzukii_14-3-3zeta-PG 0.1018 (0.0195 0.1912) 0.0963 (0.0177 0.1837) 0.1171 (0.0318 0.2718) 0.0688 (0.0044 0.0637) 0.0626 (0.0044 0.0700)-1.0000 (0.0000 0.0177)-1.0000 (0.0000 0.0176)
D_eugracilis_14-3-3zeta-PG 0.1058 (0.0195 0.1841) 0.1001 (0.0177 0.1766) 0.1205 (0.0318 0.2640) 0.0687 (0.0044 0.0638) 0.0625 (0.0044 0.0702)-1.0000 (0.0000 0.0670)-1.0000 (0.0000 0.0669)-1.0000 (0.0000 0.0735)
D_ficusphila_14-3-3zeta-PG 0.1104 (0.0195 0.1764) 0.1046 (0.0177 0.1690) 0.1246 (0.0318 0.2554) 0.0688 (0.0044 0.0637) 0.0626 (0.0044 0.0701)-1.0000 (0.0000 0.0419)-1.0000 (0.0000 0.0418)-1.0000 (0.0000 0.0481)-1.0000 (0.0000 0.0607)
D_rhopaloa_14-3-3zeta-PG 0.1104 (0.0195 0.1764) 0.1046 (0.0177 0.1691) 0.1246 (0.0318 0.2554) 0.0688 (0.0044 0.0637) 0.0625 (0.0044 0.0701)-1.0000 (0.0000 0.0481)-1.0000 (0.0000 0.0542)-1.0000 (0.0000 0.0481)-1.0000 (0.0000 0.0735)-1.0000 (0.0000 0.0481)
D_elegans_14-3-3zeta-PG 0.1158 (0.0213 0.1837) 0.1105 (0.0195 0.1763) 0.1277 (0.0337 0.2635) 0.0877 (0.0061 0.0700) 0.0804 (0.0061 0.0764) 0.0418 (0.0018 0.0419) 0.0365 (0.0018 0.0480) 0.0418 (0.0017 0.0419) 0.0261 (0.0017 0.0670) 0.0417 (0.0017 0.0419) 0.0589 (0.0017 0.0297)
Model 0: one-ratio
TREE # 1: (1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
check convergence..
lnL(ntime: 19 np: 21): -1458.923820 +0.000000
13..1 13..3 13..14 14..2 14..15 15..4 15..5 15..16 16..17 17..18 18..19 19..6 19..8 18..7 17..10 17..20 20..11 20..12 16..9
0.003796 0.081749 0.008798 0.003815 0.110305 0.000004 0.004091 0.033682 0.008255 0.010465 0.004172 0.006369 0.005988 0.006004 0.012383 0.008246 0.012452 0.012318 0.020757 1.860255 0.078694
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35365
(1: 0.003796, 3: 0.081749, (2: 0.003815, (4: 0.000004, 5: 0.004091, ((((6: 0.006369, 8: 0.005988): 0.004172, 7: 0.006004): 0.010465, 10: 0.012383, (11: 0.012452, 12: 0.012318): 0.008246): 0.008255, 9: 0.020757): 0.033682): 0.110305): 0.008798);
(D_melanogaster_14-3-3zeta-PG: 0.003796, D_simulans_14-3-3zeta-PG: 0.081749, (D_sechellia_14-3-3zeta-PG: 0.003815, (D_yakuba_14-3-3zeta-PG: 0.000004, D_erecta_14-3-3zeta-PG: 0.004091, ((((D_takahashii_14-3-3zeta-PG: 0.006369, D_suzukii_14-3-3zeta-PG: 0.005988): 0.004172, D_biarmipes_14-3-3zeta-PG: 0.006004): 0.010465, D_ficusphila_14-3-3zeta-PG: 0.012383, (D_rhopaloa_14-3-3zeta-PG: 0.012452, D_elegans_14-3-3zeta-PG: 0.012318): 0.008246): 0.008255, D_eugracilis_14-3-3zeta-PG: 0.020757): 0.033682): 0.110305): 0.008798);
Detailed output identifying parameters
kappa (ts/tv) = 1.86025
omega (dN/dS) = 0.07869
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 567.8 176.2 0.0787 0.0003 0.0043 0.2 0.8
13..3 0.082 567.8 176.2 0.0787 0.0072 0.0918 4.1 16.2
13..14 0.009 567.8 176.2 0.0787 0.0008 0.0099 0.4 1.7
14..2 0.004 567.8 176.2 0.0787 0.0003 0.0043 0.2 0.8
14..15 0.110 567.8 176.2 0.0787 0.0097 0.1239 5.5 21.8
15..4 0.000 567.8 176.2 0.0787 0.0000 0.0000 0.0 0.0
15..5 0.004 567.8 176.2 0.0787 0.0004 0.0046 0.2 0.8
15..16 0.034 567.8 176.2 0.0787 0.0030 0.0378 1.7 6.7
16..17 0.008 567.8 176.2 0.0787 0.0007 0.0093 0.4 1.6
17..18 0.010 567.8 176.2 0.0787 0.0009 0.0118 0.5 2.1
18..19 0.004 567.8 176.2 0.0787 0.0004 0.0047 0.2 0.8
19..6 0.006 567.8 176.2 0.0787 0.0006 0.0072 0.3 1.3
19..8 0.006 567.8 176.2 0.0787 0.0005 0.0067 0.3 1.2
18..7 0.006 567.8 176.2 0.0787 0.0005 0.0067 0.3 1.2
17..10 0.012 567.8 176.2 0.0787 0.0011 0.0139 0.6 2.4
17..20 0.008 567.8 176.2 0.0787 0.0007 0.0093 0.4 1.6
20..11 0.012 567.8 176.2 0.0787 0.0011 0.0140 0.6 2.5
20..12 0.012 567.8 176.2 0.0787 0.0011 0.0138 0.6 2.4
16..9 0.021 567.8 176.2 0.0787 0.0018 0.0233 1.0 4.1
tree length for dN: 0.0313
tree length for dS: 0.3971
Time used: 0:13
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
lnL(ntime: 19 np: 22): -1451.361180 +0.000000
13..1 13..3 13..14 14..2 14..15 15..4 15..5 15..16 16..17 17..18 18..19 19..6 19..8 18..7 17..10 17..20 20..11 20..12 16..9
0.003895 0.084115 0.008612 0.003995 0.111595 0.000004 0.004094 0.033576 0.008214 0.010396 0.004141 0.006325 0.005944 0.005961 0.012299 0.008205 0.012382 0.012209 0.020634 1.928818 0.904085 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35660
(1: 0.003895, 3: 0.084115, (2: 0.003995, (4: 0.000004, 5: 0.004094, ((((6: 0.006325, 8: 0.005944): 0.004141, 7: 0.005961): 0.010396, 10: 0.012299, (11: 0.012382, 12: 0.012209): 0.008205): 0.008214, 9: 0.020634): 0.033576): 0.111595): 0.008612);
(D_melanogaster_14-3-3zeta-PG: 0.003895, D_simulans_14-3-3zeta-PG: 0.084115, (D_sechellia_14-3-3zeta-PG: 0.003995, (D_yakuba_14-3-3zeta-PG: 0.000004, D_erecta_14-3-3zeta-PG: 0.004094, ((((D_takahashii_14-3-3zeta-PG: 0.006325, D_suzukii_14-3-3zeta-PG: 0.005944): 0.004141, D_biarmipes_14-3-3zeta-PG: 0.005961): 0.010396, D_ficusphila_14-3-3zeta-PG: 0.012299, (D_rhopaloa_14-3-3zeta-PG: 0.012382, D_elegans_14-3-3zeta-PG: 0.012209): 0.008205): 0.008214, D_eugracilis_14-3-3zeta-PG: 0.020634): 0.033576): 0.111595): 0.008612);
Detailed output identifying parameters
kappa (ts/tv) = 1.92882
dN/dS (w) for site classes (K=2)
p: 0.90409 0.09591
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 566.5 177.5 0.0959 0.0004 0.0042 0.2 0.7
13..3 0.084 566.5 177.5 0.0959 0.0086 0.0900 4.9 16.0
13..14 0.009 566.5 177.5 0.0959 0.0009 0.0092 0.5 1.6
14..2 0.004 566.5 177.5 0.0959 0.0004 0.0043 0.2 0.8
14..15 0.112 566.5 177.5 0.0959 0.0115 0.1194 6.5 21.2
15..4 0.000 566.5 177.5 0.0959 0.0000 0.0000 0.0 0.0
15..5 0.004 566.5 177.5 0.0959 0.0004 0.0044 0.2 0.8
15..16 0.034 566.5 177.5 0.0959 0.0034 0.0359 2.0 6.4
16..17 0.008 566.5 177.5 0.0959 0.0008 0.0088 0.5 1.6
17..18 0.010 566.5 177.5 0.0959 0.0011 0.0111 0.6 2.0
18..19 0.004 566.5 177.5 0.0959 0.0004 0.0044 0.2 0.8
19..6 0.006 566.5 177.5 0.0959 0.0006 0.0068 0.4 1.2
19..8 0.006 566.5 177.5 0.0959 0.0006 0.0064 0.3 1.1
18..7 0.006 566.5 177.5 0.0959 0.0006 0.0064 0.3 1.1
17..10 0.012 566.5 177.5 0.0959 0.0013 0.0132 0.7 2.3
17..20 0.008 566.5 177.5 0.0959 0.0008 0.0088 0.5 1.6
20..11 0.012 566.5 177.5 0.0959 0.0013 0.0132 0.7 2.4
20..12 0.012 566.5 177.5 0.0959 0.0013 0.0131 0.7 2.3
16..9 0.021 566.5 177.5 0.0959 0.0021 0.0221 1.2 3.9
Time used: 0:39
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
lnL(ntime: 19 np: 24): -1451.361180 +0.000000
13..1 13..3 13..14 14..2 14..15 15..4 15..5 15..16 16..17 17..18 18..19 19..6 19..8 18..7 17..10 17..20 20..11 20..12 16..9
0.003895 0.084115 0.008612 0.003995 0.111595 0.000004 0.004094 0.033576 0.008214 0.010396 0.004141 0.006325 0.005945 0.005961 0.012299 0.008205 0.012382 0.012209 0.020634 1.928818 0.904086 0.027990 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35660
(1: 0.003895, 3: 0.084115, (2: 0.003995, (4: 0.000004, 5: 0.004094, ((((6: 0.006325, 8: 0.005945): 0.004141, 7: 0.005961): 0.010396, 10: 0.012299, (11: 0.012382, 12: 0.012209): 0.008205): 0.008214, 9: 0.020634): 0.033576): 0.111595): 0.008612);
(D_melanogaster_14-3-3zeta-PG: 0.003895, D_simulans_14-3-3zeta-PG: 0.084115, (D_sechellia_14-3-3zeta-PG: 0.003995, (D_yakuba_14-3-3zeta-PG: 0.000004, D_erecta_14-3-3zeta-PG: 0.004094, ((((D_takahashii_14-3-3zeta-PG: 0.006325, D_suzukii_14-3-3zeta-PG: 0.005945): 0.004141, D_biarmipes_14-3-3zeta-PG: 0.005961): 0.010396, D_ficusphila_14-3-3zeta-PG: 0.012299, (D_rhopaloa_14-3-3zeta-PG: 0.012382, D_elegans_14-3-3zeta-PG: 0.012209): 0.008205): 0.008214, D_eugracilis_14-3-3zeta-PG: 0.020634): 0.033576): 0.111595): 0.008612);
Detailed output identifying parameters
kappa (ts/tv) = 1.92882
dN/dS (w) for site classes (K=3)
p: 0.90409 0.02799 0.06792
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 566.5 177.5 0.0959 0.0004 0.0042 0.2 0.7
13..3 0.084 566.5 177.5 0.0959 0.0086 0.0900 4.9 16.0
13..14 0.009 566.5 177.5 0.0959 0.0009 0.0092 0.5 1.6
14..2 0.004 566.5 177.5 0.0959 0.0004 0.0043 0.2 0.8
14..15 0.112 566.5 177.5 0.0959 0.0115 0.1194 6.5 21.2
15..4 0.000 566.5 177.5 0.0959 0.0000 0.0000 0.0 0.0
15..5 0.004 566.5 177.5 0.0959 0.0004 0.0044 0.2 0.8
15..16 0.034 566.5 177.5 0.0959 0.0034 0.0359 2.0 6.4
16..17 0.008 566.5 177.5 0.0959 0.0008 0.0088 0.5 1.6
17..18 0.010 566.5 177.5 0.0959 0.0011 0.0111 0.6 2.0
18..19 0.004 566.5 177.5 0.0959 0.0004 0.0044 0.2 0.8
19..6 0.006 566.5 177.5 0.0959 0.0006 0.0068 0.4 1.2
19..8 0.006 566.5 177.5 0.0959 0.0006 0.0064 0.3 1.1
18..7 0.006 566.5 177.5 0.0959 0.0006 0.0064 0.3 1.1
17..10 0.012 566.5 177.5 0.0959 0.0013 0.0132 0.7 2.3
17..20 0.008 566.5 177.5 0.0959 0.0008 0.0088 0.5 1.6
20..11 0.012 566.5 177.5 0.0959 0.0013 0.0132 0.7 2.4
20..12 0.012 566.5 177.5 0.0959 0.0013 0.0131 0.7 2.3
16..9 0.021 566.5 177.5 0.0959 0.0021 0.0221 1.2 3.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PG)
Pr(w>1) post mean +- SE for w
150 N 0.578 1.622 +- 0.998
159 A 0.693 1.871 +- 1.149
161 T 0.586 1.636 +- 0.997
185 L 0.573 1.602 +- 0.983
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.573 0.272 0.096 0.034 0.013 0.006 0.003 0.002 0.001 0.001
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008 0.990
sum of density on p0-p1 = 1.000000
Time used: 1:29
Model 3: discrete (3 categories)
TREE # 1: (1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
lnL(ntime: 19 np: 25): -1451.332921 +0.000000
13..1 13..3 13..14 14..2 14..15 15..4 15..5 15..16 16..17 17..18 18..19 19..6 19..8 18..7 17..10 17..20 20..11 20..12 16..9
0.003886 0.083926 0.008635 0.003978 0.111508 0.000004 0.004096 0.033607 0.008221 0.010408 0.004146 0.006333 0.005952 0.005968 0.012314 0.008213 0.012395 0.012226 0.020657 1.906611 0.898489 0.079889 0.000001 0.899766 0.899773
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35647
(1: 0.003886, 3: 0.083926, (2: 0.003978, (4: 0.000004, 5: 0.004096, ((((6: 0.006333, 8: 0.005952): 0.004146, 7: 0.005968): 0.010408, 10: 0.012314, (11: 0.012395, 12: 0.012226): 0.008213): 0.008221, 9: 0.020657): 0.033607): 0.111508): 0.008635);
(D_melanogaster_14-3-3zeta-PG: 0.003886, D_simulans_14-3-3zeta-PG: 0.083926, (D_sechellia_14-3-3zeta-PG: 0.003978, (D_yakuba_14-3-3zeta-PG: 0.000004, D_erecta_14-3-3zeta-PG: 0.004096, ((((D_takahashii_14-3-3zeta-PG: 0.006333, D_suzukii_14-3-3zeta-PG: 0.005952): 0.004146, D_biarmipes_14-3-3zeta-PG: 0.005968): 0.010408, D_ficusphila_14-3-3zeta-PG: 0.012314, (D_rhopaloa_14-3-3zeta-PG: 0.012395, D_elegans_14-3-3zeta-PG: 0.012226): 0.008213): 0.008221, D_eugracilis_14-3-3zeta-PG: 0.020657): 0.033607): 0.111508): 0.008635);
Detailed output identifying parameters
kappa (ts/tv) = 1.90661
dN/dS (w) for site classes (K=3)
p: 0.89849 0.07989 0.02162
w: 0.00000 0.89977 0.89977
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 566.9 177.1 0.0913 0.0004 0.0042 0.2 0.7
13..3 0.084 566.9 177.1 0.0913 0.0083 0.0910 4.7 16.1
13..14 0.009 566.9 177.1 0.0913 0.0009 0.0094 0.5 1.7
14..2 0.004 566.9 177.1 0.0913 0.0004 0.0043 0.2 0.8
14..15 0.112 566.9 177.1 0.0913 0.0110 0.1208 6.3 21.4
15..4 0.000 566.9 177.1 0.0913 0.0000 0.0000 0.0 0.0
15..5 0.004 566.9 177.1 0.0913 0.0004 0.0044 0.2 0.8
15..16 0.034 566.9 177.1 0.0913 0.0033 0.0364 1.9 6.4
16..17 0.008 566.9 177.1 0.0913 0.0008 0.0089 0.5 1.6
17..18 0.010 566.9 177.1 0.0913 0.0010 0.0113 0.6 2.0
18..19 0.004 566.9 177.1 0.0913 0.0004 0.0045 0.2 0.8
19..6 0.006 566.9 177.1 0.0913 0.0006 0.0069 0.4 1.2
19..8 0.006 566.9 177.1 0.0913 0.0006 0.0065 0.3 1.1
18..7 0.006 566.9 177.1 0.0913 0.0006 0.0065 0.3 1.1
17..10 0.012 566.9 177.1 0.0913 0.0012 0.0133 0.7 2.4
17..20 0.008 566.9 177.1 0.0913 0.0008 0.0089 0.5 1.6
20..11 0.012 566.9 177.1 0.0913 0.0012 0.0134 0.7 2.4
20..12 0.012 566.9 177.1 0.0913 0.0012 0.0132 0.7 2.3
16..9 0.021 566.9 177.1 0.0913 0.0020 0.0224 1.2 4.0
Naive Empirical Bayes (NEB) analysis
Time used: 2:23
Model 7: beta (10 categories)
TREE # 1: (1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
check convergence..
lnL(ntime: 19 np: 22): -1451.333746 +0.000000
13..1 13..3 13..14 14..2 14..15 15..4 15..5 15..16 16..17 17..18 18..19 19..6 19..8 18..7 17..10 17..20 20..11 20..12 16..9
0.003883 0.083874 0.008624 0.003976 0.111422 0.000004 0.004092 0.033574 0.008212 0.010397 0.004141 0.006326 0.005946 0.005962 0.012300 0.008204 0.012382 0.012213 0.020635 1.906728 0.009146 0.127141
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35617
(1: 0.003883, 3: 0.083874, (2: 0.003976, (4: 0.000004, 5: 0.004092, ((((6: 0.006326, 8: 0.005946): 0.004141, 7: 0.005962): 0.010397, 10: 0.012300, (11: 0.012382, 12: 0.012213): 0.008204): 0.008212, 9: 0.020635): 0.033574): 0.111422): 0.008624);
(D_melanogaster_14-3-3zeta-PG: 0.003883, D_simulans_14-3-3zeta-PG: 0.083874, (D_sechellia_14-3-3zeta-PG: 0.003976, (D_yakuba_14-3-3zeta-PG: 0.000004, D_erecta_14-3-3zeta-PG: 0.004092, ((((D_takahashii_14-3-3zeta-PG: 0.006326, D_suzukii_14-3-3zeta-PG: 0.005946): 0.004141, D_biarmipes_14-3-3zeta-PG: 0.005962): 0.010397, D_ficusphila_14-3-3zeta-PG: 0.012300, (D_rhopaloa_14-3-3zeta-PG: 0.012382, D_elegans_14-3-3zeta-PG: 0.012213): 0.008204): 0.008212, D_eugracilis_14-3-3zeta-PG: 0.020635): 0.033574): 0.111422): 0.008624);
Detailed output identifying parameters
kappa (ts/tv) = 1.90673
Parameters in M7 (beta):
p = 0.00915 q = 0.12714
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.91027
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 566.9 177.1 0.0910 0.0004 0.0042 0.2 0.7
13..3 0.084 566.9 177.1 0.0910 0.0083 0.0910 4.7 16.1
13..14 0.009 566.9 177.1 0.0910 0.0009 0.0094 0.5 1.7
14..2 0.004 566.9 177.1 0.0910 0.0004 0.0043 0.2 0.8
14..15 0.111 566.9 177.1 0.0910 0.0110 0.1208 6.2 21.4
15..4 0.000 566.9 177.1 0.0910 0.0000 0.0000 0.0 0.0
15..5 0.004 566.9 177.1 0.0910 0.0004 0.0044 0.2 0.8
15..16 0.034 566.9 177.1 0.0910 0.0033 0.0364 1.9 6.4
16..17 0.008 566.9 177.1 0.0910 0.0008 0.0089 0.5 1.6
17..18 0.010 566.9 177.1 0.0910 0.0010 0.0113 0.6 2.0
18..19 0.004 566.9 177.1 0.0910 0.0004 0.0045 0.2 0.8
19..6 0.006 566.9 177.1 0.0910 0.0006 0.0069 0.4 1.2
19..8 0.006 566.9 177.1 0.0910 0.0006 0.0064 0.3 1.1
18..7 0.006 566.9 177.1 0.0910 0.0006 0.0065 0.3 1.1
17..10 0.012 566.9 177.1 0.0910 0.0012 0.0133 0.7 2.4
17..20 0.008 566.9 177.1 0.0910 0.0008 0.0089 0.5 1.6
20..11 0.012 566.9 177.1 0.0910 0.0012 0.0134 0.7 2.4
20..12 0.012 566.9 177.1 0.0910 0.0012 0.0132 0.7 2.3
16..9 0.021 566.9 177.1 0.0910 0.0020 0.0224 1.2 4.0
Time used: 5:43
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 3, (2, (4, 5, ((((6, 8), 7), 10, (11, 12)), 9)))); MP score: 73
lnL(ntime: 19 np: 24): -1451.361179 +0.000000
13..1 13..3 13..14 14..2 14..15 15..4 15..5 15..16 16..17 17..18 18..19 19..6 19..8 18..7 17..10 17..20 20..11 20..12 16..9
0.003895 0.084115 0.008612 0.003995 0.111595 0.000004 0.004094 0.033576 0.008214 0.010396 0.004141 0.006325 0.005944 0.005961 0.012299 0.008205 0.012382 0.012210 0.020634 1.928819 0.904085 0.005000 2.631327 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.35660
(1: 0.003895, 3: 0.084115, (2: 0.003995, (4: 0.000004, 5: 0.004094, ((((6: 0.006325, 8: 0.005944): 0.004141, 7: 0.005961): 0.010396, 10: 0.012299, (11: 0.012382, 12: 0.012210): 0.008205): 0.008214, 9: 0.020634): 0.033576): 0.111595): 0.008612);
(D_melanogaster_14-3-3zeta-PG: 0.003895, D_simulans_14-3-3zeta-PG: 0.084115, (D_sechellia_14-3-3zeta-PG: 0.003995, (D_yakuba_14-3-3zeta-PG: 0.000004, D_erecta_14-3-3zeta-PG: 0.004094, ((((D_takahashii_14-3-3zeta-PG: 0.006325, D_suzukii_14-3-3zeta-PG: 0.005944): 0.004141, D_biarmipes_14-3-3zeta-PG: 0.005961): 0.010396, D_ficusphila_14-3-3zeta-PG: 0.012299, (D_rhopaloa_14-3-3zeta-PG: 0.012382, D_elegans_14-3-3zeta-PG: 0.012210): 0.008205): 0.008214, D_eugracilis_14-3-3zeta-PG: 0.020634): 0.033576): 0.111595): 0.008612);
Detailed output identifying parameters
kappa (ts/tv) = 1.92882
Parameters in M8 (beta&w>1):
p0 = 0.90409 p = 0.00500 q = 2.63133
(p1 = 0.09591) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09041 0.09041 0.09041 0.09041 0.09041 0.09041 0.09041 0.09041 0.09041 0.09041 0.09591
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
13..1 0.004 566.5 177.5 0.0959 0.0004 0.0042 0.2 0.7
13..3 0.084 566.5 177.5 0.0959 0.0086 0.0900 4.9 16.0
13..14 0.009 566.5 177.5 0.0959 0.0009 0.0092 0.5 1.6
14..2 0.004 566.5 177.5 0.0959 0.0004 0.0043 0.2 0.8
14..15 0.112 566.5 177.5 0.0959 0.0115 0.1194 6.5 21.2
15..4 0.000 566.5 177.5 0.0959 0.0000 0.0000 0.0 0.0
15..5 0.004 566.5 177.5 0.0959 0.0004 0.0044 0.2 0.8
15..16 0.034 566.5 177.5 0.0959 0.0034 0.0359 2.0 6.4
16..17 0.008 566.5 177.5 0.0959 0.0008 0.0088 0.5 1.6
17..18 0.010 566.5 177.5 0.0959 0.0011 0.0111 0.6 2.0
18..19 0.004 566.5 177.5 0.0959 0.0004 0.0044 0.2 0.8
19..6 0.006 566.5 177.5 0.0959 0.0006 0.0068 0.4 1.2
19..8 0.006 566.5 177.5 0.0959 0.0006 0.0064 0.3 1.1
18..7 0.006 566.5 177.5 0.0959 0.0006 0.0064 0.3 1.1
17..10 0.012 566.5 177.5 0.0959 0.0013 0.0132 0.7 2.3
17..20 0.008 566.5 177.5 0.0959 0.0008 0.0088 0.5 1.6
20..11 0.012 566.5 177.5 0.0959 0.0013 0.0132 0.7 2.4
20..12 0.012 566.5 177.5 0.0959 0.0013 0.0131 0.7 2.3
16..9 0.021 566.5 177.5 0.0959 0.0021 0.0221 1.2 3.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_14-3-3zeta-PG)
Pr(w>1) post mean +- SE for w
150 N 0.684 1.417 +- 0.866
159 A 0.788 1.593 +- 0.870
161 T 0.695 1.435 +- 0.863
185 L 0.682 1.410 +- 0.864
239 E 0.522 1.118 +- 0.885
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.001 0.011 0.039 0.094 0.175 0.279 0.401
ws: 0.741 0.197 0.045 0.011 0.003 0.001 0.000 0.000 0.000 0.000
Time used: 9:18
Model 1: NearlyNeutral -1451.36118 Model 2: PositiveSelection -1451.36118 Model 0: one-ratio -1458.92382 Model 3: discrete -1451.332921 Model 7: beta -1451.333746 Model 8: beta&w>1 -1451.361179 Model 0 vs 1 15.125279999999748 Model 2 vs 1 0.0 Model 8 vs 7 0.054865999999947235
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
