--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Nov 25 12:55:20 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/1/128up-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2413.83 -2426.99 2 -2414.07 -2424.97 -------------------------------------- TOTAL -2413.94 -2426.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.556558 0.006634 0.406277 0.719295 0.548050 1258.52 1293.27 1.000 r(A<->C){all} 0.061721 0.000568 0.019533 0.110070 0.059674 1049.15 1060.80 1.000 r(A<->G){all} 0.304211 0.003060 0.196530 0.407952 0.300783 754.02 768.11 1.001 r(A<->T){all} 0.119967 0.001740 0.044598 0.202388 0.116152 583.49 722.17 1.000 r(C<->G){all} 0.042319 0.000240 0.011324 0.071546 0.041246 972.06 1001.90 1.000 r(C<->T){all} 0.407791 0.003086 0.304153 0.521389 0.406057 803.92 887.04 1.002 r(G<->T){all} 0.063992 0.000557 0.020788 0.109547 0.061420 1023.83 1048.07 1.001 pi(A){all} 0.240638 0.000161 0.214939 0.264442 0.240394 1434.12 1449.86 1.000 pi(C){all} 0.272588 0.000169 0.245651 0.295977 0.272551 1293.71 1316.92 1.000 pi(G){all} 0.279551 0.000174 0.251590 0.303451 0.279558 1208.59 1232.19 1.000 pi(T){all} 0.207223 0.000133 0.184975 0.229367 0.207113 1170.67 1181.94 1.000 alpha{1,2} 0.033798 0.000457 0.000229 0.071049 0.031841 1399.63 1410.21 1.000 alpha{3} 3.286184 0.908698 1.588927 5.169913 3.155399 1501.00 1501.00 1.000 pinvar{all} 0.590164 0.001292 0.512907 0.653991 0.591793 1382.59 1441.79 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2216.479301 Model 2: PositiveSelection -2216.479301 Model 0: one-ratio -2218.445959 Model 3: discrete -2215.939341 Model 7: beta -2216.368583 Model 8: beta&w>1 -2216.314827 Model 0 vs 1 3.933316000000559 Model 2 vs 1 0.0 Model 8 vs 7 0.10751199999958772
>C1 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C2 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >C3 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >C4 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C5 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C6 MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=368 C1 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG C2 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG C3 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG C4 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG C5 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG C6 MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG ********:***************************************** C1 GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT C2 GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT C3 GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT C4 GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT C5 GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT C6 GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT ************************************************** C1 TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD C2 TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD C3 TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD C4 TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD C5 TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD C6 TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD ************************************************** C1 CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL C2 CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL C3 CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL C4 CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL C5 CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL C6 CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL ******************************************.******* C1 DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI C2 DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI C3 DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI C4 DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI C5 DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI C6 DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI *:************************************************ C1 DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG C2 DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG C3 DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG C4 DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG C5 DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG C6 DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG ************************:************************* C1 QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV C2 QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV C3 QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV C4 QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV C5 QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV C6 QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV ************************************************** C1 GIEHVLNDEDVVQIVKKV C2 GIDHVLNDEDVVQIVKKV C3 GIDHVLNDEDVVQIVKKV C4 GIEHVLNDEDVVQIVKKV C5 GIEHVLNDEDVVQIVKKV C6 GIEHVLNDEDVVQIVKKV **:*************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [72] Relaxation Summary: [11040]--->[11040] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.370 Mb, Max= 30.796 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C2 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >C3 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >C4 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C5 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C6 MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV FORMAT of file /tmp/tmp2525620386054257507aln Not Supported[FATAL:T-COFFEE] >C1 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C2 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >C3 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >C4 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C5 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C6 MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:368 S:100 BS:368 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 99.46 C1 C2 99.46 TOP 1 0 99.46 C2 C1 99.46 BOT 0 2 99.73 C1 C3 99.73 TOP 2 0 99.73 C3 C1 99.73 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 99.73 C1 C5 99.73 TOP 4 0 99.73 C5 C1 99.73 BOT 0 5 99.18 C1 C6 99.18 TOP 5 0 99.18 C6 C1 99.18 BOT 1 2 99.73 C2 C3 99.73 TOP 2 1 99.73 C3 C2 99.73 BOT 1 3 99.46 C2 C4 99.46 TOP 3 1 99.46 C4 C2 99.46 BOT 1 4 99.18 C2 C5 99.18 TOP 4 1 99.18 C5 C2 99.18 BOT 1 5 98.64 C2 C6 98.64 TOP 5 1 98.64 C6 C2 98.64 BOT 2 3 99.73 C3 C4 99.73 TOP 3 2 99.73 C4 C3 99.73 BOT 2 4 99.46 C3 C5 99.46 TOP 4 2 99.46 C5 C3 99.46 BOT 2 5 98.91 C3 C6 98.91 TOP 5 2 98.91 C6 C3 98.91 BOT 3 4 99.73 C4 C5 99.73 TOP 4 3 99.73 C5 C4 99.73 BOT 3 5 99.18 C4 C6 99.18 TOP 5 3 99.18 C6 C4 99.18 BOT 4 5 99.46 C5 C6 99.46 TOP 5 4 99.46 C6 C5 99.46 AVG 0 C1 * 99.62 AVG 1 C2 * 99.29 AVG 2 C3 * 99.51 AVG 3 C4 * 99.62 AVG 4 C5 * 99.51 AVG 5 C6 * 99.08 TOT TOT * 99.44 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG C2 ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG C3 ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG C4 ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG C5 ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG C6 ATGAGCACAATTTTGGAGAAAATCGCGGCCATCGAGTCGGAGATGGCCCG ***********:************ ************************* C1 AACCCAAAAGAACAAGGCCACCTCGGCCCATTTGGGTCTACTGAAGGCGA C2 AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA C3 AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA C4 AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCGA C5 AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCAA C6 CACCCAGAAGAATAAGGCCACCTCGGCGCATTTGGGTCTCCTGAAGGCTA .*****.***** ************** *********** ******** * C1 AGCTGGCTAAGCTGCGACGCGAACTGATTTCCCCCAAAGGAGGCGGCGGC C2 AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAGGGAGGCGGCGGC C3 AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC C4 AGCTGGCCAAGCTGCGGCGCGAGCTGATTTCCCCCAAAGGAGGTGGCGGC C5 AGCTGGCCAAGCTGCGACGCGAGCTGATTTCTCCCAAAGGAGGCGGCGGC C6 AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC ******* ********.*****.******** *****.***** ****** C1 GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACTGGAGATGCCCGGGT C2 GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT C3 GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT C4 GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACGGGAGATGCCCGTGT C5 GGAACCGGCGAAGCTGGCTTCGAGGTGGCGAAGACAGGAGATGCCCGTGT C6 GGAACCGGCGAGGCTGGCTTTGAGGTGGCCAAGACAGGAGATGCCCGGGT ***********.******** ******** ***** *********** ** C1 GGGATTCGTAGGGTTTCCTTCTGTGGGTAAATCCACACTGCTCTCCAACT C2 GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT C3 GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT C4 GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCAAACT C5 GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCTAACT C6 GGGCTTTGTGGGTTTCCCATCCGTGGGTAAATCCACTTTACTGTCCAATT ***.** ** ** ** **:** **.***********: *.** ** ** * C1 TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC C2 TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC C3 TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC C4 TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC C5 TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC C6 TAGCTGGAGTTTATTCCGAGGTGGCGGCCTACGAGTTCACAACGTTGACA *.*****.***** **************.*****.**************. C1 ACTGTGCCGGGATGCATTAAGTACAAGGGCGCTAAGATCCAGCTGCTGGA C2 ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTCCTGGA C3 ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA C4 ACTGTACCAGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA C5 ACTGTGCCAGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA C6 ACTGTGCCGGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTCGA *****.**.******** ************** *********** ** ** C1 CTTGCCCGGTATCATTGAGGGCGCTAAGGATGGCAAGGGTCGAGGTCGTC C2 TTTGCCCGGTATCATTGAGGGCGCTAAGGACGGCAAGGGTCGAGGTCGTC C3 TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGGGGTCGTC C4 TCTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC C5 TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC C6 TTTGCCCGGAATCATTGAGGGCGCCAAGGATGGCAAAGGTCGTGGTCGTC *******:************** ***** *****.***** ******* C1 AGGTGATTGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT C2 AGGTGATAGCTGTCGCTCGCACCTGCAACCTCATTTTCATGGTGCTGGAT C3 AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT C4 AGGTGATAGCTGTTGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT C5 AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATCTTCATGGTGCTGGAT C6 AGGTGATCGCCGTCGCACGAACCTGTAACCTAATCTTCATGGTGCTGGAT ******* ** ** **:**.***** *****.** *************** C1 TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG C2 TGCCTGAAACCGCTTGGCCACAAAAAACTCCTCGAGCATGAATTGGAGGG C3 TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG C4 TGCCTGAAACCGCTTGGCCACAAGAAACTCCTGGAGCATGAATTGGAGGG C5 TGCCTGAAACCGCTTGGCCACAAGAAACTGCTCGAGCATGAATTGGAGGG C6 TGCCTGAAACCGCTGGGTCACAAAAAACTGCTGGAGCACGAGTTGGAGGG ************** ** *****.***** ** ***** **.******** C1 CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA C2 CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA C3 CTTCGGCATCCGGCTAAACAAGAAACCACCAAATATCTACTACAAGCGGA C4 CTTCGGCATCCGTCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA C5 CTTCGGCATTCGGCTTAACAAGAAACCACCAAATATTTACTACAAGCGGA C6 CTTTGGCATCCGGCTTAACAAGAAACCGCCAAATATCTACTACAAGCGGA *** ***** ** **:***********.******** ************* C1 AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCCGAGTTG C2 AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG C3 AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG C4 AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCTGAGTTG C5 AAGACAAGGGTGGCATCAATCTTAACTGCATGGTTCCGCAGTCGGAGTTG C6 AGGACAAGGGCGGCATCAACCTGAACTGCATGGTTCCGCAATCCGAATTG *.******** ******** ** ***:********** **.** **. ** C1 GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC C2 GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC C3 GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC C4 GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC C5 GACACGGATCTGGTGAAGACCATTCTGTCCGAGTACAAGATCCACAATGC C6 GACGCGGATCTGGTGAAAACGATTTTATCGGAGTACAAGATCCACAATGC ***.*************.** *** *.** ******************** C1 GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTCATTGACGTTA C2 GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA C3 GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA C4 GGACATCACCCTAAGATACGACGCCACTAGTGACGATCTGATCGACGTTA C5 GGACATCACCCTGAGATACGACGCCACTAGTGACGATCTGATCGACGTTA C6 CGACATTACGCTGAGATACGATGCCACTAGTGACGACCTAATCGACGTGA ***** ** **.******** ************** ** ** ***** * C1 TCGAGGGCAACCGCATCTACATACCCTGCATATATCTGCTGAACAAGATC C2 TTGAGGGCAACCGCATCTATATACCTTGCATCTATCTGCTAAACAAGATC C3 TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC C4 TTGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC C5 TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC C6 TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAATAAGATC * ***************** ***** *****.********.** ****** C1 GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG C2 GATCAGATCTCCATTGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG C3 GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG C4 GATCAGATCTCCATCGAGGAACTGGACGTCATCTACAAGATCCCGCATTG C5 GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCACATTG C6 GATCAGATCTCCATTGAGGAGCTGGACGTAATCTACAAGATCCCGCACTG ************** *****.********.**************.** ** C1 CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC C2 TGTGCCCATCTCGGCCCATCACAACTGGAACTTTGACGATCTTCTGGAGC C3 CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC C4 CGTGCCCATTTCGGCCCATCATCACTGGAACTTCGACGATCTGCTGGAGC C5 CGTGCCCATCTCAGCCCATCACCACTGGAACTTTGACGATCTTCTTGAGC C6 CGTGCCCATTTCGGCGCACCACCACTGGAACTTTGACGATCTGCTGGAGC ******** **.** ** ** .********** ******** ** **** C1 TGATGTGGGAATACCTGCGACTGCAGCGCATCTACACCAAGCCCAAGGGC C2 TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGT C3 TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGC C4 TGATGTGGGAGTACCTGCGGCTACAGCGCATCTACACCAAGCCCAAGGGC C5 TGATGTGGGAGTACCTGCGGTTACAGCGCATCTACACCAAGCCCAAGGGT C6 TGATGTGGGAATACCTGCGGCTGCAGCGAATCTACACGAAGCCCAAGGGC **********.********. *.*****.******** *********** C1 CAGCTGCCCGATTACAACTCGCCCGTGGTACTCCACAACGAGCGCACCAG C2 CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGTACTAG C3 CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG C4 CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG C5 CAGTTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG C6 CAGCTGCCCGACTACAATTCACCCGTGGTGCTCCACAACGAGCGCACCAG *** ******* ***** **.********.************** ** ** C1 CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA C2 CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA C3 CATTGAAGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA C4 CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA C5 CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA C6 CATTGAGGACTTTTGCAACAAGTTGCATCGCTCCATCGCAAAGGAGTTTA ******.** ** ********* ************* **.*****.**** C1 AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCACAGAAGGTG C2 AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG C3 AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCTCAGAAGGTG C4 AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCGCAGAAGGTG C5 AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG C6 AATATGCGCTGGTCTGGGGTTCATCCGTGAAGCATCAACCCCAGAAAGTG ************* ***** ***** ***********.** *****.*** C1 GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA C2 GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA C3 GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA C4 GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA C5 GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA C6 GGCATCGAGCATGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA ******** ** ******************** ***************** C1 GGTT C2 GGTT C3 GGTT C4 GGTT C5 GGTT C6 GGTT **** >C1 ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAAAAGAACAAGGCCACCTCGGCCCATTTGGGTCTACTGAAGGCGA AGCTGGCTAAGCTGCGACGCGAACTGATTTCCCCCAAAGGAGGCGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACTGGAGATGCCCGGGT GGGATTCGTAGGGTTTCCTTCTGTGGGTAAATCCACACTGCTCTCCAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC ACTGTGCCGGGATGCATTAAGTACAAGGGCGCTAAGATCCAGCTGCTGGA CTTGCCCGGTATCATTGAGGGCGCTAAGGATGGCAAGGGTCGAGGTCGTC AGGTGATTGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCCGAGTTG GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTCATTGACGTTA TCGAGGGCAACCGCATCTACATACCCTGCATATATCTGCTGAACAAGATC GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC TGATGTGGGAATACCTGCGACTGCAGCGCATCTACACCAAGCCCAAGGGC CAGCTGCCCGATTACAACTCGCCCGTGGTACTCCACAACGAGCGCACCAG CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCACAGAAGGTG GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA GGTT >C2 ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAGGGAGGCGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTCCTGGA TTTGCCCGGTATCATTGAGGGCGCTAAGGACGGCAAGGGTCGAGGTCGTC AGGTGATAGCTGTCGCTCGCACCTGCAACCTCATTTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAAAAACTCCTCGAGCATGAATTGGAGGG CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA TTGAGGGCAACCGCATCTATATACCTTGCATCTATCTGCTAAACAAGATC GATCAGATCTCCATTGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG TGTGCCCATCTCGGCCCATCACAACTGGAACTTTGACGATCTTCTGGAGC TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGT CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGTACTAG CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA GGTT >C3 ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGGGGTCGTC AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG CTTCGGCATCCGGCTAAACAAGAAACCACCAAATATCTACTACAAGCGGA AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGC CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG CATTGAAGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCTCAGAAGGTG GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA GGTT >C4 ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCGA AGCTGGCCAAGCTGCGGCGCGAGCTGATTTCCCCCAAAGGAGGTGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACGGGAGATGCCCGTGT GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCAAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC ACTGTACCAGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA TCTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC AGGTGATAGCTGTTGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAGAAACTCCTGGAGCATGAATTGGAGGG CTTCGGCATCCGTCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCTGAGTTG GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC GGACATCACCCTAAGATACGACGCCACTAGTGACGATCTGATCGACGTTA TTGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC GATCAGATCTCCATCGAGGAACTGGACGTCATCTACAAGATCCCGCATTG CGTGCCCATTTCGGCCCATCATCACTGGAACTTCGACGATCTGCTGGAGC TGATGTGGGAGTACCTGCGGCTACAGCGCATCTACACCAAGCCCAAGGGC CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCGCAGAAGGTG GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA GGTT >C5 ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCAA AGCTGGCCAAGCTGCGACGCGAGCTGATTTCTCCCAAAGGAGGCGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCGAAGACAGGAGATGCCCGTGT GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCTAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC ACTGTGCCAGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATCTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAGAAACTGCTCGAGCATGAATTGGAGGG CTTCGGCATTCGGCTTAACAAGAAACCACCAAATATTTACTACAAGCGGA AAGACAAGGGTGGCATCAATCTTAACTGCATGGTTCCGCAGTCGGAGTTG GACACGGATCTGGTGAAGACCATTCTGTCCGAGTACAAGATCCACAATGC GGACATCACCCTGAGATACGACGCCACTAGTGACGATCTGATCGACGTTA TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCACATTG CGTGCCCATCTCAGCCCATCACCACTGGAACTTTGACGATCTTCTTGAGC TGATGTGGGAGTACCTGCGGTTACAGCGCATCTACACCAAGCCCAAGGGT CAGTTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA GGTT >C6 ATGAGCACAATTTTGGAGAAAATCGCGGCCATCGAGTCGGAGATGGCCCG CACCCAGAAGAATAAGGCCACCTCGGCGCATTTGGGTCTCCTGAAGGCTA AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC GGAACCGGCGAGGCTGGCTTTGAGGTGGCCAAGACAGGAGATGCCCGGGT GGGCTTTGTGGGTTTCCCATCCGTGGGTAAATCCACTTTACTGTCCAATT TAGCTGGAGTTTATTCCGAGGTGGCGGCCTACGAGTTCACAACGTTGACA ACTGTGCCGGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTCGA TTTGCCCGGAATCATTGAGGGCGCCAAGGATGGCAAAGGTCGTGGTCGTC AGGTGATCGCCGTCGCACGAACCTGTAACCTAATCTTCATGGTGCTGGAT TGCCTGAAACCGCTGGGTCACAAAAAACTGCTGGAGCACGAGTTGGAGGG CTTTGGCATCCGGCTTAACAAGAAACCGCCAAATATCTACTACAAGCGGA AGGACAAGGGCGGCATCAACCTGAACTGCATGGTTCCGCAATCCGAATTG GACGCGGATCTGGTGAAAACGATTTTATCGGAGTACAAGATCCACAATGC CGACATTACGCTGAGATACGATGCCACTAGTGACGACCTAATCGACGTGA TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAATAAGATC GATCAGATCTCCATTGAGGAGCTGGACGTAATCTACAAGATCCCGCACTG CGTGCCCATTTCGGCGCACCACCACTGGAACTTTGACGATCTGCTGGAGC TGATGTGGGAATACCTGCGGCTGCAGCGAATCTACACGAAGCCCAAGGGC CAGCTGCCCGACTACAATTCACCCGTGGTGCTCCACAACGAGCGCACCAG CATTGAGGACTTTTGCAACAAGTTGCATCGCTCCATCGCAAAGGAGTTTA AATATGCGCTGGTCTGGGGTTCATCCGTGAAGCATCAACCCCAGAAAGTG GGCATCGAGCATGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA GGTT >C1 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C2 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >C3 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >C4 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C5 MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >C6 MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1104 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1480078170 Setting output file names to "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 897583322 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 6759784829 Seed = 733388387 Swapseed = 1480078170 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 12 unique site patterns Division 2 has 4 unique site patterns Division 3 has 72 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3131.063190 -- -24.965149 Chain 2 -- -3129.710594 -- -24.965149 Chain 3 -- -3131.721927 -- -24.965149 Chain 4 -- -3119.752517 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3102.951460 -- -24.965149 Chain 2 -- -3082.437147 -- -24.965149 Chain 3 -- -3132.285207 -- -24.965149 Chain 4 -- -3081.745827 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3131.063] (-3129.711) (-3131.722) (-3119.753) * [-3102.951] (-3082.437) (-3132.285) (-3081.746) 500 -- (-2524.573) [-2517.053] (-2517.953) (-2505.594) * [-2524.119] (-2529.149) (-2522.786) (-2510.379) -- 0:00:00 1000 -- (-2506.347) [-2509.613] (-2521.759) (-2493.834) * [-2486.282] (-2525.676) (-2518.903) (-2486.170) -- 0:00:00 1500 -- (-2495.562) [-2460.776] (-2500.489) (-2482.596) * [-2453.989] (-2510.880) (-2515.108) (-2472.824) -- 0:00:00 2000 -- (-2476.917) [-2435.027] (-2473.383) (-2478.948) * [-2437.771] (-2505.264) (-2500.626) (-2450.773) -- 0:00:00 2500 -- (-2466.933) (-2418.575) [-2429.086] (-2442.688) * (-2427.300) (-2474.258) (-2470.835) [-2438.315] -- 0:00:00 3000 -- (-2450.468) [-2419.114] (-2420.540) (-2415.990) * (-2422.085) (-2427.952) (-2456.754) [-2429.379] -- 0:05:32 3500 -- (-2430.009) [-2413.729] (-2419.674) (-2420.268) * (-2417.762) (-2429.474) [-2420.607] (-2430.279) -- 0:04:44 4000 -- [-2420.295] (-2421.720) (-2410.838) (-2417.122) * (-2419.713) (-2429.415) [-2416.717] (-2427.728) -- 0:04:09 4500 -- [-2422.139] (-2417.477) (-2423.837) (-2421.708) * (-2422.253) [-2418.213] (-2421.441) (-2427.044) -- 0:03:41 5000 -- (-2421.859) (-2417.598) (-2417.833) [-2421.361] * [-2413.448] (-2415.933) (-2420.408) (-2425.552) -- 0:03:19 Average standard deviation of split frequencies: 0.098209 5500 -- [-2415.191] (-2416.406) (-2422.952) (-2423.712) * (-2418.614) (-2422.204) [-2420.015] (-2424.880) -- 0:03:00 6000 -- [-2417.759] (-2425.499) (-2418.796) (-2419.677) * [-2415.128] (-2418.438) (-2426.314) (-2423.050) -- 0:02:45 6500 -- (-2417.895) (-2419.653) [-2414.924] (-2419.454) * (-2414.523) (-2428.582) (-2415.113) [-2431.423] -- 0:02:32 7000 -- (-2416.688) (-2424.278) [-2429.968] (-2420.735) * (-2424.599) (-2423.723) [-2419.019] (-2427.192) -- 0:02:21 7500 -- (-2416.102) [-2415.932] (-2424.963) (-2412.321) * (-2424.155) (-2416.251) [-2416.852] (-2422.466) -- 0:02:12 8000 -- (-2417.604) [-2421.436] (-2421.722) (-2419.495) * (-2426.967) [-2414.721] (-2413.899) (-2424.450) -- 0:02:04 8500 -- (-2423.147) [-2413.256] (-2420.402) (-2417.961) * (-2415.905) [-2415.643] (-2415.889) (-2422.097) -- 0:01:56 9000 -- (-2424.778) (-2415.710) [-2422.691] (-2415.321) * (-2430.900) (-2418.905) [-2422.344] (-2413.197) -- 0:03:40 9500 -- [-2419.191] (-2416.521) (-2415.086) (-2426.721) * [-2423.505] (-2417.965) (-2420.951) (-2417.352) -- 0:03:28 10000 -- (-2417.251) [-2421.456] (-2417.706) (-2415.490) * (-2414.687) [-2415.419] (-2420.039) (-2418.372) -- 0:03:18 Average standard deviation of split frequencies: 0.138896 10500 -- (-2419.727) (-2420.887) [-2420.427] (-2415.951) * (-2425.701) (-2424.604) (-2416.077) [-2415.664] -- 0:03:08 11000 -- [-2423.183] (-2413.783) (-2415.905) (-2424.226) * (-2424.332) (-2429.440) (-2419.761) [-2415.485] -- 0:02:59 11500 -- [-2422.519] (-2411.194) (-2422.060) (-2419.143) * (-2424.147) (-2424.816) (-2426.080) [-2416.807] -- 0:02:51 12000 -- [-2418.583] (-2411.724) (-2424.023) (-2423.157) * (-2417.742) (-2419.338) [-2418.710] (-2417.752) -- 0:02:44 12500 -- (-2421.135) [-2418.300] (-2421.183) (-2425.131) * (-2417.915) [-2417.500] (-2421.763) (-2417.386) -- 0:02:38 13000 -- (-2430.137) [-2415.505] (-2418.388) (-2418.863) * (-2422.909) [-2410.453] (-2418.941) (-2417.051) -- 0:02:31 13500 -- (-2423.281) (-2429.155) [-2417.632] (-2420.175) * (-2421.248) [-2413.769] (-2422.265) (-2416.651) -- 0:02:26 14000 -- [-2412.011] (-2434.451) (-2420.729) (-2415.885) * (-2423.011) (-2415.414) [-2421.849] (-2417.670) -- 0:02:20 14500 -- (-2417.853) [-2425.365] (-2419.818) (-2415.993) * (-2419.723) (-2418.917) [-2416.932] (-2416.946) -- 0:02:15 15000 -- (-2415.246) (-2424.812) (-2422.742) [-2420.780] * (-2418.581) (-2422.096) [-2414.581] (-2416.985) -- 0:03:17 Average standard deviation of split frequencies: 0.123744 15500 -- [-2418.244] (-2429.135) (-2417.183) (-2417.283) * (-2418.541) (-2417.304) (-2416.508) [-2412.074] -- 0:03:10 16000 -- (-2425.590) (-2418.860) (-2416.171) [-2417.650] * (-2419.675) (-2418.983) (-2414.187) [-2416.600] -- 0:03:04 16500 -- (-2415.985) (-2421.638) [-2419.128] (-2419.681) * (-2411.672) [-2417.102] (-2414.213) (-2416.584) -- 0:02:58 17000 -- (-2421.573) (-2422.538) (-2417.068) [-2419.533] * [-2414.006] (-2417.759) (-2416.198) (-2419.511) -- 0:02:53 17500 -- (-2422.374) (-2422.369) (-2425.102) [-2415.666] * (-2419.344) (-2419.964) [-2415.077] (-2418.097) -- 0:02:48 18000 -- [-2426.004] (-2417.896) (-2420.418) (-2430.010) * [-2418.023] (-2414.442) (-2420.263) (-2418.112) -- 0:02:43 18500 -- [-2420.296] (-2418.433) (-2425.156) (-2420.212) * [-2414.692] (-2415.912) (-2424.939) (-2421.995) -- 0:02:39 19000 -- (-2418.024) [-2423.169] (-2419.683) (-2427.546) * (-2415.599) (-2429.238) (-2425.218) [-2421.204] -- 0:02:34 19500 -- [-2420.938] (-2421.066) (-2424.790) (-2415.736) * (-2419.905) [-2423.826] (-2419.716) (-2421.575) -- 0:02:30 20000 -- (-2418.305) (-2428.111) (-2422.773) [-2415.642] * (-2418.021) (-2414.542) (-2414.913) [-2418.158] -- 0:02:27 Average standard deviation of split frequencies: 0.087438 20500 -- (-2422.203) [-2416.647] (-2423.481) (-2419.751) * (-2416.933) (-2415.610) (-2417.997) [-2420.408] -- 0:02:23 21000 -- (-2418.740) (-2418.018) [-2423.469] (-2417.483) * [-2414.753] (-2422.346) (-2416.773) (-2415.154) -- 0:03:06 21500 -- (-2424.080) [-2417.731] (-2421.045) (-2424.707) * (-2413.351) (-2421.272) (-2423.192) [-2416.508] -- 0:03:02 22000 -- (-2423.537) [-2414.759] (-2416.827) (-2412.971) * (-2418.050) [-2412.799] (-2422.552) (-2419.262) -- 0:02:57 22500 -- (-2425.257) (-2413.714) (-2423.668) [-2418.948] * (-2422.545) (-2420.329) [-2422.725] (-2430.061) -- 0:02:53 23000 -- (-2426.815) [-2413.011] (-2415.395) (-2422.613) * (-2420.783) [-2413.969] (-2427.029) (-2420.405) -- 0:02:49 23500 -- [-2420.571] (-2415.033) (-2419.976) (-2418.222) * (-2421.746) (-2423.336) (-2429.230) [-2415.213] -- 0:02:46 24000 -- (-2429.848) [-2416.132] (-2423.999) (-2417.318) * (-2417.203) (-2420.664) (-2425.774) [-2415.903] -- 0:02:42 24500 -- (-2419.244) [-2414.346] (-2429.458) (-2424.062) * (-2418.401) [-2424.859] (-2415.281) (-2416.266) -- 0:02:39 25000 -- (-2420.036) (-2416.140) [-2424.695] (-2419.682) * (-2417.081) [-2419.581] (-2418.713) (-2417.379) -- 0:02:36 Average standard deviation of split frequencies: 0.072524 25500 -- (-2429.407) [-2421.093] (-2419.806) (-2415.276) * (-2417.199) (-2425.931) (-2415.875) [-2417.111] -- 0:02:32 26000 -- (-2421.196) [-2415.831] (-2426.026) (-2418.806) * [-2415.193] (-2419.284) (-2413.363) (-2418.328) -- 0:02:29 26500 -- [-2420.490] (-2421.504) (-2421.816) (-2429.310) * [-2415.859] (-2416.556) (-2424.226) (-2421.934) -- 0:02:26 27000 -- [-2419.390] (-2424.007) (-2426.125) (-2423.296) * (-2418.010) (-2415.388) [-2425.049] (-2418.306) -- 0:03:00 27500 -- [-2412.746] (-2415.267) (-2418.506) (-2422.013) * [-2418.976] (-2413.592) (-2417.591) (-2420.580) -- 0:02:56 28000 -- [-2414.662] (-2414.173) (-2421.310) (-2416.102) * [-2421.059] (-2422.960) (-2427.601) (-2416.671) -- 0:02:53 28500 -- (-2416.240) [-2421.876] (-2415.380) (-2411.976) * (-2420.460) (-2424.769) [-2420.894] (-2418.036) -- 0:02:50 29000 -- (-2414.118) (-2421.082) (-2413.236) [-2416.146] * (-2412.295) (-2420.700) (-2421.506) [-2419.648] -- 0:02:47 29500 -- (-2415.011) [-2415.675] (-2421.150) (-2423.350) * [-2420.105] (-2420.843) (-2423.682) (-2425.188) -- 0:02:44 30000 -- (-2415.974) (-2414.430) (-2416.743) [-2413.598] * [-2415.965] (-2425.023) (-2423.416) (-2418.850) -- 0:02:41 Average standard deviation of split frequencies: 0.066612 30500 -- (-2422.570) (-2423.122) (-2422.417) [-2418.255] * (-2417.285) (-2416.888) [-2419.078] (-2417.473) -- 0:02:38 31000 -- (-2420.946) (-2415.460) (-2418.847) [-2414.212] * (-2422.678) (-2415.437) (-2418.543) [-2416.286] -- 0:02:36 31500 -- (-2412.220) (-2417.426) [-2416.999] (-2420.528) * (-2416.840) (-2421.440) (-2416.507) [-2413.125] -- 0:02:33 32000 -- (-2417.603) [-2416.497] (-2418.863) (-2426.243) * (-2417.609) (-2421.220) [-2417.944] (-2426.160) -- 0:02:31 32500 -- [-2417.220] (-2418.785) (-2413.938) (-2422.414) * (-2420.448) (-2422.264) [-2418.387] (-2410.889) -- 0:02:28 33000 -- (-2411.821) (-2422.408) (-2418.501) [-2410.900] * (-2419.402) (-2418.374) [-2413.691] (-2420.949) -- 0:02:55 33500 -- (-2412.959) [-2416.409] (-2417.653) (-2417.744) * (-2421.950) [-2413.171] (-2413.253) (-2415.726) -- 0:02:53 34000 -- (-2415.912) [-2423.824] (-2416.563) (-2420.729) * [-2419.023] (-2410.740) (-2417.104) (-2414.346) -- 0:02:50 34500 -- (-2417.451) [-2414.328] (-2422.161) (-2418.149) * [-2419.610] (-2417.613) (-2432.546) (-2424.816) -- 0:02:47 35000 -- (-2425.563) (-2413.719) (-2412.239) [-2416.815] * (-2425.798) (-2418.492) (-2421.200) [-2418.002] -- 0:02:45 Average standard deviation of split frequencies: 0.069838 35500 -- [-2421.904] (-2420.344) (-2416.178) (-2411.544) * (-2415.528) (-2419.000) (-2412.410) [-2414.065] -- 0:02:43 36000 -- [-2415.025] (-2416.761) (-2427.238) (-2422.718) * [-2419.330] (-2420.221) (-2421.827) (-2415.644) -- 0:02:40 36500 -- (-2417.107) [-2418.056] (-2421.857) (-2414.381) * [-2416.485] (-2414.403) (-2418.175) (-2416.357) -- 0:02:38 37000 -- (-2419.198) (-2421.381) [-2420.761] (-2413.966) * [-2415.858] (-2421.272) (-2420.300) (-2419.689) -- 0:02:36 37500 -- (-2421.197) (-2418.590) [-2414.844] (-2426.165) * (-2415.682) [-2417.006] (-2419.887) (-2424.719) -- 0:02:34 38000 -- (-2417.647) [-2422.663] (-2417.979) (-2417.234) * (-2417.241) (-2416.872) (-2422.469) [-2422.334] -- 0:02:31 38500 -- (-2420.836) [-2416.316] (-2425.466) (-2415.168) * (-2418.738) (-2426.436) (-2423.395) [-2414.733] -- 0:02:29 39000 -- (-2428.305) (-2425.539) (-2418.210) [-2421.293] * (-2423.630) (-2422.973) (-2419.821) [-2416.237] -- 0:02:52 39500 -- (-2418.286) (-2425.862) [-2418.055] (-2420.576) * (-2419.372) (-2421.579) (-2426.790) [-2420.595] -- 0:02:50 40000 -- (-2423.565) (-2419.619) (-2415.996) [-2419.001] * (-2419.031) (-2425.289) (-2415.159) [-2416.994] -- 0:02:48 Average standard deviation of split frequencies: 0.061824 40500 -- (-2420.753) (-2420.133) (-2414.145) [-2409.639] * (-2417.781) (-2422.948) [-2419.079] (-2421.889) -- 0:02:45 41000 -- (-2414.882) (-2427.054) (-2420.735) [-2417.845] * (-2420.659) [-2421.579] (-2417.112) (-2419.653) -- 0:02:43 41500 -- [-2420.225] (-2418.847) (-2415.615) (-2433.736) * (-2415.570) (-2422.670) (-2419.957) [-2413.285] -- 0:02:41 42000 -- (-2424.561) (-2421.770) [-2415.877] (-2419.830) * (-2421.789) (-2423.242) [-2417.493] (-2424.795) -- 0:02:39 42500 -- (-2417.039) [-2429.868] (-2418.214) (-2424.167) * (-2421.687) (-2422.181) [-2421.224] (-2414.330) -- 0:02:37 43000 -- (-2420.140) [-2421.792] (-2418.743) (-2418.703) * (-2422.465) [-2414.304] (-2415.379) (-2426.821) -- 0:02:35 43500 -- (-2417.609) (-2417.973) (-2419.874) [-2423.903] * (-2429.917) (-2415.705) [-2418.669] (-2410.185) -- 0:02:33 44000 -- (-2415.086) (-2419.039) [-2417.814] (-2416.592) * (-2422.124) [-2414.636] (-2418.157) (-2422.531) -- 0:02:32 44500 -- (-2414.494) (-2425.441) (-2417.937) [-2416.297] * (-2417.399) (-2419.688) (-2419.506) [-2416.628] -- 0:02:30 45000 -- (-2412.838) (-2416.261) (-2414.162) [-2417.523] * (-2422.021) (-2423.531) (-2421.667) [-2413.760] -- 0:02:49 Average standard deviation of split frequencies: 0.053289 45500 -- (-2414.941) [-2414.619] (-2414.061) (-2424.247) * (-2419.835) (-2417.115) [-2417.807] (-2416.828) -- 0:02:47 46000 -- (-2417.457) (-2424.870) (-2416.969) [-2419.299] * (-2414.010) [-2424.115] (-2422.344) (-2410.284) -- 0:02:45 46500 -- (-2422.800) (-2429.341) [-2412.545] (-2422.680) * (-2417.163) (-2434.479) (-2420.793) [-2410.668] -- 0:02:44 47000 -- [-2413.707] (-2415.505) (-2414.693) (-2425.811) * (-2417.156) (-2421.430) [-2417.459] (-2418.902) -- 0:02:42 47500 -- (-2414.412) (-2425.219) [-2414.416] (-2417.024) * (-2416.257) [-2414.436] (-2418.861) (-2418.300) -- 0:02:40 48000 -- (-2412.887) [-2426.015] (-2416.110) (-2428.826) * (-2420.192) [-2416.690] (-2420.490) (-2425.196) -- 0:02:38 48500 -- (-2423.719) [-2415.421] (-2417.445) (-2424.513) * [-2420.364] (-2425.200) (-2417.954) (-2422.532) -- 0:02:36 49000 -- (-2422.115) (-2417.509) (-2416.922) [-2420.123] * (-2421.310) (-2424.992) [-2413.239] (-2420.626) -- 0:02:35 49500 -- (-2425.907) (-2420.821) [-2416.069] (-2419.918) * [-2413.145] (-2418.205) (-2412.626) (-2422.040) -- 0:02:33 50000 -- (-2434.169) [-2415.435] (-2414.179) (-2419.105) * [-2413.704] (-2419.945) (-2423.561) (-2422.939) -- 0:02:32 Average standard deviation of split frequencies: 0.046520 50500 -- (-2431.564) (-2423.063) [-2415.969] (-2418.639) * (-2421.718) (-2424.128) [-2418.541] (-2414.626) -- 0:02:30 51000 -- (-2431.143) (-2420.182) [-2413.401] (-2418.462) * (-2420.999) [-2414.962] (-2418.282) (-2421.204) -- 0:02:47 51500 -- (-2437.682) (-2416.144) [-2414.881] (-2419.179) * (-2425.190) (-2416.013) [-2413.957] (-2419.128) -- 0:02:45 52000 -- (-2425.617) (-2416.228) (-2411.698) [-2421.599] * (-2426.735) (-2421.091) (-2416.613) [-2421.126] -- 0:02:44 52500 -- (-2418.162) (-2414.493) [-2418.477] (-2419.044) * [-2419.112] (-2416.986) (-2427.818) (-2420.861) -- 0:02:42 53000 -- [-2420.740] (-2418.302) (-2418.647) (-2429.527) * (-2415.128) (-2416.990) [-2420.050] (-2420.740) -- 0:02:40 53500 -- (-2420.660) (-2422.299) [-2416.337] (-2421.052) * (-2416.270) [-2418.282] (-2421.671) (-2423.460) -- 0:02:39 54000 -- [-2420.281] (-2419.421) (-2425.641) (-2421.023) * [-2416.651] (-2422.967) (-2422.217) (-2419.443) -- 0:02:37 54500 -- (-2426.708) (-2419.733) [-2414.142] (-2422.771) * (-2416.766) (-2412.313) [-2420.235] (-2425.127) -- 0:02:36 55000 -- [-2419.367] (-2418.961) (-2414.866) (-2418.207) * (-2423.663) (-2417.258) (-2422.417) [-2417.500] -- 0:02:34 Average standard deviation of split frequencies: 0.042090 55500 -- (-2415.806) (-2418.791) (-2419.428) [-2420.221] * (-2419.334) (-2414.774) [-2421.906] (-2417.454) -- 0:02:33 56000 -- (-2418.286) [-2420.046] (-2419.904) (-2415.495) * (-2416.056) (-2418.608) (-2417.614) [-2413.625] -- 0:02:31 56500 -- (-2419.607) (-2420.525) [-2416.730] (-2416.892) * [-2422.347] (-2419.292) (-2426.728) (-2424.808) -- 0:02:30 57000 -- (-2422.296) [-2413.299] (-2426.850) (-2419.461) * (-2417.289) (-2416.401) [-2420.961] (-2419.554) -- 0:02:45 57500 -- [-2415.294] (-2419.582) (-2416.067) (-2422.472) * (-2424.904) (-2418.362) (-2425.762) [-2412.637] -- 0:02:43 58000 -- (-2414.143) [-2425.625] (-2414.030) (-2421.090) * (-2415.503) (-2414.609) (-2420.738) [-2416.379] -- 0:02:42 58500 -- (-2418.474) [-2417.334] (-2417.315) (-2419.924) * (-2413.954) (-2421.303) [-2418.286] (-2414.591) -- 0:02:40 59000 -- (-2418.786) (-2418.623) (-2416.943) [-2416.895] * [-2418.936] (-2427.804) (-2417.776) (-2420.979) -- 0:02:39 59500 -- (-2415.986) (-2421.452) (-2423.206) [-2423.761] * (-2418.224) (-2421.812) [-2419.969] (-2423.176) -- 0:02:38 60000 -- (-2418.599) (-2424.124) [-2419.351] (-2420.500) * (-2421.076) (-2424.140) (-2426.638) [-2416.850] -- 0:02:36 Average standard deviation of split frequencies: 0.040406 60500 -- [-2413.554] (-2422.149) (-2421.181) (-2422.307) * (-2416.176) (-2419.643) (-2423.015) [-2413.340] -- 0:02:35 61000 -- (-2417.199) (-2425.306) [-2417.692] (-2424.156) * (-2415.735) [-2417.569] (-2418.301) (-2420.188) -- 0:02:33 61500 -- (-2419.169) (-2426.346) (-2413.240) [-2415.896] * (-2416.350) (-2419.057) (-2418.511) [-2417.664] -- 0:02:32 62000 -- (-2414.479) (-2422.964) (-2421.029) [-2420.668] * (-2413.704) (-2422.245) [-2420.787] (-2420.847) -- 0:02:31 62500 -- (-2420.441) (-2417.481) (-2416.580) [-2421.865] * [-2418.736] (-2417.861) (-2419.385) (-2413.623) -- 0:02:45 63000 -- (-2418.493) (-2418.002) [-2419.335] (-2420.410) * [-2414.845] (-2424.876) (-2414.827) (-2420.320) -- 0:02:43 63500 -- (-2415.645) [-2410.748] (-2417.802) (-2416.054) * (-2412.477) [-2419.303] (-2424.772) (-2419.128) -- 0:02:42 64000 -- (-2424.436) [-2418.074] (-2418.509) (-2421.305) * (-2424.522) [-2420.862] (-2421.426) (-2416.092) -- 0:02:40 64500 -- [-2413.628] (-2415.439) (-2411.540) (-2414.094) * [-2415.755] (-2416.714) (-2413.723) (-2416.281) -- 0:02:39 65000 -- [-2416.441] (-2416.758) (-2415.527) (-2422.471) * (-2419.016) (-2414.261) (-2420.593) [-2419.224] -- 0:02:38 Average standard deviation of split frequencies: 0.038569 65500 -- (-2435.346) [-2421.835] (-2417.941) (-2418.959) * (-2414.740) (-2422.833) (-2417.223) [-2416.780] -- 0:02:36 66000 -- (-2420.217) (-2418.037) [-2418.917] (-2416.711) * (-2420.709) (-2413.997) (-2427.236) [-2418.771] -- 0:02:35 66500 -- (-2416.154) (-2424.189) (-2416.406) [-2411.486] * [-2413.104] (-2426.026) (-2416.773) (-2427.141) -- 0:02:34 67000 -- (-2420.104) (-2424.067) (-2421.980) [-2416.694] * (-2414.581) (-2420.345) [-2418.438] (-2429.737) -- 0:02:33 67500 -- (-2429.129) [-2418.916] (-2415.908) (-2414.737) * (-2420.413) [-2416.677] (-2415.009) (-2423.401) -- 0:02:31 68000 -- (-2427.528) (-2412.917) [-2417.084] (-2416.658) * (-2424.038) [-2415.455] (-2418.180) (-2423.401) -- 0:02:44 68500 -- (-2436.137) [-2416.494] (-2423.921) (-2419.563) * [-2416.808] (-2423.992) (-2420.991) (-2420.750) -- 0:02:43 69000 -- (-2428.213) (-2422.781) [-2426.506] (-2412.606) * [-2418.753] (-2412.870) (-2413.993) (-2427.218) -- 0:02:41 69500 -- (-2424.185) (-2412.624) (-2418.133) [-2415.531] * (-2414.837) (-2414.124) [-2417.267] (-2421.154) -- 0:02:40 70000 -- (-2423.463) (-2419.783) [-2417.986] (-2421.518) * (-2416.877) [-2417.105] (-2413.560) (-2417.377) -- 0:02:39 Average standard deviation of split frequencies: 0.035578 70500 -- (-2421.607) [-2417.230] (-2420.752) (-2422.777) * [-2417.049] (-2419.462) (-2419.317) (-2418.295) -- 0:02:38 71000 -- [-2421.375] (-2420.951) (-2421.404) (-2420.142) * (-2413.106) (-2420.505) [-2420.546] (-2416.478) -- 0:02:37 71500 -- (-2421.922) [-2421.725] (-2423.289) (-2414.425) * (-2419.932) [-2410.813] (-2420.647) (-2420.141) -- 0:02:35 72000 -- [-2421.226] (-2414.088) (-2415.684) (-2420.845) * (-2419.266) [-2418.619] (-2429.812) (-2412.919) -- 0:02:34 72500 -- (-2418.207) (-2416.130) (-2425.143) [-2416.142] * (-2416.466) [-2413.627] (-2412.284) (-2413.427) -- 0:02:33 73000 -- (-2427.198) (-2427.081) [-2420.745] (-2420.508) * (-2416.529) (-2422.106) (-2419.235) [-2418.387] -- 0:02:32 73500 -- (-2419.580) (-2418.956) (-2416.389) [-2416.383] * (-2414.861) (-2422.680) [-2416.352] (-2418.512) -- 0:02:43 74000 -- (-2417.103) [-2412.932] (-2421.162) (-2426.127) * [-2413.819] (-2424.969) (-2416.328) (-2424.057) -- 0:02:42 74500 -- (-2415.960) (-2416.199) [-2412.642] (-2418.482) * (-2414.115) [-2415.071] (-2415.591) (-2417.481) -- 0:02:41 75000 -- (-2416.978) (-2415.090) [-2421.016] (-2422.248) * [-2413.551] (-2416.171) (-2422.543) (-2418.245) -- 0:02:40 Average standard deviation of split frequencies: 0.034115 75500 -- (-2421.425) (-2424.833) (-2418.454) [-2414.819] * [-2415.447] (-2419.417) (-2420.735) (-2422.956) -- 0:02:39 76000 -- (-2422.988) [-2422.738] (-2414.068) (-2414.079) * (-2413.801) (-2422.614) [-2419.272] (-2421.594) -- 0:02:38 76500 -- [-2421.380] (-2421.683) (-2417.321) (-2418.619) * [-2415.671] (-2430.305) (-2413.614) (-2412.544) -- 0:02:36 77000 -- (-2425.224) (-2421.484) [-2414.638] (-2419.241) * (-2417.145) (-2425.191) [-2415.353] (-2419.674) -- 0:02:35 77500 -- (-2419.900) [-2431.752] (-2408.849) (-2412.500) * [-2418.489] (-2423.544) (-2419.095) (-2418.765) -- 0:02:34 78000 -- (-2423.831) (-2420.890) (-2412.385) [-2417.829] * (-2415.919) (-2424.709) (-2419.580) [-2420.919] -- 0:02:33 78500 -- (-2422.524) (-2415.271) (-2417.246) [-2420.226] * (-2417.398) (-2422.710) [-2418.529] (-2427.471) -- 0:02:32 79000 -- (-2417.658) (-2415.624) (-2419.472) [-2417.374] * (-2417.407) [-2417.146] (-2415.722) (-2415.414) -- 0:02:31 79500 -- (-2416.632) [-2421.237] (-2415.386) (-2421.560) * (-2419.836) (-2418.271) (-2422.375) [-2415.110] -- 0:02:42 80000 -- (-2429.422) [-2415.363] (-2419.999) (-2421.151) * (-2424.184) (-2419.785) (-2414.818) [-2416.515] -- 0:02:41 Average standard deviation of split frequencies: 0.028051 80500 -- [-2417.334] (-2432.355) (-2426.935) (-2421.982) * (-2417.125) [-2420.287] (-2424.733) (-2418.788) -- 0:02:39 81000 -- (-2418.241) (-2415.303) [-2423.603] (-2416.896) * (-2416.496) (-2418.179) [-2419.780] (-2419.075) -- 0:02:38 81500 -- [-2423.886] (-2420.361) (-2429.749) (-2431.332) * (-2423.208) (-2419.602) (-2417.629) [-2418.302] -- 0:02:37 82000 -- (-2419.619) (-2417.806) [-2415.292] (-2420.769) * [-2419.213] (-2429.279) (-2420.490) (-2416.017) -- 0:02:36 82500 -- (-2418.570) (-2418.816) [-2415.254] (-2414.993) * (-2422.725) [-2418.424] (-2419.234) (-2422.405) -- 0:02:35 83000 -- (-2421.782) [-2418.875] (-2421.006) (-2413.797) * [-2416.707] (-2411.511) (-2414.603) (-2424.387) -- 0:02:34 83500 -- (-2422.786) (-2420.564) (-2421.529) [-2414.708] * (-2419.603) (-2414.693) [-2420.028] (-2421.918) -- 0:02:33 84000 -- (-2421.588) [-2414.366] (-2422.614) (-2423.848) * (-2420.081) [-2417.277] (-2426.885) (-2422.541) -- 0:02:32 84500 -- (-2415.349) [-2415.654] (-2415.379) (-2425.581) * (-2420.799) (-2415.564) [-2419.766] (-2418.170) -- 0:02:31 85000 -- (-2424.352) (-2417.839) (-2417.371) [-2414.463] * (-2416.305) (-2415.534) (-2422.608) [-2415.281] -- 0:02:30 Average standard deviation of split frequencies: 0.024118 85500 -- (-2416.638) (-2418.366) [-2416.929] (-2422.342) * (-2412.990) [-2422.904] (-2418.874) (-2426.215) -- 0:02:40 86000 -- (-2421.273) (-2418.745) (-2422.485) [-2414.897] * [-2422.927] (-2414.338) (-2418.490) (-2418.539) -- 0:02:39 86500 -- (-2426.760) (-2425.673) [-2418.454] (-2415.694) * [-2416.287] (-2414.515) (-2423.221) (-2418.797) -- 0:02:38 87000 -- (-2415.460) [-2426.643] (-2427.738) (-2421.443) * [-2417.057] (-2421.880) (-2419.096) (-2420.926) -- 0:02:37 87500 -- [-2421.615] (-2420.283) (-2422.029) (-2414.507) * [-2418.064] (-2425.148) (-2420.996) (-2416.056) -- 0:02:36 88000 -- (-2417.019) [-2418.260] (-2428.614) (-2418.373) * [-2417.650] (-2417.064) (-2419.300) (-2423.763) -- 0:02:35 88500 -- (-2418.375) (-2414.081) (-2423.304) [-2422.659] * [-2421.030] (-2418.188) (-2422.921) (-2413.599) -- 0:02:34 89000 -- (-2423.204) (-2413.210) (-2421.531) [-2418.905] * (-2416.883) [-2416.912] (-2418.770) (-2421.806) -- 0:02:33 89500 -- (-2415.646) [-2415.638] (-2420.466) (-2414.616) * (-2417.816) (-2424.605) [-2410.342] (-2419.760) -- 0:02:32 90000 -- (-2415.424) (-2415.125) (-2414.408) [-2415.566] * (-2417.061) (-2423.034) (-2421.861) [-2416.415] -- 0:02:31 Average standard deviation of split frequencies: 0.020797 90500 -- (-2420.630) [-2415.678] (-2414.813) (-2414.200) * [-2423.275] (-2425.806) (-2415.269) (-2417.709) -- 0:02:30 91000 -- (-2425.615) (-2416.381) [-2414.357] (-2423.809) * [-2423.723] (-2417.261) (-2427.038) (-2417.658) -- 0:02:29 91500 -- (-2420.582) (-2414.869) (-2424.446) [-2416.684] * (-2422.059) (-2427.301) (-2430.592) [-2430.030] -- 0:02:38 92000 -- (-2415.328) [-2418.674] (-2422.886) (-2423.619) * [-2422.286] (-2424.438) (-2415.177) (-2429.447) -- 0:02:37 92500 -- (-2424.996) (-2419.256) (-2414.436) [-2413.688] * (-2419.960) (-2419.111) (-2417.869) [-2419.862] -- 0:02:36 93000 -- (-2416.293) (-2418.534) [-2416.866] (-2415.993) * (-2419.180) (-2425.036) (-2417.756) [-2412.386] -- 0:02:36 93500 -- [-2419.684] (-2419.691) (-2419.882) (-2416.807) * (-2424.183) [-2415.610] (-2423.586) (-2420.958) -- 0:02:35 94000 -- (-2418.139) (-2421.075) (-2419.465) [-2415.091] * (-2419.393) (-2414.030) [-2419.473] (-2417.096) -- 0:02:34 94500 -- (-2418.172) (-2422.333) (-2422.584) [-2412.251] * (-2420.186) (-2423.463) [-2424.856] (-2419.307) -- 0:02:33 95000 -- [-2413.157] (-2421.380) (-2414.772) (-2420.795) * (-2419.988) (-2421.842) [-2413.973] (-2418.085) -- 0:02:32 Average standard deviation of split frequencies: 0.022097 95500 -- (-2422.941) (-2420.817) (-2418.805) [-2422.342] * (-2424.288) [-2415.448] (-2421.462) (-2419.923) -- 0:02:31 96000 -- [-2417.272] (-2430.460) (-2419.657) (-2414.183) * (-2424.218) (-2415.904) [-2418.764] (-2417.317) -- 0:02:30 96500 -- (-2419.805) (-2414.888) (-2421.834) [-2421.745] * (-2424.106) (-2418.549) (-2418.563) [-2420.832] -- 0:02:29 97000 -- (-2418.856) [-2416.826] (-2416.149) (-2423.586) * (-2427.846) (-2419.146) [-2420.696] (-2418.257) -- 0:02:28 97500 -- [-2419.954] (-2423.022) (-2418.349) (-2420.814) * (-2417.617) (-2432.247) [-2427.182] (-2421.214) -- 0:02:37 98000 -- (-2432.447) [-2418.782] (-2420.474) (-2413.715) * (-2421.854) (-2419.750) [-2417.118] (-2418.200) -- 0:02:36 98500 -- [-2423.620] (-2419.087) (-2420.302) (-2418.409) * (-2417.190) [-2417.555] (-2418.040) (-2417.865) -- 0:02:35 99000 -- (-2417.841) (-2416.969) [-2414.236] (-2425.192) * [-2417.854] (-2414.359) (-2424.190) (-2427.304) -- 0:02:34 99500 -- (-2415.458) (-2416.384) [-2416.379] (-2425.318) * [-2422.023] (-2419.138) (-2418.469) (-2424.774) -- 0:02:33 100000 -- (-2420.306) [-2415.156] (-2419.456) (-2415.732) * [-2417.928] (-2419.266) (-2420.572) (-2422.602) -- 0:02:33 Average standard deviation of split frequencies: 0.025756 100500 -- (-2425.243) (-2419.642) [-2424.345] (-2418.664) * (-2415.782) (-2422.013) (-2417.170) [-2421.754] -- 0:02:32 101000 -- (-2425.657) (-2425.679) (-2415.363) [-2417.136] * [-2416.445] (-2420.196) (-2416.140) (-2419.866) -- 0:02:31 101500 -- (-2421.094) (-2427.353) (-2423.880) [-2417.141] * (-2419.768) (-2420.621) (-2415.078) [-2417.492] -- 0:02:30 102000 -- (-2419.060) (-2412.101) (-2420.702) [-2421.866] * (-2431.311) (-2420.992) (-2420.985) [-2414.976] -- 0:02:29 102500 -- (-2427.281) [-2414.998] (-2424.251) (-2425.440) * [-2416.333] (-2424.856) (-2420.955) (-2420.940) -- 0:02:28 103000 -- [-2415.986] (-2415.167) (-2421.468) (-2427.059) * [-2414.760] (-2420.489) (-2415.709) (-2418.878) -- 0:02:28 103500 -- [-2419.043] (-2418.321) (-2421.238) (-2421.738) * [-2421.909] (-2425.646) (-2415.749) (-2416.067) -- 0:02:35 104000 -- (-2417.840) (-2416.483) [-2417.358] (-2422.944) * [-2420.187] (-2412.218) (-2420.547) (-2419.171) -- 0:02:35 104500 -- [-2415.511] (-2418.955) (-2421.418) (-2419.432) * (-2420.691) (-2417.483) (-2422.219) [-2417.034] -- 0:02:34 105000 -- (-2419.343) (-2418.018) [-2414.977] (-2416.489) * [-2420.018] (-2416.700) (-2422.974) (-2426.143) -- 0:02:33 Average standard deviation of split frequencies: 0.021347 105500 -- (-2414.576) (-2423.156) (-2419.871) [-2420.687] * [-2419.319] (-2417.586) (-2411.051) (-2418.673) -- 0:02:32 106000 -- (-2412.435) (-2417.567) [-2417.269] (-2420.375) * [-2417.643] (-2420.747) (-2413.007) (-2423.931) -- 0:02:31 106500 -- [-2414.737] (-2422.546) (-2414.131) (-2421.531) * (-2419.698) (-2422.068) [-2412.866] (-2425.470) -- 0:02:31 107000 -- [-2412.365] (-2416.067) (-2412.789) (-2427.697) * (-2419.594) (-2430.115) (-2420.042) [-2419.185] -- 0:02:30 107500 -- [-2418.043] (-2417.283) (-2414.545) (-2426.474) * (-2418.024) (-2424.667) (-2420.732) [-2415.332] -- 0:02:29 108000 -- (-2415.014) (-2414.738) [-2419.260] (-2419.316) * (-2419.416) (-2429.149) [-2415.106] (-2417.392) -- 0:02:28 108500 -- (-2416.228) [-2414.262] (-2421.860) (-2422.766) * [-2418.119] (-2429.595) (-2422.007) (-2424.979) -- 0:02:27 109000 -- [-2416.335] (-2418.792) (-2419.249) (-2415.503) * (-2418.329) (-2418.919) [-2416.531] (-2416.294) -- 0:02:35 109500 -- (-2422.875) (-2418.757) (-2422.103) [-2409.869] * (-2422.893) (-2417.781) (-2416.807) [-2423.079] -- 0:02:34 110000 -- [-2425.874] (-2419.629) (-2422.764) (-2417.702) * (-2421.018) (-2420.757) (-2417.401) [-2416.963] -- 0:02:33 Average standard deviation of split frequencies: 0.023002 110500 -- (-2422.421) [-2418.464] (-2420.889) (-2417.400) * (-2423.019) [-2419.399] (-2415.683) (-2417.171) -- 0:02:32 111000 -- [-2418.636] (-2417.511) (-2430.656) (-2416.239) * (-2423.954) (-2420.402) [-2415.208] (-2421.476) -- 0:02:32 111500 -- (-2414.611) (-2421.014) (-2424.014) [-2412.088] * [-2420.223] (-2413.579) (-2423.649) (-2422.207) -- 0:02:31 112000 -- [-2412.187] (-2414.976) (-2424.820) (-2416.720) * (-2420.787) (-2416.352) (-2421.989) [-2422.059] -- 0:02:30 112500 -- [-2413.810] (-2419.631) (-2427.336) (-2421.623) * (-2430.158) [-2417.518] (-2421.962) (-2417.689) -- 0:02:29 113000 -- [-2412.732] (-2418.348) (-2423.824) (-2414.910) * (-2424.076) (-2422.560) (-2417.402) [-2422.626] -- 0:02:29 113500 -- (-2415.879) (-2416.809) (-2420.370) [-2415.153] * [-2420.340] (-2421.043) (-2421.660) (-2425.336) -- 0:02:28 114000 -- (-2414.472) (-2419.328) (-2419.960) [-2424.736] * (-2419.135) (-2413.452) (-2413.815) [-2423.343] -- 0:02:27 114500 -- (-2422.472) (-2423.261) (-2419.329) [-2419.310] * [-2416.372] (-2419.730) (-2423.339) (-2417.900) -- 0:02:26 115000 -- (-2424.995) (-2427.869) (-2423.180) [-2411.173] * [-2414.651] (-2420.125) (-2422.803) (-2417.163) -- 0:02:33 Average standard deviation of split frequencies: 0.020319 115500 -- (-2429.851) [-2422.321] (-2423.657) (-2419.329) * [-2413.104] (-2415.697) (-2422.805) (-2421.870) -- 0:02:33 116000 -- (-2416.529) (-2415.248) [-2427.141] (-2422.775) * [-2418.536] (-2416.428) (-2418.250) (-2424.013) -- 0:02:32 116500 -- [-2419.672] (-2417.600) (-2418.906) (-2427.275) * (-2421.397) [-2417.446] (-2414.668) (-2413.671) -- 0:02:31 117000 -- (-2412.319) [-2422.032] (-2426.870) (-2428.617) * (-2420.211) (-2418.563) [-2413.843] (-2418.010) -- 0:02:30 117500 -- (-2419.571) [-2420.635] (-2414.388) (-2419.388) * (-2417.289) [-2418.836] (-2416.132) (-2422.494) -- 0:02:30 118000 -- [-2417.329] (-2417.044) (-2423.636) (-2423.510) * (-2424.824) (-2430.126) [-2418.263] (-2419.381) -- 0:02:29 118500 -- [-2417.981] (-2424.407) (-2421.966) (-2417.751) * (-2415.802) (-2427.128) [-2415.616] (-2419.374) -- 0:02:28 119000 -- (-2422.603) [-2420.104] (-2420.493) (-2417.617) * (-2421.581) (-2421.264) [-2417.666] (-2426.086) -- 0:02:28 119500 -- (-2423.770) [-2417.733] (-2425.355) (-2417.447) * (-2416.755) (-2418.773) [-2419.501] (-2417.661) -- 0:02:27 120000 -- [-2416.507] (-2428.987) (-2416.105) (-2422.692) * (-2424.379) (-2420.490) (-2418.501) [-2419.065] -- 0:02:26 Average standard deviation of split frequencies: 0.017580 120500 -- [-2417.568] (-2424.924) (-2419.501) (-2415.137) * (-2423.625) (-2414.653) [-2416.116] (-2411.848) -- 0:02:25 121000 -- (-2420.986) [-2420.392] (-2424.884) (-2416.595) * [-2416.679] (-2414.004) (-2418.608) (-2419.892) -- 0:02:25 121500 -- (-2418.016) (-2422.582) (-2418.398) [-2417.366] * (-2416.346) (-2418.130) (-2424.770) [-2418.593] -- 0:02:31 122000 -- (-2421.881) (-2410.935) (-2417.207) [-2426.614] * [-2427.364] (-2417.515) (-2424.391) (-2414.664) -- 0:02:31 122500 -- (-2422.216) [-2413.128] (-2422.763) (-2416.874) * [-2418.072] (-2426.823) (-2419.989) (-2419.399) -- 0:02:30 123000 -- (-2422.027) [-2421.291] (-2419.485) (-2418.297) * (-2415.955) (-2425.428) (-2417.315) [-2416.410] -- 0:02:29 123500 -- (-2417.368) (-2423.856) (-2425.745) [-2415.087] * (-2420.074) [-2418.022] (-2415.747) (-2418.170) -- 0:02:29 124000 -- (-2411.535) (-2430.045) (-2420.699) [-2422.871] * (-2419.773) (-2426.950) (-2424.991) [-2419.952] -- 0:02:28 124500 -- (-2414.299) [-2415.213] (-2422.727) (-2425.538) * (-2415.483) [-2414.557] (-2420.213) (-2421.064) -- 0:02:27 125000 -- (-2416.995) [-2418.531] (-2422.883) (-2419.368) * (-2413.354) [-2415.392] (-2422.894) (-2415.168) -- 0:02:27 Average standard deviation of split frequencies: 0.014965 125500 -- (-2420.424) (-2420.588) (-2423.267) [-2416.224] * (-2414.174) (-2427.637) (-2416.850) [-2413.745] -- 0:02:26 126000 -- [-2413.957] (-2419.099) (-2414.877) (-2421.925) * (-2412.451) (-2419.675) (-2418.049) [-2419.719] -- 0:02:25 126500 -- (-2418.304) (-2417.937) [-2414.908] (-2414.031) * [-2411.752] (-2420.630) (-2426.196) (-2419.733) -- 0:02:25 127000 -- [-2417.317] (-2422.849) (-2420.134) (-2415.603) * (-2418.498) (-2418.659) (-2427.012) [-2415.729] -- 0:02:24 127500 -- (-2420.855) (-2418.307) (-2425.871) [-2415.462] * [-2417.728] (-2422.324) (-2420.142) (-2416.258) -- 0:02:30 128000 -- (-2422.395) [-2418.522] (-2420.759) (-2430.724) * (-2412.734) [-2425.309] (-2423.861) (-2429.995) -- 0:02:29 128500 -- [-2419.077] (-2419.392) (-2421.083) (-2422.043) * (-2417.372) (-2417.686) [-2422.144] (-2419.822) -- 0:02:29 129000 -- (-2421.818) (-2426.566) (-2428.404) [-2425.077] * [-2419.384] (-2417.310) (-2415.570) (-2419.494) -- 0:02:28 129500 -- [-2422.798] (-2414.216) (-2422.205) (-2423.046) * (-2416.183) (-2419.539) [-2415.586] (-2420.160) -- 0:02:27 130000 -- (-2423.005) (-2422.444) [-2418.567] (-2426.612) * (-2418.175) (-2426.927) [-2420.048] (-2425.407) -- 0:02:27 Average standard deviation of split frequencies: 0.015333 130500 -- (-2431.360) [-2420.906] (-2419.653) (-2419.820) * (-2418.602) (-2420.820) [-2423.566] (-2416.648) -- 0:02:26 131000 -- (-2420.662) (-2418.329) (-2422.653) [-2414.858] * (-2416.288) (-2423.840) [-2417.394] (-2416.939) -- 0:02:25 131500 -- (-2415.874) (-2413.810) (-2429.618) [-2418.360] * [-2415.747] (-2415.379) (-2417.206) (-2428.900) -- 0:02:25 132000 -- (-2421.757) (-2417.620) (-2421.235) [-2417.037] * (-2421.612) [-2418.540] (-2415.298) (-2416.918) -- 0:02:24 132500 -- (-2423.217) (-2431.117) [-2412.339] (-2416.958) * (-2423.705) [-2415.316] (-2427.537) (-2415.463) -- 0:02:24 133000 -- [-2424.401] (-2417.380) (-2417.837) (-2422.385) * (-2422.113) (-2416.809) (-2414.977) [-2418.592] -- 0:02:23 133500 -- (-2414.444) [-2412.341] (-2416.864) (-2415.972) * (-2422.477) (-2424.627) [-2419.730] (-2417.357) -- 0:02:29 134000 -- (-2431.400) (-2420.732) [-2419.801] (-2420.295) * [-2414.164] (-2419.767) (-2416.362) (-2417.684) -- 0:02:28 134500 -- (-2419.476) (-2424.189) (-2410.703) [-2418.384] * (-2422.942) (-2420.413) [-2419.223] (-2418.521) -- 0:02:28 135000 -- (-2425.096) [-2417.809] (-2421.629) (-2415.779) * (-2417.070) [-2412.751] (-2418.692) (-2415.545) -- 0:02:27 Average standard deviation of split frequencies: 0.018198 135500 -- [-2421.299] (-2420.455) (-2418.736) (-2418.977) * (-2419.725) (-2415.619) (-2420.349) [-2417.034] -- 0:02:26 136000 -- (-2420.449) [-2414.643] (-2417.615) (-2416.673) * [-2415.379] (-2426.682) (-2425.190) (-2419.352) -- 0:02:26 136500 -- [-2417.881] (-2422.063) (-2413.981) (-2412.162) * (-2424.749) (-2428.902) (-2418.779) [-2421.181] -- 0:02:25 137000 -- [-2414.762] (-2423.624) (-2423.102) (-2413.797) * (-2417.232) (-2419.382) (-2418.996) [-2423.708] -- 0:02:24 137500 -- (-2420.954) (-2419.444) [-2420.096] (-2421.190) * [-2420.024] (-2418.319) (-2417.593) (-2415.524) -- 0:02:24 138000 -- [-2416.187] (-2422.863) (-2418.112) (-2426.633) * (-2422.150) (-2423.195) (-2414.679) [-2420.945] -- 0:02:23 138500 -- (-2421.560) (-2424.205) [-2413.960] (-2423.084) * [-2412.722] (-2421.723) (-2415.175) (-2418.751) -- 0:02:23 139000 -- (-2422.607) [-2413.875] (-2421.522) (-2418.083) * (-2416.581) (-2428.209) [-2413.304] (-2419.954) -- 0:02:22 139500 -- (-2413.453) [-2417.036] (-2418.062) (-2422.046) * (-2417.165) [-2414.901] (-2416.804) (-2418.824) -- 0:02:21 140000 -- (-2420.889) (-2423.596) (-2413.398) [-2419.338] * [-2423.254] (-2419.634) (-2417.385) (-2412.791) -- 0:02:27 Average standard deviation of split frequencies: 0.021783 140500 -- (-2422.348) (-2423.975) (-2422.856) [-2420.101] * [-2419.269] (-2415.701) (-2416.512) (-2420.574) -- 0:02:26 141000 -- (-2420.264) [-2423.053] (-2416.363) (-2420.778) * (-2420.924) [-2414.966] (-2421.752) (-2420.589) -- 0:02:26 141500 -- (-2421.366) (-2419.970) (-2417.819) [-2417.119] * [-2414.885] (-2419.424) (-2415.621) (-2418.607) -- 0:02:25 142000 -- (-2422.887) (-2423.227) [-2419.700] (-2420.744) * [-2415.917] (-2415.592) (-2413.797) (-2417.986) -- 0:02:25 142500 -- [-2421.021] (-2424.380) (-2421.661) (-2426.467) * (-2416.054) [-2418.481] (-2417.735) (-2420.024) -- 0:02:24 143000 -- (-2422.298) (-2425.615) [-2413.137] (-2415.758) * (-2422.718) (-2426.045) (-2424.812) [-2420.784] -- 0:02:23 143500 -- (-2421.394) (-2418.904) [-2418.019] (-2416.257) * (-2417.529) [-2417.304] (-2421.956) (-2422.101) -- 0:02:23 144000 -- (-2425.211) (-2418.052) [-2412.604] (-2415.980) * (-2422.749) (-2418.948) [-2417.462] (-2420.756) -- 0:02:22 144500 -- (-2423.687) (-2418.315) [-2415.347] (-2419.369) * (-2418.358) (-2418.574) (-2414.193) [-2415.861] -- 0:02:22 145000 -- (-2416.678) [-2419.649] (-2414.772) (-2426.310) * (-2420.832) (-2415.101) (-2413.312) [-2419.218] -- 0:02:21 Average standard deviation of split frequencies: 0.016144 145500 -- (-2418.773) (-2415.558) [-2414.060] (-2422.134) * (-2422.974) (-2418.221) (-2421.800) [-2416.088] -- 0:02:20 146000 -- (-2423.254) (-2426.200) [-2417.140] (-2416.054) * (-2422.897) (-2423.348) (-2425.382) [-2415.309] -- 0:02:26 146500 -- (-2418.766) [-2417.214] (-2418.022) (-2423.844) * (-2429.419) (-2421.598) [-2417.437] (-2416.528) -- 0:02:25 147000 -- (-2423.256) [-2413.017] (-2414.952) (-2418.578) * (-2417.255) (-2414.367) [-2414.585] (-2415.997) -- 0:02:25 147500 -- (-2424.514) (-2425.520) (-2421.669) [-2422.476] * (-2414.574) (-2415.590) [-2421.457] (-2415.551) -- 0:02:24 148000 -- (-2415.475) (-2427.329) (-2423.802) [-2415.133] * (-2417.202) (-2418.926) [-2415.821] (-2413.912) -- 0:02:23 148500 -- (-2420.119) (-2415.733) [-2421.896] (-2415.509) * (-2418.048) [-2419.999] (-2418.676) (-2417.825) -- 0:02:23 149000 -- [-2412.658] (-2426.520) (-2418.622) (-2420.801) * [-2420.109] (-2421.946) (-2422.827) (-2425.561) -- 0:02:22 149500 -- (-2421.930) (-2424.180) (-2415.494) [-2415.611] * [-2415.546] (-2423.734) (-2421.356) (-2417.762) -- 0:02:22 150000 -- (-2415.501) (-2432.837) [-2420.400] (-2421.942) * (-2425.540) (-2411.235) [-2418.332] (-2421.021) -- 0:02:21 Average standard deviation of split frequencies: 0.013297 150500 -- (-2429.154) [-2417.332] (-2421.836) (-2418.869) * (-2419.389) (-2419.768) (-2422.445) [-2412.873] -- 0:02:21 151000 -- (-2415.806) (-2431.379) (-2421.601) [-2420.875] * [-2415.655] (-2420.864) (-2429.868) (-2418.889) -- 0:02:20 151500 -- [-2416.016] (-2419.182) (-2425.091) (-2416.866) * (-2421.076) (-2423.326) (-2415.445) [-2421.278] -- 0:02:20 152000 -- (-2417.773) (-2421.306) (-2426.102) [-2412.167] * (-2417.654) (-2420.737) (-2413.543) [-2417.637] -- 0:02:25 152500 -- (-2427.239) (-2414.877) (-2417.731) [-2417.139] * (-2424.423) (-2415.693) [-2416.244] (-2414.630) -- 0:02:24 153000 -- (-2424.070) (-2416.628) [-2419.812] (-2420.564) * (-2416.045) (-2421.179) [-2420.619] (-2417.999) -- 0:02:23 153500 -- (-2418.701) (-2421.496) [-2426.968] (-2422.471) * (-2413.346) (-2419.800) [-2414.903] (-2418.789) -- 0:02:23 154000 -- [-2417.836] (-2422.215) (-2424.916) (-2414.517) * (-2420.609) [-2416.227] (-2416.670) (-2425.956) -- 0:02:22 154500 -- (-2426.063) (-2417.090) (-2415.235) [-2422.883] * (-2420.999) (-2413.971) [-2416.019] (-2412.994) -- 0:02:22 155000 -- (-2421.545) (-2423.093) (-2411.389) [-2411.692] * (-2416.763) (-2424.373) [-2416.551] (-2418.468) -- 0:02:21 Average standard deviation of split frequencies: 0.013598 155500 -- (-2419.902) (-2434.610) [-2416.386] (-2419.450) * (-2420.623) (-2423.661) (-2412.473) [-2421.926] -- 0:02:21 156000 -- [-2423.034] (-2418.894) (-2417.862) (-2415.560) * (-2419.351) (-2426.598) (-2415.480) [-2418.912] -- 0:02:20 156500 -- (-2423.628) [-2418.532] (-2420.016) (-2427.516) * (-2416.904) (-2420.218) [-2417.461] (-2415.201) -- 0:02:20 157000 -- (-2422.929) [-2419.071] (-2418.999) (-2417.207) * (-2421.645) [-2423.571] (-2425.475) (-2413.819) -- 0:02:19 157500 -- [-2419.762] (-2422.900) (-2422.696) (-2416.718) * (-2421.802) (-2415.246) [-2415.387] (-2417.812) -- 0:02:19 158000 -- [-2421.449] (-2419.925) (-2417.246) (-2417.091) * (-2418.635) [-2414.741] (-2421.938) (-2419.420) -- 0:02:23 158500 -- (-2427.082) (-2423.111) [-2415.275] (-2421.406) * (-2420.930) (-2418.367) (-2419.734) [-2414.698] -- 0:02:23 159000 -- (-2420.365) [-2417.721] (-2418.807) (-2414.753) * (-2417.788) (-2428.090) (-2419.083) [-2415.762] -- 0:02:22 159500 -- (-2419.393) [-2417.070] (-2425.706) (-2421.752) * (-2421.346) (-2419.973) (-2424.047) [-2416.676] -- 0:02:22 160000 -- [-2415.720] (-2416.307) (-2420.596) (-2417.184) * (-2412.081) (-2423.082) [-2413.376] (-2417.848) -- 0:02:21 Average standard deviation of split frequencies: 0.010269 160500 -- (-2415.146) (-2421.968) [-2413.096] (-2418.818) * (-2413.839) (-2424.380) [-2420.086] (-2415.922) -- 0:02:21 161000 -- (-2416.559) [-2417.465] (-2420.121) (-2418.074) * (-2426.223) (-2420.599) [-2416.733] (-2416.495) -- 0:02:20 161500 -- (-2412.849) [-2415.072] (-2419.152) (-2417.322) * (-2421.622) [-2415.396] (-2413.431) (-2419.229) -- 0:02:20 162000 -- (-2415.170) (-2426.718) [-2414.486] (-2426.686) * (-2417.543) [-2418.552] (-2426.071) (-2418.139) -- 0:02:19 162500 -- [-2420.006] (-2427.934) (-2416.934) (-2421.282) * (-2424.084) [-2421.094] (-2414.233) (-2415.576) -- 0:02:19 163000 -- (-2423.162) [-2418.164] (-2425.172) (-2424.707) * (-2420.273) [-2422.373] (-2420.892) (-2413.127) -- 0:02:18 163500 -- (-2412.118) (-2424.548) [-2424.219] (-2419.630) * [-2424.589] (-2422.644) (-2421.883) (-2414.773) -- 0:02:18 164000 -- (-2421.229) (-2421.126) [-2419.104] (-2420.966) * (-2418.179) [-2423.377] (-2416.722) (-2418.795) -- 0:02:22 164500 -- (-2425.696) [-2418.961] (-2416.383) (-2415.703) * (-2419.039) (-2418.294) [-2414.518] (-2415.194) -- 0:02:22 165000 -- [-2415.829] (-2421.301) (-2416.905) (-2416.532) * (-2420.097) [-2417.659] (-2422.609) (-2415.164) -- 0:02:21 Average standard deviation of split frequencies: 0.014199 165500 -- [-2411.788] (-2425.949) (-2414.347) (-2420.747) * [-2416.524] (-2420.058) (-2414.237) (-2416.311) -- 0:02:21 166000 -- (-2413.292) (-2417.584) (-2415.528) [-2413.823] * (-2422.965) (-2424.052) (-2422.140) [-2418.508] -- 0:02:20 166500 -- [-2415.488] (-2421.910) (-2416.448) (-2417.314) * (-2420.675) (-2411.232) [-2416.348] (-2415.020) -- 0:02:20 167000 -- [-2420.170] (-2425.441) (-2418.946) (-2416.317) * (-2417.449) (-2420.171) (-2430.786) [-2415.393] -- 0:02:19 167500 -- (-2422.040) (-2416.744) (-2425.765) [-2419.427] * (-2413.910) (-2415.939) (-2418.096) [-2418.700] -- 0:02:19 168000 -- [-2420.221] (-2423.773) (-2418.341) (-2416.853) * (-2415.174) (-2418.567) [-2416.403] (-2418.662) -- 0:02:18 168500 -- [-2416.554] (-2418.644) (-2421.109) (-2418.945) * (-2425.600) (-2421.463) [-2420.882] (-2414.916) -- 0:02:18 169000 -- (-2420.988) (-2419.716) [-2422.917] (-2416.941) * (-2420.215) (-2414.846) [-2418.011] (-2416.824) -- 0:02:17 169500 -- (-2411.217) (-2425.372) (-2420.902) [-2412.821] * (-2417.954) [-2418.833] (-2415.791) (-2412.769) -- 0:02:17 170000 -- (-2416.392) (-2418.202) [-2419.673] (-2418.166) * (-2412.927) (-2420.428) (-2412.682) [-2424.323] -- 0:02:21 Average standard deviation of split frequencies: 0.010496 170500 -- (-2415.443) (-2418.632) [-2414.322] (-2420.538) * (-2423.958) (-2418.860) (-2422.404) [-2415.211] -- 0:02:21 171000 -- (-2414.131) (-2415.810) [-2421.703] (-2414.558) * (-2421.771) (-2422.274) (-2423.260) [-2418.912] -- 0:02:20 171500 -- (-2424.482) (-2414.237) [-2414.722] (-2418.158) * (-2417.408) (-2422.679) (-2424.326) [-2422.888] -- 0:02:20 172000 -- (-2420.061) (-2419.505) [-2418.357] (-2420.540) * [-2420.965] (-2416.069) (-2416.943) (-2419.644) -- 0:02:19 172500 -- (-2426.350) [-2421.335] (-2420.403) (-2417.617) * (-2422.788) (-2417.626) [-2416.821] (-2419.159) -- 0:02:19 173000 -- (-2421.383) [-2414.123] (-2418.478) (-2415.444) * [-2415.438] (-2419.403) (-2423.484) (-2423.272) -- 0:02:18 173500 -- [-2417.142] (-2417.857) (-2421.550) (-2422.483) * [-2411.520] (-2421.985) (-2426.774) (-2418.687) -- 0:02:18 174000 -- (-2415.319) (-2420.824) (-2428.270) [-2414.153] * [-2412.887] (-2412.370) (-2422.896) (-2420.012) -- 0:02:17 174500 -- (-2418.653) (-2423.689) [-2416.984] (-2418.061) * [-2413.871] (-2420.260) (-2415.766) (-2421.472) -- 0:02:17 175000 -- (-2415.412) (-2422.440) [-2421.159] (-2423.616) * [-2412.910] (-2413.922) (-2423.828) (-2419.735) -- 0:02:16 Average standard deviation of split frequencies: 0.008035 175500 -- (-2418.887) (-2426.263) [-2425.533] (-2415.687) * [-2420.119] (-2414.698) (-2422.389) (-2417.578) -- 0:02:16 176000 -- [-2417.603] (-2421.609) (-2428.252) (-2418.041) * [-2418.018] (-2422.221) (-2424.305) (-2424.334) -- 0:02:20 176500 -- (-2414.533) [-2420.815] (-2417.392) (-2420.489) * [-2412.925] (-2417.660) (-2423.709) (-2417.571) -- 0:02:19 177000 -- (-2421.972) (-2418.406) (-2423.777) [-2422.680] * (-2415.687) [-2416.404] (-2425.532) (-2427.005) -- 0:02:19 177500 -- (-2423.422) (-2418.431) [-2421.128] (-2422.968) * [-2416.476] (-2419.293) (-2422.868) (-2418.047) -- 0:02:19 178000 -- (-2421.282) (-2417.327) [-2421.871] (-2419.535) * (-2418.886) [-2417.779] (-2423.241) (-2415.844) -- 0:02:18 178500 -- (-2415.955) (-2422.115) (-2419.568) [-2418.265] * (-2420.273) [-2419.972] (-2420.174) (-2421.492) -- 0:02:18 179000 -- [-2411.793] (-2418.496) (-2426.064) (-2427.752) * (-2417.685) [-2420.625] (-2423.236) (-2413.887) -- 0:02:17 179500 -- [-2413.625] (-2412.003) (-2413.798) (-2425.312) * (-2428.161) (-2420.125) (-2417.930) [-2414.998] -- 0:02:17 180000 -- (-2419.133) [-2416.995] (-2421.892) (-2419.779) * (-2419.285) [-2412.834] (-2427.030) (-2415.856) -- 0:02:16 Average standard deviation of split frequencies: 0.009132 180500 -- (-2416.681) (-2409.770) (-2423.331) [-2423.093] * (-2424.107) (-2414.991) [-2419.476] (-2421.256) -- 0:02:16 181000 -- (-2426.304) [-2418.606] (-2428.979) (-2423.027) * (-2419.479) [-2414.604] (-2421.373) (-2417.809) -- 0:02:15 181500 -- (-2413.960) [-2418.037] (-2427.548) (-2426.830) * [-2414.939] (-2417.794) (-2421.154) (-2425.232) -- 0:02:15 182000 -- (-2417.577) (-2419.983) [-2416.975] (-2421.036) * (-2421.491) (-2420.763) [-2416.856] (-2432.389) -- 0:02:19 182500 -- [-2415.199] (-2419.924) (-2414.919) (-2419.538) * (-2415.648) (-2423.657) [-2422.085] (-2427.976) -- 0:02:18 183000 -- [-2418.217] (-2428.045) (-2417.355) (-2415.027) * [-2414.427] (-2411.745) (-2420.584) (-2413.439) -- 0:02:18 183500 -- (-2422.709) [-2415.463] (-2429.957) (-2416.496) * [-2420.884] (-2415.079) (-2430.875) (-2414.304) -- 0:02:17 184000 -- (-2425.167) (-2428.123) (-2412.725) [-2416.976] * [-2418.336] (-2420.675) (-2416.807) (-2416.189) -- 0:02:17 184500 -- [-2416.103] (-2422.970) (-2429.387) (-2413.882) * (-2424.318) [-2413.667] (-2424.117) (-2420.020) -- 0:02:17 185000 -- (-2418.598) (-2421.306) (-2422.410) [-2411.387] * (-2421.843) (-2417.489) [-2417.831] (-2422.948) -- 0:02:16 Average standard deviation of split frequencies: 0.014700 185500 -- (-2415.167) (-2418.296) (-2413.234) [-2418.015] * [-2419.075] (-2417.692) (-2415.692) (-2422.731) -- 0:02:16 186000 -- [-2419.729] (-2424.522) (-2419.197) (-2421.654) * [-2421.043] (-2422.255) (-2419.972) (-2414.630) -- 0:02:15 186500 -- (-2420.293) (-2411.246) (-2427.809) [-2416.192] * (-2420.852) [-2420.140] (-2416.410) (-2420.711) -- 0:02:15 187000 -- (-2419.269) (-2420.199) [-2419.996] (-2419.551) * (-2429.587) [-2415.502] (-2428.620) (-2418.813) -- 0:02:14 187500 -- [-2424.645] (-2422.063) (-2424.608) (-2429.614) * (-2420.789) (-2415.253) (-2413.815) [-2420.114] -- 0:02:14 188000 -- (-2418.600) (-2418.851) (-2427.135) [-2424.470] * (-2419.173) [-2416.563] (-2416.639) (-2418.981) -- 0:02:18 188500 -- (-2419.390) (-2417.704) [-2417.672] (-2423.186) * (-2425.871) (-2415.152) (-2412.889) [-2423.085] -- 0:02:17 189000 -- (-2418.605) (-2421.907) [-2418.852] (-2420.255) * (-2427.382) (-2423.199) (-2422.205) [-2424.521] -- 0:02:17 189500 -- (-2420.114) [-2412.849] (-2420.847) (-2423.209) * [-2425.519] (-2418.463) (-2418.685) (-2427.853) -- 0:02:16 190000 -- (-2424.653) (-2414.274) [-2424.138] (-2418.905) * (-2420.860) [-2418.558] (-2420.917) (-2431.850) -- 0:02:16 Average standard deviation of split frequencies: 0.010384 190500 -- [-2416.760] (-2416.015) (-2419.245) (-2419.593) * [-2417.376] (-2413.463) (-2416.240) (-2422.591) -- 0:02:15 191000 -- (-2416.103) (-2412.611) [-2416.179] (-2418.553) * [-2423.163] (-2421.802) (-2416.448) (-2433.006) -- 0:02:15 191500 -- (-2418.318) [-2417.463] (-2417.857) (-2423.088) * (-2431.177) [-2422.175] (-2418.964) (-2413.561) -- 0:02:15 192000 -- (-2415.667) [-2412.659] (-2417.150) (-2423.451) * [-2422.420] (-2422.021) (-2423.860) (-2417.905) -- 0:02:14 192500 -- (-2418.159) [-2413.386] (-2417.214) (-2425.145) * (-2424.922) (-2417.062) (-2417.562) [-2413.436] -- 0:02:14 193000 -- (-2415.881) [-2418.002] (-2423.381) (-2427.801) * (-2429.109) (-2414.315) (-2426.514) [-2420.612] -- 0:02:13 193500 -- (-2423.662) (-2421.284) [-2416.376] (-2421.633) * (-2433.010) (-2420.207) [-2420.129] (-2417.074) -- 0:02:13 194000 -- (-2429.139) [-2420.911] (-2422.958) (-2428.249) * (-2431.529) [-2416.758] (-2416.746) (-2416.109) -- 0:02:12 194500 -- (-2418.687) [-2421.853] (-2419.765) (-2427.401) * (-2422.213) (-2422.157) [-2416.580] (-2427.620) -- 0:02:16 195000 -- (-2421.291) (-2418.407) [-2417.930] (-2419.097) * [-2416.118] (-2424.257) (-2422.693) (-2428.192) -- 0:02:16 Average standard deviation of split frequencies: 0.006013 195500 -- (-2420.105) [-2421.610] (-2415.164) (-2421.069) * (-2420.805) (-2416.045) [-2415.449] (-2418.911) -- 0:02:15 196000 -- (-2417.694) (-2420.551) [-2414.346] (-2421.087) * (-2424.115) [-2420.511] (-2419.445) (-2417.418) -- 0:02:15 196500 -- (-2421.706) (-2415.767) [-2421.740] (-2423.354) * (-2425.203) [-2424.947] (-2415.418) (-2421.065) -- 0:02:14 197000 -- (-2416.063) (-2416.501) [-2414.373] (-2422.244) * (-2422.172) (-2421.036) (-2417.866) [-2419.906] -- 0:02:14 197500 -- (-2422.675) (-2420.039) [-2415.917] (-2423.191) * [-2422.077] (-2425.452) (-2417.120) (-2411.333) -- 0:02:14 198000 -- (-2418.613) [-2414.085] (-2424.115) (-2424.375) * (-2418.475) (-2424.508) (-2415.945) [-2416.701] -- 0:02:13 198500 -- (-2433.310) (-2417.468) [-2416.823] (-2423.757) * (-2415.329) (-2416.725) [-2414.401] (-2419.898) -- 0:02:13 199000 -- (-2426.493) (-2423.422) (-2418.901) [-2418.357] * (-2424.350) [-2412.686] (-2418.172) (-2425.091) -- 0:02:12 199500 -- (-2419.930) [-2419.217] (-2419.898) (-2420.645) * (-2416.358) (-2418.916) (-2419.626) [-2415.892] -- 0:02:12 200000 -- [-2416.305] (-2421.304) (-2418.472) (-2413.890) * [-2417.698] (-2414.268) (-2417.694) (-2423.669) -- 0:02:12 Average standard deviation of split frequencies: 0.003524 200500 -- (-2413.513) [-2419.861] (-2424.191) (-2424.370) * (-2422.881) (-2413.596) [-2419.265] (-2420.389) -- 0:02:15 201000 -- (-2414.546) (-2421.759) (-2412.880) [-2417.519] * (-2416.381) [-2414.075] (-2421.455) (-2427.530) -- 0:02:15 201500 -- (-2418.071) (-2420.473) (-2420.870) [-2421.819] * (-2419.249) [-2416.013] (-2419.906) (-2417.435) -- 0:02:14 202000 -- (-2416.588) (-2417.050) (-2414.381) [-2420.867] * (-2417.161) [-2416.899] (-2419.475) (-2419.428) -- 0:02:14 202500 -- (-2412.818) [-2425.816] (-2417.837) (-2424.017) * (-2421.811) (-2421.383) (-2419.274) [-2415.352] -- 0:02:13 203000 -- [-2416.608] (-2420.715) (-2422.160) (-2415.632) * (-2426.468) (-2416.094) [-2414.532] (-2426.727) -- 0:02:13 203500 -- [-2411.608] (-2422.572) (-2416.693) (-2417.801) * [-2417.881] (-2418.805) (-2417.939) (-2424.374) -- 0:02:13 204000 -- (-2419.589) [-2422.011] (-2416.477) (-2422.979) * (-2412.479) (-2426.465) [-2417.600] (-2423.599) -- 0:02:12 204500 -- (-2423.814) [-2421.937] (-2419.815) (-2423.610) * (-2420.889) (-2423.466) [-2414.376] (-2416.837) -- 0:02:12 205000 -- [-2414.647] (-2420.809) (-2415.710) (-2414.578) * (-2419.189) (-2421.361) (-2424.124) [-2418.490] -- 0:02:11 Average standard deviation of split frequencies: 0.005721 205500 -- (-2419.429) [-2414.632] (-2416.253) (-2419.905) * (-2415.239) (-2417.805) [-2414.613] (-2410.570) -- 0:02:11 206000 -- [-2423.084] (-2421.904) (-2420.273) (-2419.029) * (-2414.358) (-2418.418) [-2420.050] (-2419.368) -- 0:02:11 206500 -- (-2421.276) [-2416.285] (-2409.517) (-2425.937) * (-2412.134) [-2416.851] (-2419.071) (-2419.811) -- 0:02:14 207000 -- (-2417.958) (-2412.595) (-2417.931) [-2420.840] * (-2413.057) (-2425.400) (-2421.987) [-2419.190] -- 0:02:14 207500 -- (-2422.185) (-2419.480) (-2414.121) [-2419.414] * [-2418.357] (-2422.652) (-2418.416) (-2424.156) -- 0:02:13 208000 -- (-2422.378) (-2418.434) [-2426.660] (-2421.388) * [-2429.315] (-2426.617) (-2421.852) (-2421.450) -- 0:02:13 208500 -- (-2426.634) [-2419.062] (-2421.488) (-2412.834) * (-2425.701) (-2428.903) [-2415.141] (-2420.318) -- 0:02:12 209000 -- (-2424.132) (-2429.615) (-2422.381) [-2417.425] * (-2425.998) (-2424.236) [-2412.639] (-2420.198) -- 0:02:12 209500 -- (-2427.014) (-2428.819) (-2421.329) [-2418.350] * [-2420.289] (-2417.690) (-2416.790) (-2423.650) -- 0:02:12 210000 -- (-2429.100) (-2420.359) [-2416.353] (-2421.188) * (-2421.176) (-2429.245) (-2416.119) [-2416.454] -- 0:02:11 Average standard deviation of split frequencies: 0.007161 210500 -- (-2422.120) (-2412.508) (-2415.976) [-2417.383] * [-2415.408] (-2426.062) (-2415.319) (-2423.060) -- 0:02:11 211000 -- [-2414.635] (-2415.327) (-2424.424) (-2421.817) * (-2418.149) (-2417.773) [-2414.884] (-2425.954) -- 0:02:10 211500 -- (-2415.199) (-2419.326) [-2418.944] (-2419.799) * [-2417.764] (-2415.365) (-2421.943) (-2418.371) -- 0:02:10 212000 -- (-2414.965) (-2428.169) [-2420.997] (-2420.357) * (-2426.848) (-2421.253) (-2419.798) [-2418.559] -- 0:02:10 212500 -- [-2415.660] (-2423.374) (-2422.160) (-2415.933) * [-2415.091] (-2411.016) (-2419.456) (-2419.137) -- 0:02:13 213000 -- (-2419.397) (-2430.947) (-2419.265) [-2420.872] * (-2421.440) (-2417.558) (-2420.813) [-2411.526] -- 0:02:13 213500 -- (-2426.114) (-2424.640) (-2423.502) [-2422.845] * [-2415.612] (-2413.928) (-2417.912) (-2419.317) -- 0:02:12 214000 -- [-2423.680] (-2430.430) (-2412.992) (-2422.583) * (-2424.077) [-2415.995] (-2424.412) (-2411.963) -- 0:02:12 214500 -- (-2418.632) [-2420.899] (-2420.315) (-2421.626) * [-2418.217] (-2415.300) (-2419.549) (-2423.199) -- 0:02:11 215000 -- (-2420.165) (-2422.208) (-2420.101) [-2417.292] * [-2413.485] (-2424.782) (-2419.602) (-2426.564) -- 0:02:11 Average standard deviation of split frequencies: 0.008293 215500 -- (-2421.262) (-2428.021) (-2424.403) [-2418.329] * (-2418.184) (-2417.343) [-2418.581] (-2421.913) -- 0:02:11 216000 -- [-2421.025] (-2419.264) (-2422.187) (-2421.648) * (-2421.390) (-2420.043) (-2420.414) [-2419.463] -- 0:02:10 216500 -- (-2415.949) (-2425.588) (-2417.921) [-2423.850] * (-2422.541) (-2424.658) [-2417.637] (-2416.393) -- 0:02:10 217000 -- [-2415.638] (-2428.755) (-2422.174) (-2423.813) * [-2414.121] (-2428.036) (-2418.507) (-2415.110) -- 0:02:09 217500 -- [-2419.291] (-2426.415) (-2418.033) (-2418.745) * (-2414.397) (-2418.258) [-2418.716] (-2417.875) -- 0:02:09 218000 -- [-2416.633] (-2421.420) (-2428.828) (-2413.946) * (-2415.202) [-2419.884] (-2414.735) (-2419.183) -- 0:02:09 218500 -- [-2424.536] (-2420.157) (-2423.076) (-2418.933) * (-2413.391) (-2421.350) (-2416.228) [-2419.270] -- 0:02:12 219000 -- (-2422.437) (-2416.982) (-2426.725) [-2417.571] * [-2416.554] (-2417.107) (-2416.074) (-2422.249) -- 0:02:11 219500 -- (-2415.193) (-2424.473) (-2424.249) [-2414.171] * (-2431.192) (-2417.525) [-2417.374] (-2428.076) -- 0:02:11 220000 -- [-2418.546] (-2416.984) (-2420.624) (-2420.844) * (-2414.641) (-2422.876) [-2414.494] (-2430.929) -- 0:02:11 Average standard deviation of split frequencies: 0.006836 220500 -- (-2415.662) [-2423.119] (-2422.178) (-2421.358) * (-2422.362) [-2414.667] (-2415.334) (-2414.351) -- 0:02:10 221000 -- (-2417.876) [-2419.130] (-2417.123) (-2422.853) * (-2415.890) (-2425.187) (-2419.588) [-2414.112] -- 0:02:10 221500 -- (-2410.468) (-2422.702) [-2414.673] (-2415.740) * [-2410.124] (-2422.345) (-2417.827) (-2417.555) -- 0:02:10 222000 -- [-2413.915] (-2416.959) (-2423.867) (-2416.469) * [-2414.875] (-2419.953) (-2418.127) (-2423.661) -- 0:02:09 222500 -- (-2421.855) (-2412.820) [-2416.270] (-2422.585) * (-2415.427) (-2417.526) [-2415.492] (-2414.883) -- 0:02:09 223000 -- [-2425.204] (-2414.479) (-2418.747) (-2419.284) * (-2421.310) (-2424.853) (-2420.052) [-2416.434] -- 0:02:08 223500 -- (-2413.280) (-2421.605) [-2428.540] (-2418.235) * (-2423.194) (-2417.992) [-2417.056] (-2419.701) -- 0:02:08 224000 -- [-2416.419] (-2428.652) (-2417.194) (-2425.211) * [-2421.920] (-2422.949) (-2419.401) (-2422.736) -- 0:02:11 224500 -- [-2427.991] (-2423.401) (-2418.138) (-2424.126) * (-2422.839) (-2419.097) [-2420.047] (-2415.617) -- 0:02:11 225000 -- (-2415.539) (-2421.615) [-2412.172] (-2417.425) * (-2421.926) (-2420.615) [-2414.599] (-2417.505) -- 0:02:10 Average standard deviation of split frequencies: 0.005840 225500 -- (-2415.804) (-2417.902) (-2416.449) [-2413.323] * [-2413.344] (-2425.966) (-2418.285) (-2419.380) -- 0:02:10 226000 -- [-2418.398] (-2423.659) (-2422.694) (-2421.065) * [-2419.816] (-2426.171) (-2422.511) (-2420.581) -- 0:02:10 226500 -- (-2416.055) (-2418.543) [-2418.070] (-2420.032) * (-2418.582) (-2416.513) [-2421.934] (-2430.576) -- 0:02:09 227000 -- [-2416.506] (-2422.147) (-2417.624) (-2422.048) * [-2424.927] (-2420.850) (-2429.868) (-2425.597) -- 0:02:09 227500 -- [-2409.975] (-2418.575) (-2413.705) (-2419.465) * [-2415.020] (-2419.786) (-2420.230) (-2414.556) -- 0:02:09 228000 -- (-2421.112) [-2419.169] (-2427.195) (-2421.505) * (-2421.930) [-2417.029] (-2414.995) (-2423.834) -- 0:02:08 228500 -- (-2420.052) (-2422.611) (-2419.703) [-2416.647] * (-2427.454) (-2422.553) [-2412.805] (-2417.363) -- 0:02:08 229000 -- (-2414.913) [-2414.663] (-2420.455) (-2417.475) * (-2417.121) (-2425.474) (-2416.737) [-2416.398] -- 0:02:07 229500 -- [-2418.168] (-2419.044) (-2417.770) (-2416.959) * [-2418.012] (-2423.478) (-2414.880) (-2420.293) -- 0:02:07 230000 -- (-2418.430) (-2422.763) [-2413.023] (-2416.003) * (-2413.081) [-2416.861] (-2421.372) (-2424.806) -- 0:02:10 Average standard deviation of split frequencies: 0.004087 230500 -- [-2418.313] (-2423.019) (-2413.944) (-2420.693) * (-2418.502) (-2416.204) (-2418.587) [-2422.806] -- 0:02:10 231000 -- (-2420.190) [-2422.402] (-2416.244) (-2420.655) * (-2416.765) (-2417.515) (-2420.936) [-2417.062] -- 0:02:09 231500 -- (-2417.289) (-2420.040) (-2413.911) [-2417.749] * (-2421.035) (-2418.915) [-2418.182] (-2417.255) -- 0:02:09 232000 -- (-2424.269) (-2422.667) [-2415.105] (-2421.463) * (-2419.778) [-2416.075] (-2424.458) (-2420.592) -- 0:02:09 232500 -- (-2421.164) [-2417.774] (-2421.638) (-2420.594) * [-2415.047] (-2416.300) (-2420.808) (-2418.947) -- 0:02:08 233000 -- (-2414.207) (-2420.993) [-2416.523] (-2420.932) * (-2421.529) (-2420.365) (-2420.684) [-2417.601] -- 0:02:08 233500 -- (-2422.704) [-2417.370] (-2418.157) (-2419.810) * (-2420.833) [-2424.299] (-2417.293) (-2421.984) -- 0:02:08 234000 -- (-2418.711) [-2415.383] (-2427.928) (-2425.700) * [-2415.435] (-2421.893) (-2424.136) (-2417.975) -- 0:02:07 234500 -- (-2414.943) (-2414.667) [-2421.025] (-2421.377) * (-2425.406) (-2421.434) [-2415.497] (-2421.267) -- 0:02:07 235000 -- [-2418.491] (-2417.666) (-2426.675) (-2424.294) * (-2419.486) (-2423.145) (-2422.685) [-2416.559] -- 0:02:06 Average standard deviation of split frequencies: 0.005593 235500 -- (-2419.202) [-2417.386] (-2425.103) (-2426.213) * (-2415.040) (-2423.061) (-2420.472) [-2413.674] -- 0:02:06 236000 -- [-2414.198] (-2424.347) (-2416.838) (-2416.605) * (-2421.204) (-2424.470) (-2417.465) [-2410.258] -- 0:02:09 236500 -- [-2418.682] (-2411.491) (-2423.249) (-2423.287) * (-2414.884) (-2418.636) (-2419.943) [-2415.753] -- 0:02:09 237000 -- [-2411.566] (-2418.382) (-2413.693) (-2423.032) * (-2414.803) (-2423.609) [-2415.075] (-2420.932) -- 0:02:08 237500 -- (-2414.304) (-2412.813) [-2419.148] (-2428.086) * (-2421.219) [-2429.428] (-2418.443) (-2421.190) -- 0:02:08 238000 -- (-2419.870) (-2415.144) [-2419.546] (-2424.913) * (-2417.636) (-2426.631) [-2418.028] (-2419.669) -- 0:02:08 238500 -- (-2419.492) [-2419.088] (-2420.273) (-2432.325) * (-2421.205) [-2415.244] (-2412.276) (-2424.925) -- 0:02:07 239000 -- (-2418.792) [-2414.727] (-2415.977) (-2416.914) * (-2421.107) [-2424.521] (-2418.901) (-2422.741) -- 0:02:07 239500 -- (-2422.139) [-2417.909] (-2414.193) (-2429.122) * (-2416.890) (-2421.863) (-2420.560) [-2410.958] -- 0:02:07 240000 -- (-2423.093) [-2422.493] (-2416.629) (-2425.850) * [-2421.326] (-2423.498) (-2417.429) (-2417.478) -- 0:02:06 Average standard deviation of split frequencies: 0.004701 240500 -- [-2415.502] (-2414.519) (-2418.740) (-2426.249) * (-2424.655) (-2417.162) [-2424.268] (-2415.559) -- 0:02:06 241000 -- (-2417.615) (-2418.705) (-2419.914) [-2425.993] * (-2420.864) [-2417.429] (-2417.493) (-2418.531) -- 0:02:05 241500 -- [-2420.607] (-2415.849) (-2421.072) (-2422.832) * (-2423.581) (-2411.859) [-2416.466] (-2428.314) -- 0:02:05 242000 -- (-2420.305) [-2413.334] (-2416.051) (-2426.306) * [-2420.126] (-2419.300) (-2423.291) (-2421.345) -- 0:02:08 242500 -- (-2415.283) (-2422.046) (-2414.719) [-2420.000] * [-2420.665] (-2421.054) (-2422.539) (-2428.397) -- 0:02:08 243000 -- (-2422.026) (-2420.492) [-2425.647] (-2424.948) * (-2419.939) (-2420.027) (-2419.441) [-2424.389] -- 0:02:07 243500 -- (-2415.929) (-2421.085) (-2419.555) [-2421.660] * (-2423.621) (-2417.598) [-2421.261] (-2421.632) -- 0:02:07 244000 -- (-2412.842) (-2419.493) [-2415.498] (-2416.697) * (-2420.321) [-2416.401] (-2417.912) (-2424.117) -- 0:02:07 244500 -- [-2415.812] (-2424.643) (-2417.005) (-2429.542) * (-2421.439) (-2415.994) (-2420.253) [-2410.488] -- 0:02:06 245000 -- [-2417.433] (-2425.208) (-2415.455) (-2418.687) * [-2416.391] (-2412.660) (-2416.105) (-2419.641) -- 0:02:06 Average standard deviation of split frequencies: 0.005366 245500 -- [-2416.923] (-2427.597) (-2423.502) (-2412.074) * [-2414.147] (-2419.215) (-2422.584) (-2414.651) -- 0:02:06 246000 -- [-2417.019] (-2418.752) (-2419.629) (-2413.793) * [-2422.074] (-2416.876) (-2415.805) (-2422.992) -- 0:02:05 246500 -- [-2423.206] (-2413.393) (-2419.335) (-2415.581) * (-2417.102) (-2419.521) [-2421.916] (-2422.004) -- 0:02:05 247000 -- (-2417.576) (-2415.165) (-2423.139) [-2418.884] * (-2422.669) [-2415.763] (-2421.120) (-2421.466) -- 0:02:04 247500 -- (-2420.775) (-2415.256) (-2417.127) [-2417.374] * (-2418.618) (-2427.520) (-2416.943) [-2415.646] -- 0:02:04 248000 -- (-2416.665) [-2415.475] (-2414.447) (-2423.729) * (-2420.750) (-2417.135) (-2416.645) [-2420.077] -- 0:02:07 248500 -- [-2413.685] (-2417.049) (-2417.448) (-2420.369) * (-2422.125) [-2422.350] (-2421.314) (-2427.439) -- 0:02:07 249000 -- (-2416.194) [-2418.575] (-2417.583) (-2418.543) * (-2423.955) (-2421.066) [-2417.161] (-2420.796) -- 0:02:06 249500 -- (-2421.982) (-2424.991) [-2423.766] (-2422.629) * [-2415.840] (-2424.795) (-2414.553) (-2418.141) -- 0:02:06 250000 -- [-2421.905] (-2430.520) (-2421.386) (-2418.032) * (-2422.816) (-2425.352) (-2416.036) [-2418.185] -- 0:02:06 Average standard deviation of split frequencies: 0.005642 250500 -- (-2418.750) [-2415.457] (-2418.993) (-2422.725) * (-2418.965) (-2423.781) (-2420.063) [-2423.068] -- 0:02:05 251000 -- (-2416.051) (-2421.198) (-2413.870) [-2420.813] * (-2418.987) (-2418.213) [-2419.801] (-2417.955) -- 0:02:05 251500 -- (-2431.053) (-2424.825) (-2416.607) [-2412.201] * [-2413.548] (-2421.332) (-2420.709) (-2426.535) -- 0:02:04 252000 -- (-2417.557) (-2414.805) (-2425.905) [-2417.721] * [-2413.315] (-2416.066) (-2422.377) (-2429.877) -- 0:02:04 252500 -- (-2418.914) (-2423.612) (-2420.390) [-2410.758] * [-2418.015] (-2420.535) (-2420.926) (-2422.165) -- 0:02:04 253000 -- [-2411.243] (-2418.643) (-2425.646) (-2413.631) * (-2419.443) (-2414.731) (-2420.018) [-2418.683] -- 0:02:04 253500 -- [-2419.262] (-2430.185) (-2421.850) (-2420.268) * (-2420.125) (-2419.001) [-2418.727] (-2417.306) -- 0:02:03 254000 -- (-2416.803) (-2422.682) (-2414.685) [-2418.970] * (-2419.858) [-2416.587] (-2421.295) (-2426.524) -- 0:02:06 254500 -- (-2413.408) (-2421.925) (-2426.841) [-2413.881] * (-2423.535) (-2412.483) [-2423.072] (-2429.033) -- 0:02:05 255000 -- (-2417.920) [-2415.791] (-2417.476) (-2421.821) * (-2422.876) (-2415.061) [-2418.769] (-2424.225) -- 0:02:05 Average standard deviation of split frequencies: 0.005156 255500 -- (-2421.735) [-2415.737] (-2418.766) (-2417.317) * (-2418.444) [-2417.741] (-2418.811) (-2417.591) -- 0:02:05 256000 -- (-2420.494) [-2425.194] (-2418.015) (-2415.240) * [-2418.873] (-2419.573) (-2417.302) (-2420.414) -- 0:02:04 256500 -- [-2423.304] (-2421.189) (-2421.277) (-2416.100) * (-2415.037) [-2423.264] (-2414.499) (-2416.381) -- 0:02:04 257000 -- (-2417.863) [-2413.863] (-2414.976) (-2420.898) * [-2416.381] (-2420.596) (-2415.838) (-2424.211) -- 0:02:04 257500 -- (-2426.413) (-2425.191) (-2418.953) [-2417.717] * (-2418.120) [-2416.140] (-2416.116) (-2432.123) -- 0:02:03 258000 -- [-2416.950] (-2421.002) (-2415.649) (-2422.980) * (-2427.638) (-2417.081) [-2415.473] (-2428.846) -- 0:02:03 258500 -- (-2419.138) (-2423.411) (-2414.905) [-2418.078] * (-2420.110) [-2411.309] (-2422.800) (-2414.360) -- 0:02:03 259000 -- (-2422.258) (-2418.351) [-2419.098] (-2420.959) * (-2418.832) [-2416.734] (-2419.225) (-2423.107) -- 0:02:03 259500 -- [-2420.013] (-2422.313) (-2414.355) (-2417.878) * [-2416.858] (-2422.989) (-2420.827) (-2417.659) -- 0:02:02 260000 -- (-2414.051) (-2424.879) (-2417.101) [-2418.127] * [-2414.032] (-2425.958) (-2422.494) (-2416.278) -- 0:02:05 Average standard deviation of split frequencies: 0.006149 260500 -- (-2419.834) (-2418.597) (-2413.794) [-2424.980] * (-2415.468) (-2421.200) (-2426.806) [-2420.313] -- 0:02:04 261000 -- (-2431.565) [-2412.653] (-2417.124) (-2414.184) * (-2420.146) (-2423.180) (-2425.659) [-2418.514] -- 0:02:04 261500 -- (-2423.648) [-2412.453] (-2418.823) (-2426.928) * (-2427.753) (-2421.040) (-2416.441) [-2414.932] -- 0:02:04 262000 -- (-2419.822) (-2418.520) (-2415.821) [-2419.339] * (-2423.494) (-2425.867) (-2425.835) [-2418.668] -- 0:02:03 262500 -- [-2418.274] (-2417.516) (-2421.797) (-2416.370) * (-2427.236) [-2417.211] (-2415.957) (-2417.696) -- 0:02:03 263000 -- (-2423.211) (-2421.478) [-2419.297] (-2418.802) * (-2429.114) [-2417.053] (-2420.215) (-2416.792) -- 0:02:03 263500 -- (-2422.455) (-2422.804) (-2423.875) [-2411.900] * (-2419.898) (-2418.904) (-2423.454) [-2415.860] -- 0:02:02 264000 -- (-2421.348) (-2418.867) [-2425.019] (-2421.442) * [-2419.958] (-2422.059) (-2412.189) (-2412.666) -- 0:02:02 264500 -- [-2420.306] (-2413.015) (-2427.245) (-2417.371) * [-2418.749] (-2418.207) (-2414.083) (-2418.404) -- 0:02:02 265000 -- (-2419.571) (-2425.672) [-2416.609] (-2418.897) * (-2415.408) (-2419.017) (-2411.540) [-2420.496] -- 0:02:02 Average standard deviation of split frequencies: 0.006025 265500 -- (-2426.943) (-2415.386) (-2419.043) [-2415.202] * (-2422.325) (-2414.038) [-2417.259] (-2424.911) -- 0:02:01 266000 -- (-2417.962) [-2417.808] (-2419.597) (-2421.648) * (-2418.328) (-2419.020) (-2417.479) [-2423.707] -- 0:02:04 266500 -- [-2417.486] (-2417.516) (-2415.549) (-2417.173) * [-2413.698] (-2416.755) (-2416.006) (-2412.201) -- 0:02:03 267000 -- (-2424.190) [-2410.133] (-2417.704) (-2415.807) * (-2419.397) [-2417.404] (-2422.763) (-2419.589) -- 0:02:03 267500 -- (-2419.376) (-2421.913) (-2415.931) [-2424.715] * (-2416.810) [-2414.649] (-2418.489) (-2419.418) -- 0:02:03 268000 -- (-2421.032) [-2419.031] (-2419.608) (-2427.223) * (-2418.500) (-2413.520) [-2418.662] (-2418.970) -- 0:02:02 268500 -- (-2413.204) [-2414.381] (-2425.754) (-2418.770) * (-2419.017) (-2420.257) (-2418.457) [-2415.887] -- 0:02:02 269000 -- (-2417.710) (-2415.358) (-2418.077) [-2412.272] * [-2412.207] (-2416.737) (-2417.963) (-2413.915) -- 0:02:02 269500 -- (-2416.828) (-2420.860) [-2415.211] (-2419.807) * (-2419.097) [-2417.286] (-2419.999) (-2422.870) -- 0:02:01 270000 -- (-2416.935) (-2428.094) [-2414.084] (-2420.725) * (-2417.116) (-2416.819) [-2416.827] (-2421.726) -- 0:02:01 Average standard deviation of split frequencies: 0.006618 270500 -- [-2412.860] (-2417.610) (-2414.666) (-2417.111) * (-2423.044) (-2417.541) (-2418.316) [-2415.942] -- 0:02:01 271000 -- (-2419.183) (-2413.205) (-2421.542) [-2417.324] * [-2421.641] (-2434.184) (-2419.502) (-2413.615) -- 0:02:01 271500 -- (-2419.781) [-2418.509] (-2417.247) (-2424.903) * [-2413.684] (-2418.930) (-2418.345) (-2415.450) -- 0:02:00 272000 -- (-2419.863) (-2418.550) (-2414.318) [-2420.597] * (-2414.652) (-2424.753) (-2414.793) [-2416.560] -- 0:02:03 272500 -- (-2427.120) [-2426.302] (-2429.508) (-2423.355) * (-2417.572) (-2426.877) (-2416.216) [-2416.869] -- 0:02:02 273000 -- (-2416.973) (-2422.909) [-2421.383] (-2415.509) * (-2419.035) (-2417.688) [-2419.768] (-2425.217) -- 0:02:02 273500 -- (-2420.787) (-2415.005) (-2417.215) [-2416.020] * (-2421.110) [-2414.835] (-2418.404) (-2417.966) -- 0:02:02 274000 -- [-2414.045] (-2421.332) (-2426.032) (-2417.066) * [-2411.052] (-2426.391) (-2418.554) (-2418.868) -- 0:02:01 274500 -- (-2424.989) (-2420.469) [-2416.075] (-2417.799) * [-2414.973] (-2424.878) (-2418.954) (-2418.198) -- 0:02:01 275000 -- (-2418.625) (-2417.227) (-2425.765) [-2415.272] * (-2418.420) (-2426.408) (-2416.265) [-2414.867] -- 0:02:01 Average standard deviation of split frequencies: 0.003843 275500 -- (-2422.142) (-2415.519) (-2425.322) [-2419.578] * (-2414.510) [-2416.760] (-2419.811) (-2414.694) -- 0:02:00 276000 -- (-2422.461) (-2417.614) (-2422.576) [-2419.595] * [-2413.269] (-2415.983) (-2421.894) (-2420.953) -- 0:02:00 276500 -- (-2416.629) (-2418.477) [-2417.596] (-2423.162) * (-2420.798) [-2413.993] (-2422.661) (-2414.579) -- 0:02:00 277000 -- (-2421.814) [-2417.669] (-2422.202) (-2419.256) * [-2428.461] (-2413.788) (-2418.092) (-2418.051) -- 0:02:00 277500 -- (-2417.427) (-2413.217) [-2416.157] (-2413.459) * (-2429.814) (-2428.213) (-2419.242) [-2416.464] -- 0:01:59 278000 -- (-2413.664) [-2415.395] (-2419.041) (-2423.838) * [-2420.644] (-2418.859) (-2412.770) (-2419.732) -- 0:02:02 278500 -- (-2419.843) [-2412.596] (-2413.262) (-2420.209) * (-2418.768) (-2414.412) [-2419.800] (-2418.911) -- 0:02:01 279000 -- (-2420.501) (-2418.724) [-2417.962] (-2423.772) * (-2422.008) (-2412.581) [-2417.157] (-2418.902) -- 0:02:01 279500 -- (-2421.937) (-2413.353) [-2414.569] (-2424.443) * (-2418.516) (-2423.103) [-2417.734] (-2414.026) -- 0:02:01 280000 -- (-2415.747) (-2413.732) [-2423.666] (-2418.820) * [-2414.172] (-2415.756) (-2426.750) (-2419.890) -- 0:02:00 Average standard deviation of split frequencies: 0.002939 280500 -- [-2420.693] (-2424.140) (-2416.558) (-2419.367) * (-2422.928) (-2413.951) (-2416.223) [-2422.187] -- 0:02:00 281000 -- (-2424.450) (-2438.198) (-2419.840) [-2412.631] * (-2418.525) (-2420.427) (-2423.586) [-2419.227] -- 0:02:00 281500 -- [-2413.764] (-2424.130) (-2434.352) (-2419.429) * [-2422.291] (-2427.247) (-2421.793) (-2420.946) -- 0:01:59 282000 -- (-2417.159) (-2421.489) (-2427.394) [-2415.996] * [-2415.134] (-2426.276) (-2425.914) (-2418.108) -- 0:01:59 282500 -- (-2420.466) (-2422.071) (-2421.518) [-2415.610] * [-2417.657] (-2429.854) (-2420.063) (-2420.839) -- 0:01:59 283000 -- (-2415.699) (-2417.989) [-2417.383] (-2417.649) * (-2410.601) (-2430.657) (-2417.980) [-2422.084] -- 0:01:59 283500 -- (-2419.470) (-2412.785) (-2424.400) [-2420.269] * (-2419.070) (-2435.902) (-2417.284) [-2419.553] -- 0:01:58 284000 -- [-2425.904] (-2418.226) (-2428.006) (-2423.175) * [-2417.172] (-2436.055) (-2411.863) (-2423.893) -- 0:02:01 284500 -- (-2414.308) (-2413.004) (-2425.726) [-2416.069] * [-2415.155] (-2426.169) (-2416.005) (-2425.940) -- 0:02:00 285000 -- (-2423.015) [-2418.305] (-2421.476) (-2418.316) * (-2417.860) (-2423.656) [-2422.802] (-2420.975) -- 0:02:00 Average standard deviation of split frequencies: 0.002884 285500 -- [-2418.782] (-2430.080) (-2414.967) (-2413.121) * (-2421.712) (-2423.360) (-2414.505) [-2413.793] -- 0:02:00 286000 -- (-2427.074) (-2420.568) (-2417.882) [-2415.551] * (-2431.424) (-2414.021) (-2425.812) [-2420.462] -- 0:01:59 286500 -- [-2415.334] (-2426.222) (-2417.474) (-2423.796) * [-2420.902] (-2424.363) (-2419.131) (-2427.198) -- 0:01:59 287000 -- [-2424.484] (-2415.451) (-2422.891) (-2421.633) * [-2419.607] (-2428.207) (-2421.953) (-2420.733) -- 0:01:59 287500 -- (-2421.094) [-2418.697] (-2422.358) (-2426.053) * (-2419.955) [-2419.234] (-2419.850) (-2418.470) -- 0:01:58 288000 -- [-2420.709] (-2416.814) (-2423.492) (-2432.732) * (-2415.173) [-2416.932] (-2422.642) (-2418.238) -- 0:01:58 288500 -- [-2416.896] (-2420.089) (-2422.113) (-2413.423) * (-2424.025) (-2419.562) [-2420.431] (-2419.885) -- 0:01:58 289000 -- (-2421.175) (-2422.167) [-2420.452] (-2420.996) * (-2422.097) (-2418.629) [-2415.884] (-2417.576) -- 0:01:58 289500 -- (-2415.107) (-2430.759) (-2414.366) [-2422.134] * (-2424.695) [-2420.122] (-2423.016) (-2424.365) -- 0:01:57 290000 -- (-2415.567) (-2433.070) (-2431.552) [-2416.770] * (-2427.327) (-2430.079) [-2412.255] (-2415.332) -- 0:01:59 Average standard deviation of split frequencies: 0.002838 290500 -- (-2413.992) (-2429.556) (-2431.569) [-2417.882] * (-2418.501) (-2414.495) (-2416.973) [-2414.149] -- 0:01:59 291000 -- (-2422.853) (-2427.888) (-2423.974) [-2415.192] * (-2422.465) [-2424.941] (-2420.191) (-2421.180) -- 0:01:59 291500 -- (-2424.469) (-2422.396) [-2417.814] (-2421.354) * (-2419.845) [-2414.298] (-2418.501) (-2424.479) -- 0:01:59 292000 -- [-2418.079] (-2424.743) (-2427.741) (-2419.974) * (-2423.493) (-2414.801) (-2420.141) [-2422.836] -- 0:01:58 292500 -- (-2416.509) [-2422.510] (-2419.189) (-2418.567) * (-2424.891) [-2419.869] (-2420.600) (-2420.581) -- 0:01:58 293000 -- (-2423.135) (-2420.091) (-2412.039) [-2411.700] * [-2417.222] (-2415.195) (-2414.087) (-2419.564) -- 0:01:58 293500 -- (-2416.626) (-2422.170) (-2426.257) [-2416.088] * (-2420.213) (-2420.976) [-2413.580] (-2420.270) -- 0:01:57 294000 -- (-2420.865) [-2420.226] (-2415.013) (-2416.769) * (-2416.868) (-2423.452) (-2416.480) [-2411.805] -- 0:01:57 294500 -- (-2418.063) (-2420.350) [-2418.660] (-2416.644) * [-2417.522] (-2430.891) (-2421.656) (-2414.685) -- 0:01:57 295000 -- [-2417.494] (-2419.911) (-2420.746) (-2416.465) * (-2423.804) (-2425.475) [-2415.262] (-2419.985) -- 0:01:57 Average standard deviation of split frequencies: 0.003981 295500 -- [-2415.521] (-2422.416) (-2419.121) (-2420.289) * (-2417.181) (-2415.280) [-2417.603] (-2421.978) -- 0:01:56 296000 -- (-2417.483) (-2411.278) (-2424.977) [-2416.646] * (-2411.891) (-2414.816) (-2420.755) [-2417.464] -- 0:01:58 296500 -- [-2423.412] (-2423.113) (-2435.833) (-2420.921) * [-2412.487] (-2420.910) (-2428.976) (-2420.739) -- 0:01:58 297000 -- [-2422.515] (-2421.451) (-2419.078) (-2417.900) * [-2419.232] (-2419.493) (-2425.346) (-2421.312) -- 0:01:58 297500 -- (-2420.191) (-2421.638) [-2420.010] (-2413.620) * (-2420.251) (-2423.494) [-2418.381] (-2419.569) -- 0:01:58 298000 -- (-2423.434) (-2420.362) (-2427.139) [-2419.346] * (-2421.589) (-2423.040) [-2422.800] (-2421.258) -- 0:01:57 298500 -- (-2420.457) [-2416.501] (-2423.144) (-2417.194) * (-2422.401) (-2422.862) (-2419.488) [-2418.712] -- 0:01:57 299000 -- (-2420.748) (-2418.023) [-2418.435] (-2423.760) * (-2417.171) (-2416.413) (-2414.330) [-2414.884] -- 0:01:57 299500 -- (-2417.492) (-2422.276) (-2426.322) [-2421.975] * (-2420.689) (-2422.935) [-2416.860] (-2413.582) -- 0:01:56 300000 -- (-2417.682) (-2420.355) [-2428.029] (-2421.986) * (-2418.879) (-2421.348) (-2420.169) [-2415.920] -- 0:01:56 Average standard deviation of split frequencies: 0.004704 300500 -- (-2420.212) (-2421.712) (-2419.759) [-2421.101] * (-2419.263) (-2431.119) (-2420.156) [-2421.024] -- 0:01:56 301000 -- (-2417.399) [-2420.627] (-2425.438) (-2414.973) * (-2419.336) (-2423.426) [-2419.145] (-2421.383) -- 0:01:56 301500 -- [-2417.335] (-2420.507) (-2422.138) (-2422.426) * (-2417.545) (-2431.297) (-2424.955) [-2416.415] -- 0:01:55 302000 -- [-2416.472] (-2422.259) (-2427.937) (-2426.665) * (-2424.707) (-2419.741) [-2420.927] (-2421.705) -- 0:01:57 302500 -- (-2417.460) (-2421.910) (-2428.289) [-2417.203] * [-2424.282] (-2417.946) (-2418.458) (-2417.116) -- 0:01:57 303000 -- (-2420.517) [-2418.820] (-2420.899) (-2421.831) * (-2421.263) [-2428.944] (-2418.997) (-2422.303) -- 0:01:57 303500 -- (-2429.915) (-2421.886) [-2418.312] (-2417.707) * (-2414.482) (-2435.412) [-2420.858] (-2411.239) -- 0:01:57 304000 -- (-2415.481) (-2419.333) (-2422.390) [-2412.105] * (-2415.866) [-2418.746] (-2430.864) (-2418.281) -- 0:01:56 304500 -- (-2415.720) (-2426.494) [-2416.304] (-2420.796) * (-2422.767) (-2420.271) (-2430.409) [-2423.597] -- 0:01:56 305000 -- (-2419.002) [-2420.264] (-2421.199) (-2419.814) * (-2418.453) [-2420.496] (-2427.825) (-2431.122) -- 0:01:56 Average standard deviation of split frequencies: 0.008627 305500 -- [-2417.420] (-2421.056) (-2417.242) (-2426.654) * (-2419.219) [-2420.453] (-2421.828) (-2418.280) -- 0:01:55 306000 -- (-2419.464) [-2416.249] (-2418.105) (-2428.929) * [-2418.602] (-2419.190) (-2427.063) (-2422.921) -- 0:01:55 306500 -- [-2418.481] (-2419.113) (-2417.958) (-2420.004) * (-2415.287) (-2421.749) (-2429.248) [-2417.570] -- 0:01:55 307000 -- [-2420.022] (-2427.560) (-2420.835) (-2419.193) * (-2418.133) (-2419.849) [-2422.486] (-2415.771) -- 0:01:55 307500 -- (-2418.650) (-2431.217) (-2427.623) [-2414.237] * (-2421.211) (-2421.677) [-2423.599] (-2418.282) -- 0:01:54 308000 -- (-2419.973) (-2425.938) [-2418.343] (-2411.814) * (-2417.702) (-2419.009) (-2415.470) [-2421.709] -- 0:01:56 308500 -- (-2418.736) (-2424.448) (-2419.971) [-2424.467] * (-2417.960) [-2418.518] (-2411.449) (-2411.933) -- 0:01:56 309000 -- (-2421.980) (-2442.650) (-2412.454) [-2419.411] * [-2422.892] (-2425.953) (-2417.265) (-2423.979) -- 0:01:56 309500 -- (-2421.401) (-2427.197) [-2415.043] (-2423.565) * (-2417.573) (-2417.761) [-2424.846] (-2417.033) -- 0:01:56 310000 -- (-2423.553) (-2418.185) [-2419.792] (-2412.992) * (-2422.634) [-2416.833] (-2419.204) (-2420.748) -- 0:01:55 Average standard deviation of split frequencies: 0.003793 310500 -- [-2422.218] (-2420.344) (-2421.467) (-2424.917) * [-2416.506] (-2424.693) (-2434.879) (-2415.059) -- 0:01:55 311000 -- (-2418.707) [-2418.474] (-2430.000) (-2417.492) * [-2418.935] (-2418.583) (-2418.186) (-2419.078) -- 0:01:55 311500 -- (-2419.651) (-2415.634) [-2416.945] (-2427.231) * [-2425.231] (-2417.277) (-2419.713) (-2422.832) -- 0:01:54 312000 -- (-2417.065) (-2415.914) [-2423.163] (-2427.641) * (-2412.633) (-2420.897) (-2419.435) [-2421.768] -- 0:01:54 312500 -- (-2418.599) [-2425.434] (-2416.302) (-2424.153) * [-2422.702] (-2414.370) (-2425.056) (-2421.645) -- 0:01:54 313000 -- (-2430.648) (-2420.418) [-2414.151] (-2416.185) * (-2420.204) (-2420.876) (-2423.971) [-2418.308] -- 0:01:54 313500 -- (-2421.215) (-2419.620) [-2424.752] (-2425.438) * (-2417.217) (-2420.325) [-2422.898] (-2415.956) -- 0:01:53 314000 -- [-2419.660] (-2417.204) (-2421.504) (-2417.455) * [-2411.218] (-2418.922) (-2417.405) (-2413.264) -- 0:01:55 314500 -- (-2426.546) (-2417.355) (-2420.835) [-2418.480] * (-2415.778) (-2418.744) [-2411.367] (-2422.297) -- 0:01:55 315000 -- (-2420.976) (-2419.502) [-2414.450] (-2414.233) * (-2413.180) [-2418.038] (-2419.517) (-2413.148) -- 0:01:55 Average standard deviation of split frequencies: 0.004102 315500 -- (-2424.451) (-2421.879) (-2413.938) [-2418.484] * (-2415.619) (-2418.632) [-2412.492] (-2413.885) -- 0:01:54 316000 -- (-2416.425) (-2415.503) [-2414.540] (-2417.039) * [-2415.590] (-2422.351) (-2416.263) (-2415.799) -- 0:01:54 316500 -- (-2418.356) (-2419.801) [-2423.207] (-2422.517) * (-2425.833) (-2425.270) (-2424.443) [-2423.132] -- 0:01:54 317000 -- (-2417.561) (-2426.050) [-2417.531] (-2418.742) * (-2421.832) (-2417.862) [-2411.691] (-2424.779) -- 0:01:54 317500 -- (-2412.775) [-2426.527] (-2418.197) (-2414.798) * (-2422.329) (-2420.914) [-2421.639] (-2415.794) -- 0:01:53 318000 -- (-2418.191) (-2422.548) (-2416.257) [-2416.363] * (-2418.034) (-2416.378) [-2419.367] (-2420.095) -- 0:01:53 318500 -- [-2421.045] (-2420.341) (-2416.494) (-2423.032) * (-2417.015) (-2419.339) (-2410.998) [-2414.599] -- 0:01:53 319000 -- (-2426.550) (-2418.476) (-2418.107) [-2420.234] * [-2412.225] (-2419.839) (-2415.538) (-2420.002) -- 0:01:53 319500 -- (-2416.531) (-2415.135) (-2418.301) [-2418.880] * [-2414.904] (-2420.324) (-2421.924) (-2424.174) -- 0:01:55 320000 -- (-2419.410) [-2419.984] (-2421.088) (-2425.786) * (-2425.936) (-2427.752) (-2417.364) [-2415.849] -- 0:01:54 Average standard deviation of split frequencies: 0.007644 320500 -- [-2414.393] (-2420.156) (-2423.230) (-2418.989) * (-2419.699) (-2422.071) (-2425.100) [-2420.557] -- 0:01:54 321000 -- (-2415.448) (-2419.675) [-2414.944] (-2430.696) * [-2416.500] (-2419.401) (-2418.472) (-2422.834) -- 0:01:54 321500 -- [-2419.873] (-2425.081) (-2417.520) (-2427.104) * (-2418.593) (-2418.832) (-2418.584) [-2423.201] -- 0:01:53 322000 -- (-2423.735) [-2414.173] (-2422.727) (-2425.182) * (-2420.463) (-2422.619) (-2419.473) [-2416.608] -- 0:01:53 322500 -- (-2421.562) (-2421.793) [-2421.220] (-2423.093) * (-2414.120) (-2418.883) (-2424.938) [-2413.093] -- 0:01:53 323000 -- (-2420.250) (-2422.545) [-2416.046] (-2423.726) * (-2417.231) (-2416.835) (-2418.574) [-2420.158] -- 0:01:53 323500 -- (-2417.411) (-2417.073) (-2418.081) [-2416.870] * (-2418.387) (-2423.118) (-2414.752) [-2414.509] -- 0:01:52 324000 -- (-2415.074) (-2431.016) [-2418.181] (-2426.228) * (-2421.319) (-2433.311) (-2417.725) [-2418.663] -- 0:01:52 324500 -- (-2419.575) (-2419.820) [-2414.358] (-2420.754) * (-2415.362) [-2422.764] (-2413.769) (-2418.148) -- 0:01:52 325000 -- (-2423.069) [-2415.038] (-2416.618) (-2419.530) * (-2416.076) (-2426.679) [-2420.821] (-2421.288) -- 0:01:52 Average standard deviation of split frequencies: 0.007519 325500 -- (-2421.813) [-2420.107] (-2413.782) (-2419.995) * (-2427.301) (-2420.132) (-2418.499) [-2417.231] -- 0:01:51 326000 -- (-2429.471) (-2419.415) [-2416.248] (-2425.935) * (-2427.341) [-2429.140] (-2422.335) (-2420.795) -- 0:01:53 326500 -- (-2413.274) (-2415.463) (-2422.970) [-2417.431] * (-2416.296) (-2417.071) (-2420.694) [-2421.468] -- 0:01:53 327000 -- (-2422.127) (-2436.291) (-2419.435) [-2415.074] * (-2427.000) [-2410.547] (-2423.840) (-2416.941) -- 0:01:53 327500 -- (-2421.486) (-2419.358) [-2416.714] (-2412.994) * [-2413.356] (-2417.253) (-2430.045) (-2422.419) -- 0:01:52 328000 -- (-2416.190) (-2412.323) [-2417.967] (-2418.286) * (-2412.545) [-2413.715] (-2417.424) (-2415.193) -- 0:01:52 328500 -- (-2426.003) (-2418.512) (-2417.424) [-2417.328] * (-2426.201) (-2414.811) [-2426.777] (-2418.253) -- 0:01:52 329000 -- (-2421.753) (-2425.038) [-2416.444] (-2426.514) * (-2429.529) (-2419.081) (-2422.246) [-2417.638] -- 0:01:52 329500 -- (-2422.615) (-2423.114) [-2413.925] (-2420.625) * [-2417.247] (-2418.307) (-2415.884) (-2412.025) -- 0:01:51 330000 -- (-2421.732) (-2418.413) (-2415.359) [-2418.114] * [-2417.307] (-2419.731) (-2418.468) (-2418.376) -- 0:01:51 Average standard deviation of split frequencies: 0.002851 330500 -- (-2418.445) [-2420.750] (-2422.312) (-2417.970) * [-2421.769] (-2424.237) (-2430.928) (-2415.019) -- 0:01:51 331000 -- (-2424.326) (-2421.263) [-2424.934] (-2421.116) * [-2418.183] (-2419.632) (-2419.010) (-2417.400) -- 0:01:51 331500 -- [-2415.168] (-2417.454) (-2418.336) (-2425.316) * (-2426.620) [-2418.374] (-2420.017) (-2420.373) -- 0:01:50 332000 -- (-2425.670) (-2430.798) [-2412.903] (-2409.362) * [-2418.862] (-2419.106) (-2419.652) (-2418.178) -- 0:01:52 332500 -- (-2415.298) (-2418.671) (-2413.587) [-2415.339] * (-2414.198) (-2425.400) (-2416.839) [-2415.818] -- 0:01:52 333000 -- (-2418.589) [-2416.605] (-2423.817) (-2421.870) * (-2427.999) (-2418.235) (-2419.875) [-2417.655] -- 0:01:52 333500 -- (-2418.530) (-2420.415) (-2421.559) [-2415.448] * [-2424.278] (-2417.387) (-2419.335) (-2417.475) -- 0:01:51 334000 -- (-2422.852) (-2417.983) [-2419.299] (-2421.716) * (-2418.743) (-2414.969) [-2414.558] (-2426.736) -- 0:01:51 334500 -- (-2421.212) (-2422.311) [-2419.445] (-2416.891) * (-2424.958) (-2419.093) (-2418.958) [-2412.890] -- 0:01:51 335000 -- [-2427.340] (-2417.721) (-2422.625) (-2412.463) * (-2419.949) (-2414.978) [-2414.554] (-2415.068) -- 0:01:51 Average standard deviation of split frequencies: 0.006454 335500 -- (-2420.823) (-2419.281) (-2426.544) [-2419.827] * (-2423.648) [-2420.241] (-2425.603) (-2420.250) -- 0:01:50 336000 -- (-2431.850) [-2422.004] (-2421.488) (-2417.708) * (-2417.475) (-2424.574) (-2421.770) [-2413.025] -- 0:01:50 336500 -- (-2420.884) (-2416.473) [-2421.287] (-2412.293) * (-2421.366) (-2415.500) [-2419.103] (-2413.804) -- 0:01:50 337000 -- (-2425.356) [-2416.138] (-2425.725) (-2416.611) * (-2424.343) [-2415.622] (-2421.515) (-2414.685) -- 0:01:50 337500 -- (-2429.577) [-2415.402] (-2416.222) (-2421.407) * (-2421.208) [-2415.742] (-2417.961) (-2419.017) -- 0:01:49 338000 -- (-2416.823) (-2424.928) (-2412.436) [-2416.703] * [-2422.556] (-2418.506) (-2423.735) (-2417.047) -- 0:01:51 338500 -- (-2417.809) [-2414.473] (-2419.343) (-2414.909) * (-2415.670) [-2419.680] (-2422.401) (-2424.227) -- 0:01:51 339000 -- (-2423.003) (-2420.497) [-2415.120] (-2421.557) * [-2416.076] (-2419.433) (-2421.761) (-2416.087) -- 0:01:51 339500 -- [-2421.757] (-2419.442) (-2416.491) (-2416.157) * (-2422.887) [-2413.095] (-2416.970) (-2420.017) -- 0:01:50 340000 -- (-2420.588) [-2413.125] (-2414.640) (-2425.257) * (-2419.344) (-2432.130) (-2421.165) [-2417.348] -- 0:01:50 Average standard deviation of split frequencies: 0.006919 340500 -- [-2414.003] (-2412.348) (-2421.223) (-2426.544) * [-2417.587] (-2419.528) (-2424.422) (-2413.195) -- 0:01:50 341000 -- (-2419.388) (-2418.414) (-2419.718) [-2420.921] * (-2417.546) (-2422.060) [-2421.886] (-2416.801) -- 0:01:50 341500 -- [-2420.548] (-2417.008) (-2423.208) (-2425.692) * (-2420.048) (-2425.486) [-2413.203] (-2420.350) -- 0:01:49 342000 -- (-2428.579) [-2416.619] (-2419.853) (-2421.654) * [-2417.648] (-2419.437) (-2422.728) (-2414.347) -- 0:01:49 342500 -- [-2418.648] (-2420.488) (-2419.828) (-2421.672) * (-2417.567) [-2417.797] (-2416.442) (-2417.859) -- 0:01:49 343000 -- (-2425.407) (-2422.071) [-2421.504] (-2417.430) * (-2417.687) [-2419.363] (-2418.700) (-2414.142) -- 0:01:49 343500 -- [-2418.122] (-2421.141) (-2430.504) (-2420.420) * (-2417.980) [-2413.186] (-2415.336) (-2428.969) -- 0:01:48 344000 -- (-2413.311) [-2419.345] (-2413.222) (-2425.297) * (-2424.758) (-2414.186) (-2417.488) [-2425.238] -- 0:01:50 344500 -- (-2416.914) (-2415.009) (-2419.239) [-2421.660] * (-2415.846) (-2424.334) [-2418.434] (-2414.146) -- 0:01:50 345000 -- (-2418.320) [-2413.759] (-2421.006) (-2420.967) * [-2417.562] (-2424.183) (-2417.252) (-2422.108) -- 0:01:50 Average standard deviation of split frequencies: 0.008175 345500 -- (-2420.094) (-2415.627) [-2413.250] (-2418.257) * (-2421.571) (-2418.306) (-2415.408) [-2417.121] -- 0:01:49 346000 -- (-2420.504) (-2419.718) [-2421.033] (-2421.304) * [-2422.251] (-2417.441) (-2424.191) (-2418.801) -- 0:01:49 346500 -- (-2421.498) (-2415.195) [-2420.747] (-2425.502) * (-2419.560) (-2423.736) (-2423.681) [-2413.756] -- 0:01:49 347000 -- (-2412.194) (-2418.756) (-2423.691) [-2418.796] * (-2423.088) (-2414.241) (-2416.344) [-2415.557] -- 0:01:49 347500 -- (-2422.837) [-2422.886] (-2415.912) (-2426.229) * (-2421.488) (-2414.650) (-2413.344) [-2420.962] -- 0:01:48 348000 -- (-2417.504) (-2425.750) (-2418.156) [-2417.169] * (-2417.971) [-2415.414] (-2415.635) (-2420.893) -- 0:01:48 348500 -- (-2419.045) (-2420.277) [-2421.963] (-2430.530) * (-2421.662) (-2413.358) (-2418.638) [-2420.735] -- 0:01:48 349000 -- (-2415.564) (-2419.985) (-2417.970) [-2422.247] * (-2417.979) (-2421.135) (-2422.305) [-2414.702] -- 0:01:48 349500 -- (-2424.452) [-2413.914] (-2419.418) (-2421.361) * (-2418.041) (-2419.341) [-2416.591] (-2421.496) -- 0:01:47 350000 -- (-2424.548) (-2420.819) (-2417.081) [-2417.736] * (-2423.901) (-2420.452) (-2423.245) [-2416.295] -- 0:01:47 Average standard deviation of split frequencies: 0.005915 350500 -- (-2426.039) (-2416.347) (-2422.472) [-2417.635] * [-2423.124] (-2418.141) (-2415.273) (-2417.883) -- 0:01:49 351000 -- (-2422.603) [-2415.276] (-2424.251) (-2428.376) * (-2418.030) [-2417.525] (-2416.771) (-2419.718) -- 0:01:49 351500 -- (-2420.215) [-2423.123] (-2418.217) (-2413.913) * (-2426.796) [-2409.846] (-2429.349) (-2417.440) -- 0:01:48 352000 -- [-2416.216] (-2419.867) (-2417.907) (-2419.327) * [-2419.311] (-2413.014) (-2428.679) (-2419.341) -- 0:01:48 352500 -- (-2423.087) (-2416.878) (-2418.430) [-2413.702] * (-2414.648) [-2419.308] (-2418.599) (-2416.802) -- 0:01:48 353000 -- (-2420.095) (-2422.178) (-2422.718) [-2417.524] * (-2426.382) [-2421.006] (-2424.615) (-2420.431) -- 0:01:48 353500 -- [-2414.821] (-2419.716) (-2417.022) (-2423.420) * (-2429.944) [-2416.880] (-2423.985) (-2411.763) -- 0:01:47 354000 -- (-2419.405) (-2416.791) (-2418.129) [-2415.563] * [-2424.572] (-2416.959) (-2420.844) (-2412.599) -- 0:01:47 354500 -- [-2415.139] (-2419.246) (-2420.847) (-2418.142) * (-2423.256) (-2423.754) [-2419.427] (-2413.395) -- 0:01:47 355000 -- [-2418.693] (-2424.162) (-2417.328) (-2424.102) * (-2425.203) [-2413.590] (-2417.578) (-2414.089) -- 0:01:47 Average standard deviation of split frequencies: 0.003973 355500 -- [-2416.376] (-2424.416) (-2421.395) (-2423.168) * (-2420.061) (-2414.417) [-2422.599] (-2427.929) -- 0:01:46 356000 -- (-2424.806) (-2421.682) [-2417.444] (-2428.784) * (-2417.080) (-2429.137) [-2415.895] (-2418.120) -- 0:01:46 356500 -- (-2428.621) [-2420.534] (-2421.377) (-2420.401) * (-2420.313) [-2417.787] (-2419.055) (-2412.731) -- 0:01:48 357000 -- (-2420.045) [-2421.546] (-2416.301) (-2420.181) * (-2421.316) (-2420.931) [-2413.571] (-2412.226) -- 0:01:48 357500 -- (-2417.562) (-2418.680) (-2418.062) [-2414.162] * (-2421.753) (-2422.640) (-2413.251) [-2417.471] -- 0:01:47 358000 -- (-2422.438) [-2418.921] (-2414.076) (-2419.217) * (-2416.752) [-2413.203] (-2415.476) (-2424.497) -- 0:01:47 358500 -- (-2411.673) [-2416.591] (-2422.054) (-2416.693) * (-2416.076) (-2418.196) (-2424.429) [-2416.001] -- 0:01:47 359000 -- (-2415.017) (-2416.393) (-2424.239) [-2414.735] * (-2428.010) (-2425.181) [-2414.435] (-2426.056) -- 0:01:47 359500 -- (-2422.665) [-2418.937] (-2416.325) (-2419.231) * [-2416.417] (-2417.544) (-2415.864) (-2420.315) -- 0:01:46 360000 -- (-2420.861) (-2420.063) [-2418.825] (-2420.720) * (-2417.704) (-2424.111) [-2423.206] (-2415.639) -- 0:01:46 Average standard deviation of split frequencies: 0.003921 360500 -- (-2424.286) (-2413.011) [-2417.989] (-2415.487) * [-2416.434] (-2419.464) (-2421.845) (-2413.987) -- 0:01:46 361000 -- (-2419.416) (-2417.168) [-2415.075] (-2420.221) * (-2413.528) [-2420.333] (-2415.569) (-2416.731) -- 0:01:46 361500 -- (-2420.752) (-2419.493) (-2424.786) [-2422.035] * (-2415.217) (-2427.967) [-2416.168] (-2414.810) -- 0:01:45 362000 -- [-2417.221] (-2418.426) (-2417.626) (-2423.099) * (-2415.675) (-2430.140) [-2415.609] (-2421.751) -- 0:01:45 362500 -- [-2418.568] (-2416.609) (-2415.277) (-2417.146) * (-2414.032) (-2417.450) (-2425.951) [-2418.194] -- 0:01:47 363000 -- (-2416.523) (-2414.955) [-2417.559] (-2417.073) * (-2422.307) [-2413.235] (-2417.268) (-2419.177) -- 0:01:47 363500 -- [-2415.013] (-2418.396) (-2416.332) (-2420.117) * (-2417.115) (-2413.697) [-2418.248] (-2423.061) -- 0:01:46 364000 -- (-2425.682) [-2423.122] (-2414.981) (-2421.055) * [-2420.940] (-2424.573) (-2415.270) (-2419.435) -- 0:01:46 364500 -- (-2420.918) (-2417.950) (-2415.565) [-2415.420] * (-2423.088) (-2421.431) (-2414.614) [-2420.451] -- 0:01:46 365000 -- (-2426.714) (-2421.870) (-2420.717) [-2411.712] * (-2419.365) [-2417.843] (-2410.520) (-2427.240) -- 0:01:46 Average standard deviation of split frequencies: 0.003220 365500 -- (-2419.180) [-2419.719] (-2416.570) (-2415.723) * (-2415.881) [-2417.154] (-2416.982) (-2425.108) -- 0:01:45 366000 -- [-2420.452] (-2423.372) (-2418.927) (-2414.778) * (-2427.490) [-2419.386] (-2421.018) (-2428.126) -- 0:01:45 366500 -- (-2416.705) (-2419.636) (-2419.660) [-2416.952] * (-2416.461) (-2417.012) [-2420.240] (-2430.092) -- 0:01:45 367000 -- (-2419.575) (-2422.093) (-2416.444) [-2416.335] * (-2422.998) [-2414.284] (-2420.245) (-2422.341) -- 0:01:45 367500 -- (-2418.986) [-2415.518] (-2418.107) (-2419.510) * (-2420.091) [-2413.707] (-2413.667) (-2419.758) -- 0:01:44 368000 -- (-2422.349) [-2421.154] (-2416.650) (-2422.076) * (-2422.090) (-2417.818) (-2415.672) [-2422.525] -- 0:01:44 368500 -- (-2421.986) (-2416.424) [-2415.882] (-2415.938) * (-2423.153) [-2417.327] (-2424.954) (-2416.267) -- 0:01:46 369000 -- (-2422.125) (-2416.105) [-2419.330] (-2415.255) * (-2421.076) (-2423.496) (-2413.484) [-2419.319] -- 0:01:46 369500 -- (-2421.503) [-2417.417] (-2418.375) (-2414.596) * (-2417.485) (-2433.355) [-2413.973] (-2420.140) -- 0:01:45 370000 -- (-2420.700) (-2421.330) [-2416.965] (-2415.926) * (-2410.657) (-2420.297) (-2413.850) [-2413.249] -- 0:01:45 Average standard deviation of split frequencies: 0.004451 370500 -- (-2414.816) [-2416.317] (-2422.013) (-2422.235) * (-2414.813) (-2424.006) [-2416.189] (-2421.454) -- 0:01:45 371000 -- (-2414.929) (-2414.367) [-2419.293] (-2419.787) * (-2415.348) (-2417.406) [-2422.194] (-2423.829) -- 0:01:45 371500 -- (-2412.427) (-2416.280) [-2416.105] (-2416.543) * (-2419.381) (-2415.422) (-2421.574) [-2420.211] -- 0:01:44 372000 -- (-2417.174) (-2426.551) [-2417.707] (-2417.923) * (-2420.848) (-2424.074) [-2417.125] (-2415.713) -- 0:01:44 372500 -- (-2417.914) (-2417.682) [-2416.013] (-2429.175) * (-2415.644) (-2421.651) [-2418.830] (-2416.553) -- 0:01:44 373000 -- (-2416.437) (-2418.758) (-2420.027) [-2421.452] * (-2411.983) (-2425.231) (-2424.770) [-2415.300] -- 0:01:44 373500 -- (-2419.099) [-2421.792] (-2421.434) (-2417.879) * (-2417.753) (-2417.336) [-2417.279] (-2424.609) -- 0:01:43 374000 -- (-2422.145) [-2415.825] (-2413.045) (-2415.295) * (-2419.587) (-2421.177) [-2415.089] (-2416.637) -- 0:01:43 374500 -- (-2425.019) [-2417.811] (-2415.565) (-2416.735) * [-2418.537] (-2417.117) (-2416.957) (-2419.920) -- 0:01:45 375000 -- (-2420.765) (-2415.226) (-2433.921) [-2415.373] * [-2417.261] (-2420.778) (-2421.348) (-2424.307) -- 0:01:45 Average standard deviation of split frequencies: 0.004702 375500 -- (-2422.821) (-2418.972) [-2422.753] (-2423.950) * (-2415.469) [-2425.310] (-2414.373) (-2419.822) -- 0:01:44 376000 -- [-2419.588] (-2417.558) (-2418.495) (-2418.358) * (-2420.934) (-2421.905) [-2421.067] (-2415.789) -- 0:01:44 376500 -- (-2428.211) (-2423.043) [-2421.189] (-2417.169) * [-2414.771] (-2419.648) (-2426.016) (-2417.021) -- 0:01:44 377000 -- (-2418.554) [-2429.856] (-2429.834) (-2424.186) * [-2414.882] (-2421.361) (-2416.373) (-2416.888) -- 0:01:44 377500 -- [-2413.731] (-2420.931) (-2418.050) (-2419.190) * (-2419.956) (-2421.553) (-2422.889) [-2415.518] -- 0:01:43 378000 -- [-2416.985] (-2429.143) (-2421.225) (-2413.228) * (-2417.324) (-2417.668) (-2421.902) [-2419.081] -- 0:01:43 378500 -- (-2417.287) [-2419.452] (-2423.691) (-2427.035) * [-2418.959] (-2413.938) (-2409.638) (-2420.694) -- 0:01:43 379000 -- (-2423.355) (-2412.242) [-2416.280] (-2421.330) * (-2418.409) (-2414.354) (-2419.447) [-2419.680] -- 0:01:43 379500 -- (-2418.621) [-2418.929] (-2425.447) (-2418.323) * [-2416.041] (-2417.505) (-2417.496) (-2419.248) -- 0:01:43 380000 -- (-2423.465) (-2414.349) [-2422.659] (-2414.749) * [-2424.055] (-2419.035) (-2421.930) (-2421.659) -- 0:01:44 Average standard deviation of split frequencies: 0.001548 380500 -- (-2420.204) (-2421.312) [-2416.568] (-2416.922) * (-2424.637) (-2421.061) [-2414.698] (-2416.444) -- 0:01:44 381000 -- (-2415.600) (-2420.836) (-2415.914) [-2416.030] * (-2418.337) (-2424.596) (-2417.901) [-2416.923] -- 0:01:43 381500 -- (-2420.633) (-2420.846) (-2414.430) [-2415.367] * [-2418.046] (-2420.592) (-2419.711) (-2413.026) -- 0:01:43 382000 -- [-2422.233] (-2420.784) (-2429.409) (-2419.646) * (-2417.902) (-2423.823) (-2420.441) [-2417.779] -- 0:01:43 382500 -- (-2421.821) (-2420.999) [-2416.204] (-2416.188) * [-2410.371] (-2417.962) (-2422.137) (-2423.216) -- 0:01:43 383000 -- (-2419.602) [-2418.542] (-2418.823) (-2425.600) * (-2415.769) (-2420.528) (-2413.965) [-2422.375] -- 0:01:43 383500 -- (-2414.730) (-2417.452) [-2415.563] (-2420.352) * [-2423.413] (-2414.099) (-2419.895) (-2423.605) -- 0:01:42 384000 -- (-2424.812) (-2412.958) (-2423.419) [-2419.973] * (-2417.265) (-2419.158) [-2417.997] (-2425.870) -- 0:01:42 384500 -- (-2421.538) [-2412.881] (-2423.654) (-2439.096) * [-2418.473] (-2416.893) (-2422.985) (-2429.405) -- 0:01:42 385000 -- (-2414.653) (-2420.555) [-2427.603] (-2419.220) * (-2413.136) [-2418.148] (-2418.781) (-2421.271) -- 0:01:42 Average standard deviation of split frequencies: 0.000916 385500 -- (-2418.868) (-2419.359) (-2418.075) [-2415.208] * [-2419.050] (-2422.469) (-2425.055) (-2424.538) -- 0:01:42 386000 -- (-2415.785) (-2423.801) (-2421.793) [-2418.791] * (-2418.469) (-2420.948) (-2422.600) [-2417.284] -- 0:01:43 386500 -- (-2421.105) (-2419.877) (-2420.282) [-2419.168] * (-2414.703) (-2419.229) [-2416.008] (-2428.199) -- 0:01:43 387000 -- (-2414.936) (-2415.071) [-2418.931] (-2416.753) * (-2422.057) (-2413.276) (-2420.477) [-2419.824] -- 0:01:42 387500 -- (-2418.230) (-2426.600) [-2413.707] (-2418.854) * (-2425.100) [-2415.946] (-2422.193) (-2419.783) -- 0:01:42 388000 -- (-2420.198) [-2420.909] (-2418.336) (-2420.023) * (-2417.122) [-2418.331] (-2425.179) (-2418.040) -- 0:01:42 388500 -- (-2420.570) (-2416.425) [-2412.535] (-2424.061) * (-2413.678) (-2416.795) [-2415.760] (-2429.786) -- 0:01:42 389000 -- (-2422.940) (-2417.354) [-2425.115] (-2420.865) * (-2422.766) (-2416.048) (-2415.696) [-2413.067] -- 0:01:42 389500 -- (-2418.295) (-2412.941) [-2416.749] (-2416.797) * (-2418.408) (-2428.246) [-2417.131] (-2419.094) -- 0:01:41 390000 -- (-2415.777) (-2428.683) (-2417.014) [-2417.835] * (-2422.918) (-2416.405) [-2417.921] (-2428.850) -- 0:01:41 Average standard deviation of split frequencies: 0.001508 390500 -- [-2418.617] (-2418.077) (-2417.366) (-2420.519) * (-2418.684) [-2418.562] (-2420.264) (-2419.114) -- 0:01:41 391000 -- (-2417.652) (-2416.576) [-2423.212] (-2421.272) * (-2416.228) (-2420.755) [-2420.057] (-2421.651) -- 0:01:41 391500 -- [-2423.687] (-2414.728) (-2416.883) (-2429.048) * (-2417.589) (-2413.088) [-2421.561] (-2418.852) -- 0:01:41 392000 -- (-2424.036) (-2412.957) (-2428.922) [-2421.751] * [-2418.239] (-2417.885) (-2419.250) (-2422.398) -- 0:01:42 392500 -- (-2416.533) (-2419.407) [-2415.647] (-2418.019) * [-2418.980] (-2416.449) (-2429.824) (-2419.388) -- 0:01:42 393000 -- [-2417.685] (-2424.649) (-2420.491) (-2420.991) * [-2419.956] (-2417.984) (-2422.887) (-2423.249) -- 0:01:41 393500 -- (-2433.092) (-2423.874) (-2413.635) [-2418.687] * (-2420.834) (-2423.125) (-2426.192) [-2417.762] -- 0:01:41 394000 -- (-2421.953) [-2412.074] (-2417.715) (-2417.469) * (-2420.612) (-2414.688) (-2417.930) [-2418.543] -- 0:01:41 394500 -- (-2424.978) [-2412.945] (-2427.870) (-2420.069) * (-2419.233) [-2414.926] (-2416.443) (-2417.424) -- 0:01:41 395000 -- (-2423.518) [-2415.921] (-2427.986) (-2417.412) * [-2414.582] (-2420.623) (-2418.420) (-2419.740) -- 0:01:41 Average standard deviation of split frequencies: 0.003274 395500 -- [-2413.355] (-2417.079) (-2424.263) (-2419.817) * (-2424.669) (-2412.670) [-2423.906] (-2418.472) -- 0:01:40 396000 -- (-2421.523) (-2421.398) (-2424.811) [-2415.729] * (-2423.454) (-2423.420) (-2415.955) [-2422.097] -- 0:01:40 396500 -- (-2412.339) (-2424.432) [-2418.735] (-2417.254) * [-2412.979] (-2418.204) (-2426.457) (-2416.082) -- 0:01:40 397000 -- (-2418.287) (-2415.266) [-2415.978] (-2420.085) * [-2418.104] (-2419.777) (-2416.595) (-2417.867) -- 0:01:40 397500 -- (-2420.209) (-2414.557) [-2415.221] (-2415.438) * [-2419.810] (-2415.560) (-2415.751) (-2417.078) -- 0:01:40 398000 -- (-2420.436) (-2424.157) (-2417.526) [-2419.084] * (-2418.894) (-2412.532) (-2419.490) [-2418.928] -- 0:01:41 398500 -- (-2425.338) (-2426.177) [-2414.118] (-2424.699) * (-2424.788) (-2416.106) [-2419.615] (-2415.231) -- 0:01:41 399000 -- [-2416.478] (-2418.818) (-2415.768) (-2418.470) * (-2429.108) (-2419.609) (-2423.210) [-2423.681] -- 0:01:40 399500 -- [-2419.724] (-2417.869) (-2418.306) (-2415.991) * (-2421.654) (-2421.039) [-2421.196] (-2422.190) -- 0:01:40 400000 -- (-2419.661) [-2416.802] (-2414.089) (-2422.158) * [-2417.525] (-2420.839) (-2413.100) (-2423.253) -- 0:01:40 Average standard deviation of split frequencies: 0.003236 400500 -- (-2422.184) [-2412.746] (-2415.138) (-2421.287) * (-2415.142) [-2421.798] (-2417.329) (-2420.422) -- 0:01:40 401000 -- (-2422.053) (-2416.372) [-2420.195] (-2424.451) * (-2420.976) (-2417.224) [-2411.584] (-2425.567) -- 0:01:40 401500 -- (-2426.365) (-2416.389) [-2416.387] (-2422.816) * (-2417.229) [-2418.489] (-2418.756) (-2424.683) -- 0:01:39 402000 -- [-2419.801] (-2415.582) (-2418.222) (-2425.271) * (-2420.668) [-2418.376] (-2413.597) (-2421.440) -- 0:01:39 402500 -- [-2422.955] (-2420.386) (-2422.688) (-2418.177) * (-2414.368) (-2420.809) (-2420.761) [-2416.090] -- 0:01:39 403000 -- (-2431.192) (-2414.192) (-2419.663) [-2416.370] * [-2415.994] (-2418.351) (-2435.506) (-2418.737) -- 0:01:39 403500 -- [-2422.567] (-2415.247) (-2422.294) (-2416.973) * (-2416.642) (-2416.757) (-2429.642) [-2416.504] -- 0:01:39 404000 -- [-2415.013] (-2418.875) (-2421.872) (-2418.294) * (-2417.909) (-2423.402) [-2419.790] (-2416.826) -- 0:01:40 404500 -- (-2421.444) (-2427.179) (-2419.711) [-2414.980] * [-2415.053] (-2413.310) (-2414.944) (-2418.760) -- 0:01:40 405000 -- (-2422.902) (-2416.939) [-2417.615] (-2419.794) * (-2413.313) (-2421.746) (-2418.787) [-2417.850] -- 0:01:39 Average standard deviation of split frequencies: 0.004644 405500 -- (-2415.642) (-2415.867) (-2428.902) [-2413.547] * (-2416.336) [-2416.568] (-2417.720) (-2417.031) -- 0:01:39 406000 -- [-2423.126] (-2414.834) (-2424.936) (-2415.656) * (-2417.238) (-2413.564) (-2419.893) [-2416.249] -- 0:01:39 406500 -- (-2421.051) [-2411.662] (-2419.543) (-2420.546) * (-2419.479) (-2412.325) [-2414.400] (-2416.843) -- 0:01:39 407000 -- (-2417.072) (-2424.635) [-2418.551] (-2419.223) * (-2434.828) (-2419.061) (-2416.054) [-2419.464] -- 0:01:39 407500 -- (-2421.838) [-2415.503] (-2421.847) (-2419.090) * (-2424.440) (-2419.818) (-2415.951) [-2420.420] -- 0:01:38 408000 -- (-2416.213) (-2422.205) [-2412.875] (-2419.792) * (-2427.091) (-2420.935) (-2420.439) [-2422.533] -- 0:01:38 408500 -- [-2414.959] (-2415.307) (-2419.070) (-2423.913) * (-2414.477) (-2416.122) (-2417.420) [-2416.729] -- 0:01:38 409000 -- (-2423.143) [-2417.105] (-2415.557) (-2412.815) * (-2424.663) [-2419.627] (-2428.651) (-2423.526) -- 0:01:38 409500 -- (-2427.316) [-2414.065] (-2425.179) (-2414.888) * (-2418.300) (-2418.180) [-2421.307] (-2419.957) -- 0:01:38 410000 -- (-2422.058) (-2412.655) [-2425.315] (-2416.640) * (-2418.668) (-2417.384) (-2431.712) [-2410.687] -- 0:01:37 Average standard deviation of split frequencies: 0.004879 410500 -- (-2419.498) (-2425.343) (-2416.240) [-2418.806] * (-2420.165) [-2423.341] (-2421.841) (-2423.195) -- 0:01:39 411000 -- [-2413.661] (-2422.784) (-2421.379) (-2420.302) * [-2416.685] (-2422.246) (-2416.561) (-2415.051) -- 0:01:38 411500 -- (-2423.653) (-2419.879) [-2414.581] (-2420.181) * (-2421.052) [-2415.172] (-2417.061) (-2423.241) -- 0:01:38 412000 -- (-2423.093) [-2418.664] (-2421.701) (-2419.853) * (-2423.305) [-2418.808] (-2419.671) (-2417.096) -- 0:01:38 412500 -- [-2418.681] (-2420.114) (-2430.395) (-2423.026) * (-2424.702) (-2412.412) (-2418.053) [-2413.383] -- 0:01:38 413000 -- (-2416.334) [-2414.423] (-2415.911) (-2418.821) * [-2417.382] (-2419.660) (-2416.733) (-2419.914) -- 0:01:38 413500 -- (-2412.312) [-2419.149] (-2425.371) (-2417.353) * (-2417.902) (-2419.081) (-2424.557) [-2420.872] -- 0:01:37 414000 -- (-2427.065) (-2415.487) (-2420.862) [-2412.562] * [-2423.736] (-2423.042) (-2422.316) (-2419.185) -- 0:01:37 414500 -- [-2417.184] (-2418.094) (-2420.740) (-2415.212) * (-2423.748) (-2415.198) (-2437.164) [-2418.172] -- 0:01:37 415000 -- (-2422.761) (-2418.481) [-2415.773] (-2417.930) * (-2415.733) (-2422.721) [-2429.857] (-2423.189) -- 0:01:37 Average standard deviation of split frequencies: 0.003116 415500 -- (-2418.720) [-2413.995] (-2418.796) (-2420.014) * (-2417.150) [-2413.504] (-2421.436) (-2423.004) -- 0:01:37 416000 -- [-2420.824] (-2416.388) (-2416.324) (-2421.810) * [-2415.934] (-2416.698) (-2423.081) (-2418.396) -- 0:01:36 416500 -- (-2413.146) [-2423.596] (-2421.312) (-2420.018) * (-2416.790) (-2417.963) (-2422.306) [-2421.691] -- 0:01:38 417000 -- [-2418.719] (-2414.529) (-2422.277) (-2415.063) * (-2419.595) [-2420.159] (-2419.315) (-2429.284) -- 0:01:37 417500 -- (-2419.123) (-2416.398) [-2418.916] (-2416.970) * (-2411.397) (-2421.445) (-2416.419) [-2417.227] -- 0:01:37 418000 -- (-2420.823) (-2415.532) (-2416.672) [-2425.408] * [-2415.163] (-2417.197) (-2433.092) (-2418.113) -- 0:01:37 418500 -- (-2421.240) [-2415.746] (-2423.815) (-2416.636) * [-2415.763] (-2416.907) (-2418.181) (-2421.449) -- 0:01:37 419000 -- (-2430.430) (-2422.692) (-2422.541) [-2414.183] * (-2416.587) (-2417.882) [-2415.749] (-2414.704) -- 0:01:37 419500 -- (-2417.816) (-2418.826) (-2421.919) [-2410.460] * (-2413.776) (-2419.474) (-2415.907) [-2416.499] -- 0:01:36 420000 -- (-2421.730) [-2415.287] (-2420.393) (-2426.297) * (-2419.345) [-2415.547] (-2413.828) (-2416.616) -- 0:01:36 Average standard deviation of split frequencies: 0.002521 420500 -- (-2424.021) (-2419.171) [-2418.736] (-2416.474) * (-2420.612) (-2419.093) (-2421.398) [-2417.652] -- 0:01:36 421000 -- (-2423.163) (-2416.532) (-2424.971) [-2417.102] * (-2411.307) (-2417.795) (-2419.785) [-2416.591] -- 0:01:36 421500 -- (-2421.853) (-2428.346) [-2412.465] (-2418.834) * [-2421.942] (-2420.156) (-2418.280) (-2417.413) -- 0:01:36 422000 -- (-2423.313) (-2420.331) (-2417.018) [-2420.968] * (-2414.538) (-2422.671) (-2412.252) [-2418.497] -- 0:01:35 422500 -- (-2423.054) (-2415.017) (-2415.778) [-2418.529] * (-2412.908) (-2430.301) (-2420.823) [-2423.432] -- 0:01:37 423000 -- (-2426.774) (-2415.256) (-2426.138) [-2419.171] * (-2421.834) [-2414.230] (-2420.265) (-2425.029) -- 0:01:36 423500 -- (-2422.516) [-2418.595] (-2418.837) (-2423.881) * [-2413.194] (-2425.059) (-2420.408) (-2416.028) -- 0:01:36 424000 -- [-2430.232] (-2422.556) (-2412.659) (-2419.191) * (-2417.920) (-2414.731) (-2419.108) [-2415.070] -- 0:01:36 424500 -- (-2425.347) (-2419.264) [-2414.443] (-2416.954) * (-2413.625) (-2412.307) [-2418.154] (-2427.549) -- 0:01:36 425000 -- [-2414.018] (-2420.063) (-2420.544) (-2420.847) * (-2411.900) (-2413.405) [-2413.121] (-2421.890) -- 0:01:36 Average standard deviation of split frequencies: 0.002213 425500 -- [-2415.015] (-2428.010) (-2426.661) (-2415.566) * (-2417.978) [-2412.311] (-2415.784) (-2423.426) -- 0:01:35 426000 -- (-2414.118) (-2421.462) (-2418.522) [-2415.407] * (-2421.369) (-2419.138) [-2422.544] (-2420.125) -- 0:01:35 426500 -- (-2418.127) (-2416.255) [-2412.392] (-2422.213) * (-2427.137) (-2413.854) [-2417.537] (-2418.007) -- 0:01:35 427000 -- (-2419.063) [-2416.545] (-2418.033) (-2416.522) * (-2411.871) (-2421.487) [-2411.259] (-2428.324) -- 0:01:35 427500 -- (-2424.503) [-2418.807] (-2422.274) (-2420.846) * [-2423.347] (-2426.760) (-2419.966) (-2427.044) -- 0:01:35 428000 -- (-2422.601) (-2420.962) [-2416.669] (-2423.851) * (-2418.884) [-2420.603] (-2425.416) (-2418.011) -- 0:01:34 428500 -- (-2427.327) [-2425.177] (-2427.664) (-2418.911) * (-2419.665) (-2425.359) (-2422.146) [-2415.979] -- 0:01:36 429000 -- (-2422.285) (-2420.689) [-2420.098] (-2419.021) * (-2424.174) (-2424.069) (-2424.447) [-2416.565] -- 0:01:35 429500 -- (-2420.206) [-2420.016] (-2423.624) (-2418.555) * [-2419.429] (-2418.751) (-2418.663) (-2422.364) -- 0:01:35 430000 -- (-2419.925) (-2420.026) (-2422.590) [-2416.330] * (-2423.882) [-2418.714] (-2420.790) (-2425.710) -- 0:01:35 Average standard deviation of split frequencies: 0.002189 430500 -- (-2414.957) (-2418.384) [-2419.377] (-2422.014) * (-2418.398) [-2416.013] (-2419.204) (-2414.320) -- 0:01:35 431000 -- (-2412.612) (-2421.163) [-2419.201] (-2417.479) * (-2412.513) (-2419.204) [-2418.093] (-2425.564) -- 0:01:35 431500 -- [-2423.853] (-2418.215) (-2419.412) (-2419.565) * (-2421.824) [-2416.468] (-2414.524) (-2422.238) -- 0:01:34 432000 -- (-2417.292) (-2421.384) [-2416.925] (-2416.110) * [-2416.572] (-2418.392) (-2419.241) (-2420.655) -- 0:01:34 432500 -- (-2417.772) (-2418.741) (-2418.197) [-2427.246] * [-2417.025] (-2419.969) (-2415.302) (-2416.091) -- 0:01:34 433000 -- (-2421.794) (-2427.049) [-2419.335] (-2421.079) * (-2415.130) (-2420.953) [-2414.855] (-2414.131) -- 0:01:34 433500 -- [-2420.753] (-2422.299) (-2413.963) (-2417.581) * [-2411.810] (-2420.589) (-2415.749) (-2422.754) -- 0:01:34 434000 -- (-2414.949) [-2419.655] (-2419.987) (-2418.597) * (-2416.098) (-2421.760) (-2416.953) [-2419.559] -- 0:01:33 434500 -- (-2418.803) (-2424.237) [-2416.567] (-2422.364) * (-2415.879) [-2426.618] (-2417.375) (-2415.676) -- 0:01:35 435000 -- [-2420.234] (-2421.325) (-2416.975) (-2427.985) * (-2418.047) [-2416.648] (-2422.558) (-2430.456) -- 0:01:34 Average standard deviation of split frequencies: 0.002162 435500 -- (-2413.316) (-2417.942) (-2414.607) [-2424.775] * (-2418.086) (-2420.096) (-2416.800) [-2412.216] -- 0:01:34 436000 -- (-2414.485) (-2422.163) (-2420.276) [-2415.586] * (-2419.135) (-2428.222) (-2418.499) [-2418.405] -- 0:01:34 436500 -- (-2419.408) (-2420.684) (-2415.316) [-2414.870] * (-2421.377) [-2427.744] (-2417.948) (-2420.507) -- 0:01:34 437000 -- (-2414.310) (-2420.764) (-2417.077) [-2419.812] * (-2417.116) (-2416.549) [-2419.942] (-2422.250) -- 0:01:34 437500 -- [-2417.994] (-2419.518) (-2420.820) (-2414.466) * (-2424.739) [-2419.257] (-2425.500) (-2417.410) -- 0:01:33 438000 -- (-2415.556) [-2418.517] (-2415.193) (-2425.163) * (-2412.563) (-2422.263) [-2414.974] (-2419.948) -- 0:01:33 438500 -- (-2415.443) (-2418.843) [-2420.258] (-2421.022) * (-2416.475) [-2412.713] (-2426.744) (-2421.469) -- 0:01:33 439000 -- [-2414.676] (-2426.336) (-2413.344) (-2420.792) * (-2425.173) (-2419.552) [-2414.264] (-2422.575) -- 0:01:33 439500 -- (-2423.033) (-2419.337) (-2419.377) [-2421.083] * [-2418.333] (-2421.828) (-2417.093) (-2422.650) -- 0:01:33 440000 -- [-2420.860] (-2426.231) (-2414.820) (-2421.558) * (-2423.677) [-2423.482] (-2425.098) (-2418.201) -- 0:01:32 Average standard deviation of split frequencies: 0.004546 440500 -- (-2417.843) (-2422.309) (-2424.552) [-2418.899] * (-2424.746) [-2418.715] (-2416.251) (-2414.457) -- 0:01:33 441000 -- (-2425.728) [-2422.342] (-2419.464) (-2422.513) * (-2423.990) (-2422.767) [-2416.149] (-2414.294) -- 0:01:33 441500 -- (-2416.535) (-2426.045) [-2421.792] (-2412.922) * (-2415.414) (-2415.067) [-2413.787] (-2415.030) -- 0:01:33 442000 -- (-2418.123) (-2422.190) (-2414.426) [-2412.181] * (-2416.480) [-2412.592] (-2417.575) (-2418.345) -- 0:01:33 442500 -- (-2420.777) (-2423.042) (-2419.372) [-2416.794] * (-2422.120) (-2420.811) [-2413.910] (-2421.478) -- 0:01:33 443000 -- (-2419.643) (-2426.555) (-2416.345) [-2423.479] * (-2417.702) (-2424.801) [-2422.520] (-2420.541) -- 0:01:33 443500 -- (-2424.888) (-2427.831) [-2415.712] (-2416.812) * (-2425.107) (-2416.386) [-2420.302] (-2423.049) -- 0:01:32 444000 -- (-2416.644) [-2419.774] (-2423.751) (-2411.672) * (-2423.469) (-2420.125) [-2418.003] (-2415.265) -- 0:01:32 444500 -- (-2419.753) (-2421.249) (-2421.858) [-2410.947] * [-2414.089] (-2415.093) (-2413.050) (-2418.992) -- 0:01:32 445000 -- [-2418.567] (-2418.265) (-2417.594) (-2422.890) * [-2419.021] (-2417.805) (-2423.756) (-2428.522) -- 0:01:32 Average standard deviation of split frequencies: 0.004492 445500 -- (-2422.353) (-2416.315) (-2422.722) [-2419.291] * (-2418.219) [-2418.827] (-2424.373) (-2417.524) -- 0:01:32 446000 -- (-2427.941) [-2418.729] (-2422.276) (-2420.140) * (-2426.225) (-2418.610) [-2416.636] (-2419.635) -- 0:01:31 446500 -- (-2417.506) (-2417.274) (-2418.536) [-2418.740] * (-2416.339) (-2419.015) [-2420.343] (-2414.186) -- 0:01:31 447000 -- (-2423.257) [-2419.158] (-2422.520) (-2423.532) * (-2415.496) [-2420.965] (-2420.711) (-2423.669) -- 0:01:32 447500 -- [-2414.407] (-2415.328) (-2414.453) (-2419.838) * (-2427.214) (-2425.268) [-2422.525] (-2421.593) -- 0:01:32 448000 -- (-2413.352) (-2415.979) (-2413.268) [-2416.401] * [-2415.619] (-2416.434) (-2428.931) (-2420.772) -- 0:01:32 448500 -- (-2425.304) (-2426.539) (-2417.470) [-2418.542] * (-2415.714) (-2421.417) [-2413.755] (-2415.359) -- 0:01:32 449000 -- (-2428.031) [-2421.626] (-2416.414) (-2424.756) * (-2418.114) (-2425.242) [-2419.926] (-2418.361) -- 0:01:32 449500 -- (-2423.473) (-2427.144) (-2417.304) [-2416.573] * [-2416.166] (-2418.724) (-2418.238) (-2424.906) -- 0:01:31 450000 -- (-2418.507) [-2425.156] (-2416.718) (-2431.385) * [-2423.989] (-2423.305) (-2421.617) (-2420.628) -- 0:01:31 Average standard deviation of split frequencies: 0.005230 450500 -- [-2420.843] (-2424.647) (-2418.457) (-2418.997) * (-2417.653) (-2420.167) (-2420.147) [-2417.560] -- 0:01:31 451000 -- (-2421.935) (-2419.801) (-2415.517) [-2417.247] * (-2422.639) [-2418.406] (-2420.441) (-2414.081) -- 0:01:31 451500 -- [-2416.500] (-2421.972) (-2413.207) (-2419.487) * [-2418.699] (-2412.292) (-2422.437) (-2413.495) -- 0:01:31 452000 -- [-2413.351] (-2417.313) (-2421.081) (-2416.110) * (-2417.892) (-2420.826) [-2420.850] (-2420.529) -- 0:01:30 452500 -- [-2411.398] (-2419.864) (-2416.554) (-2410.734) * (-2417.761) [-2417.516] (-2417.843) (-2417.854) -- 0:01:31 453000 -- (-2413.678) (-2419.447) (-2419.934) [-2427.681] * (-2413.736) (-2418.447) [-2419.018] (-2420.589) -- 0:01:31 453500 -- (-2417.051) (-2422.917) (-2416.878) [-2414.412] * [-2414.987] (-2419.074) (-2419.171) (-2420.937) -- 0:01:31 454000 -- [-2417.890] (-2423.197) (-2425.550) (-2419.260) * [-2420.215] (-2414.366) (-2421.220) (-2421.210) -- 0:01:31 454500 -- (-2419.012) [-2416.915] (-2424.744) (-2415.529) * (-2419.208) (-2417.717) [-2417.540] (-2422.441) -- 0:01:31 455000 -- [-2417.479] (-2423.733) (-2421.725) (-2421.752) * (-2415.364) (-2415.366) (-2418.534) [-2415.106] -- 0:01:31 Average standard deviation of split frequencies: 0.005427 455500 -- (-2415.627) (-2422.174) [-2424.022] (-2412.266) * (-2416.802) (-2419.939) [-2423.048] (-2417.510) -- 0:01:30 456000 -- (-2418.290) (-2427.856) (-2425.579) [-2413.434] * (-2420.725) (-2416.350) [-2419.059] (-2414.481) -- 0:01:30 456500 -- (-2420.201) (-2419.614) [-2413.662] (-2416.068) * [-2419.379] (-2424.442) (-2420.034) (-2423.373) -- 0:01:30 457000 -- (-2421.898) (-2422.678) (-2417.993) [-2419.196] * [-2415.734] (-2415.839) (-2414.543) (-2413.033) -- 0:01:30 457500 -- (-2418.795) [-2417.904] (-2422.376) (-2423.529) * [-2421.340] (-2422.065) (-2413.061) (-2419.326) -- 0:01:30 458000 -- (-2425.780) (-2420.155) [-2418.095] (-2422.250) * [-2417.738] (-2423.434) (-2420.910) (-2422.960) -- 0:01:29 458500 -- (-2424.702) (-2415.047) (-2414.689) [-2413.651] * [-2419.013] (-2425.868) (-2416.146) (-2415.576) -- 0:01:30 459000 -- (-2420.697) [-2420.127] (-2416.476) (-2420.903) * [-2413.687] (-2420.424) (-2414.894) (-2415.446) -- 0:01:30 459500 -- (-2415.967) (-2423.687) (-2435.089) [-2417.416] * (-2415.538) (-2421.722) [-2417.299] (-2425.601) -- 0:01:30 460000 -- (-2418.901) (-2411.792) (-2422.932) [-2426.955] * (-2418.517) (-2416.874) (-2416.206) [-2419.943] -- 0:01:30 Average standard deviation of split frequencies: 0.004605 460500 -- (-2423.104) (-2420.854) [-2413.591] (-2418.042) * (-2422.917) [-2419.101] (-2419.611) (-2427.382) -- 0:01:30 461000 -- (-2418.941) (-2412.863) (-2412.871) [-2413.921] * (-2416.464) (-2422.430) [-2419.083] (-2419.186) -- 0:01:30 461500 -- [-2420.404] (-2426.521) (-2415.611) (-2415.774) * (-2419.077) (-2425.856) (-2416.473) [-2415.065] -- 0:01:29 462000 -- (-2421.118) (-2420.201) (-2423.072) [-2417.364] * (-2418.241) [-2411.265] (-2412.847) (-2422.778) -- 0:01:29 462500 -- [-2421.736] (-2421.690) (-2418.239) (-2421.773) * [-2414.649] (-2417.861) (-2418.263) (-2418.457) -- 0:01:29 463000 -- (-2416.045) (-2420.528) [-2417.015] (-2419.366) * (-2424.066) (-2425.115) (-2416.511) [-2415.652] -- 0:01:29 463500 -- (-2417.169) (-2422.915) [-2417.260] (-2415.216) * (-2419.951) (-2421.845) [-2415.272] (-2420.357) -- 0:01:29 464000 -- (-2414.877) (-2427.916) [-2417.082] (-2419.049) * [-2420.926] (-2422.431) (-2412.466) (-2421.664) -- 0:01:28 464500 -- (-2423.154) [-2421.522] (-2422.071) (-2420.767) * [-2413.051] (-2419.971) (-2415.394) (-2421.847) -- 0:01:29 465000 -- (-2421.836) [-2416.297] (-2414.614) (-2422.417) * (-2420.159) (-2422.291) [-2417.000] (-2422.506) -- 0:01:29 Average standard deviation of split frequencies: 0.005058 465500 -- [-2420.563] (-2421.108) (-2420.154) (-2422.673) * (-2417.079) (-2416.374) (-2414.132) [-2429.279] -- 0:01:29 466000 -- [-2414.931] (-2424.695) (-2425.432) (-2422.759) * (-2412.581) [-2422.195] (-2418.255) (-2416.890) -- 0:01:29 466500 -- (-2422.056) (-2418.331) (-2417.890) [-2414.688] * [-2414.521] (-2415.025) (-2416.043) (-2417.569) -- 0:01:29 467000 -- (-2418.235) (-2415.214) (-2422.065) [-2423.905] * (-2414.826) (-2417.585) (-2409.132) [-2415.311] -- 0:01:29 467500 -- (-2420.471) [-2416.184] (-2416.660) (-2422.965) * (-2415.934) (-2422.524) (-2413.207) [-2412.979] -- 0:01:28 468000 -- [-2420.627] (-2414.735) (-2411.723) (-2426.109) * (-2417.014) (-2422.501) (-2413.947) [-2416.441] -- 0:01:28 468500 -- (-2418.552) [-2419.886] (-2425.912) (-2430.241) * (-2410.769) (-2424.685) (-2418.281) [-2419.903] -- 0:01:28 469000 -- (-2416.822) [-2411.500] (-2414.195) (-2424.452) * (-2416.590) [-2420.475] (-2417.124) (-2417.541) -- 0:01:28 469500 -- (-2418.006) (-2417.355) [-2418.400] (-2418.787) * (-2419.642) [-2417.884] (-2415.269) (-2422.663) -- 0:01:28 470000 -- [-2416.719] (-2419.690) (-2419.877) (-2423.270) * [-2412.646] (-2418.693) (-2417.483) (-2418.848) -- 0:01:27 Average standard deviation of split frequencies: 0.006761 470500 -- (-2418.340) [-2420.279] (-2413.944) (-2428.992) * (-2415.408) [-2417.391] (-2416.232) (-2415.052) -- 0:01:28 471000 -- (-2417.418) (-2415.499) [-2415.828] (-2420.992) * (-2412.975) (-2418.034) [-2417.747] (-2414.219) -- 0:01:28 471500 -- (-2413.946) (-2414.767) [-2416.998] (-2429.787) * (-2420.095) (-2420.718) (-2415.253) [-2413.521] -- 0:01:28 472000 -- (-2415.737) [-2416.829] (-2421.531) (-2423.524) * (-2413.185) (-2419.534) [-2418.415] (-2411.352) -- 0:01:28 472500 -- (-2422.167) (-2420.011) (-2419.566) [-2417.840] * [-2410.461] (-2421.748) (-2418.217) (-2414.049) -- 0:01:28 473000 -- (-2416.125) [-2417.629] (-2423.132) (-2422.627) * [-2413.306] (-2411.433) (-2418.292) (-2424.331) -- 0:01:28 473500 -- (-2417.206) (-2414.265) (-2420.318) [-2413.995] * (-2414.815) (-2417.242) (-2415.990) [-2420.186] -- 0:01:27 474000 -- (-2413.786) (-2419.623) (-2418.926) [-2418.211] * (-2423.362) (-2417.617) [-2414.858] (-2416.275) -- 0:01:27 474500 -- (-2414.518) (-2424.779) (-2418.387) [-2416.002] * [-2415.156] (-2419.490) (-2421.759) (-2419.188) -- 0:01:27 475000 -- (-2417.104) [-2420.161] (-2421.603) (-2419.440) * (-2420.639) (-2420.216) [-2420.996] (-2421.435) -- 0:01:27 Average standard deviation of split frequencies: 0.005447 475500 -- [-2418.351] (-2418.873) (-2421.996) (-2416.423) * (-2419.945) (-2419.986) (-2419.520) [-2415.935] -- 0:01:27 476000 -- (-2416.953) (-2415.121) (-2421.730) [-2416.117] * (-2414.837) [-2415.542] (-2423.341) (-2417.127) -- 0:01:28 476500 -- (-2416.172) [-2416.108] (-2418.088) (-2415.934) * (-2424.074) (-2421.004) [-2418.696] (-2424.259) -- 0:01:27 477000 -- [-2414.617] (-2414.884) (-2423.338) (-2423.099) * [-2410.396] (-2425.791) (-2423.146) (-2429.752) -- 0:01:27 477500 -- (-2423.085) [-2414.548] (-2423.654) (-2417.494) * (-2422.884) [-2421.902] (-2417.939) (-2423.236) -- 0:01:27 478000 -- [-2418.658] (-2412.003) (-2421.266) (-2421.423) * (-2421.805) (-2415.967) (-2419.131) [-2416.447] -- 0:01:27 478500 -- [-2417.224] (-2412.592) (-2421.581) (-2423.679) * (-2423.636) (-2421.584) [-2422.466] (-2419.196) -- 0:01:27 479000 -- (-2417.010) [-2421.485] (-2418.632) (-2418.904) * (-2424.342) [-2418.611] (-2421.203) (-2421.426) -- 0:01:27 479500 -- (-2423.662) [-2416.528] (-2417.453) (-2430.519) * (-2434.219) (-2416.104) [-2418.729] (-2423.332) -- 0:01:26 480000 -- [-2416.601] (-2420.568) (-2423.869) (-2425.044) * (-2419.842) (-2418.010) (-2416.261) [-2413.556] -- 0:01:26 Average standard deviation of split frequencies: 0.006130 480500 -- [-2418.228] (-2417.050) (-2424.049) (-2421.377) * (-2416.761) (-2426.286) (-2412.545) [-2418.655] -- 0:01:26 481000 -- (-2424.010) (-2412.295) [-2415.911] (-2413.153) * (-2416.538) (-2423.687) [-2413.981] (-2423.888) -- 0:01:26 481500 -- [-2417.096] (-2420.087) (-2416.903) (-2415.892) * (-2417.122) (-2424.413) [-2418.429] (-2426.766) -- 0:01:26 482000 -- (-2418.950) [-2428.209] (-2416.367) (-2420.632) * [-2414.662] (-2420.011) (-2417.765) (-2423.021) -- 0:01:27 482500 -- (-2417.264) [-2426.932] (-2422.356) (-2416.307) * (-2415.312) (-2424.478) (-2420.022) [-2424.240] -- 0:01:26 483000 -- (-2416.269) [-2422.483] (-2419.278) (-2413.359) * (-2423.645) (-2422.753) [-2419.710] (-2420.514) -- 0:01:26 483500 -- (-2424.283) (-2412.169) (-2420.009) [-2414.931] * (-2422.019) [-2421.866] (-2417.154) (-2423.071) -- 0:01:26 484000 -- (-2426.790) (-2417.724) [-2423.045] (-2416.720) * (-2421.234) [-2424.315] (-2416.553) (-2420.145) -- 0:01:26 484500 -- [-2417.404] (-2420.586) (-2421.917) (-2424.590) * (-2426.356) [-2417.795] (-2416.669) (-2419.549) -- 0:01:26 485000 -- (-2425.539) (-2420.441) [-2418.247] (-2433.986) * (-2425.062) (-2413.980) [-2418.948] (-2422.204) -- 0:01:26 Average standard deviation of split frequencies: 0.005577 485500 -- (-2413.497) (-2421.756) [-2425.965] (-2417.746) * (-2421.380) (-2419.495) (-2421.836) [-2415.916] -- 0:01:25 486000 -- (-2422.850) [-2416.012] (-2428.320) (-2415.457) * [-2419.041] (-2420.197) (-2421.951) (-2417.778) -- 0:01:25 486500 -- (-2426.027) (-2424.430) (-2431.946) [-2415.237] * (-2423.700) (-2419.690) [-2414.279] (-2428.555) -- 0:01:25 487000 -- (-2421.526) (-2422.331) (-2422.229) [-2412.163] * [-2416.631] (-2419.444) (-2420.354) (-2423.872) -- 0:01:25 487500 -- (-2420.045) (-2419.230) [-2422.814] (-2417.222) * (-2426.530) (-2427.806) [-2415.855] (-2424.940) -- 0:01:25 488000 -- [-2419.794] (-2422.323) (-2422.730) (-2419.744) * (-2420.254) (-2418.362) (-2411.931) [-2415.902] -- 0:01:26 488500 -- (-2421.872) (-2415.832) [-2416.547] (-2425.929) * (-2413.373) (-2415.177) (-2422.443) [-2421.296] -- 0:01:25 489000 -- (-2417.730) (-2418.033) (-2416.248) [-2421.318] * (-2420.814) (-2415.213) (-2417.772) [-2421.476] -- 0:01:25 489500 -- (-2416.053) (-2419.712) [-2416.743] (-2415.083) * [-2419.565] (-2416.713) (-2425.414) (-2420.452) -- 0:01:25 490000 -- (-2422.212) (-2423.094) [-2417.361] (-2420.871) * [-2420.851] (-2415.787) (-2414.271) (-2415.517) -- 0:01:25 Average standard deviation of split frequencies: 0.006725 490500 -- [-2416.967] (-2420.508) (-2420.385) (-2427.454) * (-2417.439) (-2417.449) (-2418.876) [-2419.455] -- 0:01:25 491000 -- (-2418.407) (-2416.337) (-2428.150) [-2415.925] * [-2415.171] (-2413.285) (-2420.077) (-2416.824) -- 0:01:25 491500 -- [-2419.062] (-2421.514) (-2419.958) (-2416.085) * (-2423.251) (-2421.925) [-2413.562] (-2413.835) -- 0:01:24 492000 -- (-2435.243) (-2426.907) (-2415.242) [-2421.279] * (-2419.403) (-2422.708) [-2412.850] (-2424.690) -- 0:01:24 492500 -- [-2420.193] (-2413.856) (-2415.488) (-2420.842) * (-2418.423) (-2418.267) [-2413.449] (-2416.843) -- 0:01:24 493000 -- (-2417.034) (-2422.527) (-2422.143) [-2413.921] * [-2418.142] (-2422.106) (-2419.450) (-2419.839) -- 0:01:24 493500 -- [-2413.083] (-2422.566) (-2423.875) (-2413.475) * (-2412.700) (-2416.422) (-2419.576) [-2421.329] -- 0:01:24 494000 -- (-2420.078) (-2416.994) (-2424.778) [-2416.841] * [-2420.206] (-2422.944) (-2423.678) (-2423.208) -- 0:01:23 494500 -- (-2427.781) (-2424.429) (-2416.285) [-2422.803] * (-2420.290) (-2413.809) (-2422.154) [-2415.601] -- 0:01:24 495000 -- (-2420.127) (-2418.953) (-2425.175) [-2419.072] * [-2413.642] (-2424.361) (-2421.189) (-2414.359) -- 0:01:24 Average standard deviation of split frequencies: 0.006890 495500 -- (-2418.085) (-2417.881) (-2418.259) [-2418.570] * [-2413.155] (-2416.890) (-2431.208) (-2419.336) -- 0:01:24 496000 -- (-2417.102) (-2412.553) (-2418.736) [-2417.404] * (-2418.490) [-2421.850] (-2416.801) (-2410.468) -- 0:01:24 496500 -- (-2413.734) (-2417.173) (-2418.624) [-2416.381] * (-2415.051) (-2420.444) (-2421.577) [-2415.706] -- 0:01:24 497000 -- (-2415.842) (-2425.647) [-2416.690] (-2418.728) * (-2426.266) (-2421.684) [-2416.874] (-2425.343) -- 0:01:24 497500 -- (-2415.479) (-2416.598) (-2416.525) [-2415.076] * (-2425.341) [-2416.554] (-2417.735) (-2417.551) -- 0:01:23 498000 -- [-2415.112] (-2425.548) (-2422.480) (-2418.804) * (-2425.776) [-2415.910] (-2430.286) (-2417.140) -- 0:01:23 498500 -- [-2411.278] (-2417.586) (-2419.150) (-2415.194) * (-2425.632) (-2418.884) (-2422.766) [-2414.850] -- 0:01:23 499000 -- (-2418.682) (-2422.206) [-2419.517] (-2414.767) * (-2421.571) (-2421.527) [-2419.283] (-2421.872) -- 0:01:23 499500 -- [-2415.090] (-2425.354) (-2418.229) (-2418.128) * [-2422.253] (-2422.188) (-2414.112) (-2417.912) -- 0:01:23 500000 -- (-2422.887) (-2412.807) (-2427.480) [-2416.938] * (-2426.682) (-2420.089) [-2423.059] (-2420.996) -- 0:01:23 Average standard deviation of split frequencies: 0.006826 500500 -- [-2422.262] (-2423.049) (-2418.354) (-2417.903) * (-2417.269) [-2415.182] (-2413.889) (-2418.854) -- 0:01:23 501000 -- (-2418.896) (-2413.232) (-2423.515) [-2422.163] * (-2421.106) (-2416.603) [-2414.719] (-2425.691) -- 0:01:23 501500 -- (-2427.119) (-2419.330) (-2422.765) [-2416.819] * (-2416.556) (-2421.165) (-2415.713) [-2416.640] -- 0:01:23 502000 -- (-2419.947) [-2422.031] (-2423.157) (-2417.404) * (-2419.865) (-2425.471) (-2417.821) [-2414.981] -- 0:01:23 502500 -- (-2418.472) (-2412.084) [-2420.690] (-2420.459) * (-2425.628) (-2426.430) [-2420.065] (-2415.491) -- 0:01:23 503000 -- (-2415.203) [-2418.169] (-2419.638) (-2415.550) * (-2417.087) (-2423.603) (-2418.809) [-2419.196] -- 0:01:22 503500 -- (-2423.893) (-2419.100) (-2421.082) [-2417.817] * (-2422.761) [-2417.046] (-2424.544) (-2417.636) -- 0:01:22 504000 -- (-2417.668) (-2419.238) (-2417.681) [-2414.332] * (-2418.652) (-2425.390) (-2416.840) [-2414.423] -- 0:01:22 504500 -- [-2418.081] (-2417.101) (-2425.360) (-2416.843) * (-2416.854) (-2424.136) [-2418.401] (-2425.899) -- 0:01:22 505000 -- (-2419.015) (-2418.006) (-2415.401) [-2415.091] * [-2418.394] (-2417.975) (-2416.387) (-2419.408) -- 0:01:22 Average standard deviation of split frequencies: 0.007220 505500 -- (-2424.325) (-2419.698) [-2415.518] (-2425.936) * (-2425.594) (-2423.343) [-2417.876] (-2418.553) -- 0:01:22 506000 -- (-2417.456) [-2420.460] (-2421.498) (-2423.406) * [-2417.154] (-2414.849) (-2422.876) (-2421.987) -- 0:01:22 506500 -- (-2420.322) [-2418.533] (-2416.212) (-2423.954) * [-2418.623] (-2420.019) (-2417.451) (-2421.198) -- 0:01:22 507000 -- (-2426.754) [-2414.292] (-2413.719) (-2420.003) * (-2414.650) [-2416.449] (-2424.280) (-2421.127) -- 0:01:22 507500 -- (-2419.336) (-2411.323) (-2421.119) [-2423.721] * [-2421.588] (-2418.774) (-2412.161) (-2423.718) -- 0:01:22 508000 -- (-2414.827) (-2418.538) [-2425.865] (-2419.957) * (-2427.410) [-2414.863] (-2422.561) (-2417.346) -- 0:01:22 508500 -- (-2424.764) [-2417.436] (-2416.138) (-2422.006) * (-2417.478) (-2418.753) [-2418.508] (-2422.446) -- 0:01:22 509000 -- (-2420.676) [-2420.026] (-2426.631) (-2421.145) * (-2423.011) (-2423.595) [-2422.383] (-2419.167) -- 0:01:21 509500 -- [-2420.869] (-2417.286) (-2422.835) (-2412.180) * (-2432.934) (-2423.798) [-2418.880] (-2418.005) -- 0:01:21 510000 -- (-2424.627) [-2410.408] (-2425.760) (-2420.262) * (-2422.247) [-2414.084] (-2422.717) (-2421.040) -- 0:01:21 Average standard deviation of split frequencies: 0.006923 510500 -- (-2414.398) [-2420.403] (-2429.952) (-2415.434) * (-2414.425) (-2417.946) (-2417.787) [-2412.893] -- 0:01:21 511000 -- [-2417.079] (-2416.381) (-2426.058) (-2419.473) * (-2418.993) [-2415.365] (-2415.524) (-2416.847) -- 0:01:21 511500 -- (-2418.761) (-2427.864) [-2422.859] (-2416.765) * (-2425.342) (-2422.933) [-2416.398] (-2411.952) -- 0:01:21 512000 -- (-2423.526) [-2416.671] (-2414.327) (-2419.286) * (-2421.854) (-2416.189) (-2417.166) [-2414.693] -- 0:01:21 512500 -- (-2413.988) (-2416.827) [-2415.179] (-2415.308) * (-2416.913) [-2415.431] (-2420.834) (-2422.705) -- 0:01:21 513000 -- (-2417.872) [-2420.716] (-2418.202) (-2415.235) * (-2420.589) (-2420.615) [-2417.196] (-2420.716) -- 0:01:21 513500 -- (-2419.715) (-2417.869) (-2416.553) [-2417.260] * (-2420.208) (-2420.422) [-2416.234] (-2416.131) -- 0:01:21 514000 -- (-2422.111) (-2423.080) [-2416.690] (-2417.741) * [-2422.876] (-2427.589) (-2418.539) (-2423.133) -- 0:01:21 514500 -- (-2418.657) (-2422.772) (-2412.843) [-2419.170] * (-2424.024) (-2435.929) (-2420.305) [-2413.493] -- 0:01:21 515000 -- (-2418.668) [-2417.371] (-2416.038) (-2414.756) * (-2423.494) (-2430.469) [-2417.219] (-2420.436) -- 0:01:20 Average standard deviation of split frequencies: 0.005938 515500 -- (-2424.309) (-2414.141) (-2420.639) [-2413.379] * [-2415.029] (-2425.451) (-2427.972) (-2419.194) -- 0:01:20 516000 -- (-2421.054) [-2422.193] (-2416.283) (-2421.187) * [-2420.022] (-2426.129) (-2417.781) (-2415.592) -- 0:01:20 516500 -- (-2415.145) [-2417.060] (-2415.112) (-2415.568) * (-2415.449) [-2422.741] (-2416.366) (-2425.949) -- 0:01:20 517000 -- (-2418.273) [-2414.190] (-2419.286) (-2422.138) * (-2418.796) (-2418.791) (-2425.836) [-2419.591] -- 0:01:20 517500 -- (-2416.417) [-2414.273] (-2420.011) (-2418.921) * (-2420.947) (-2420.937) (-2425.512) [-2417.497] -- 0:01:20 518000 -- (-2414.789) (-2427.168) [-2417.755] (-2421.547) * [-2422.627] (-2419.124) (-2418.051) (-2418.301) -- 0:01:20 518500 -- (-2414.280) [-2413.086] (-2424.001) (-2419.805) * (-2420.083) [-2413.681] (-2422.166) (-2420.158) -- 0:01:20 519000 -- [-2413.489] (-2412.215) (-2423.769) (-2415.933) * (-2416.057) [-2415.214] (-2422.323) (-2417.251) -- 0:01:20 519500 -- [-2415.483] (-2428.010) (-2422.131) (-2415.013) * [-2422.118] (-2417.986) (-2423.326) (-2423.553) -- 0:01:20 520000 -- (-2421.489) (-2418.854) [-2421.589] (-2418.568) * (-2420.862) (-2426.202) (-2417.671) [-2418.665] -- 0:01:20 Average standard deviation of split frequencies: 0.006111 520500 -- (-2415.173) (-2426.851) (-2416.570) [-2423.186] * [-2417.711] (-2420.704) (-2420.363) (-2421.604) -- 0:01:20 521000 -- (-2427.070) (-2424.494) [-2418.075] (-2416.679) * (-2420.104) (-2420.652) (-2420.914) [-2423.666] -- 0:01:19 521500 -- (-2421.006) (-2429.216) (-2415.278) [-2416.642] * [-2421.496] (-2419.191) (-2421.705) (-2420.634) -- 0:01:19 522000 -- (-2422.982) (-2421.049) (-2426.009) [-2420.501] * [-2420.029] (-2422.048) (-2423.148) (-2415.319) -- 0:01:19 522500 -- [-2412.951] (-2415.920) (-2419.893) (-2418.457) * [-2414.214] (-2427.786) (-2421.290) (-2423.276) -- 0:01:19 523000 -- [-2420.365] (-2419.057) (-2423.979) (-2417.138) * (-2423.636) (-2421.481) (-2418.123) [-2415.036] -- 0:01:19 523500 -- (-2420.764) [-2411.654] (-2429.153) (-2419.001) * [-2415.109] (-2415.438) (-2421.964) (-2421.050) -- 0:01:19 524000 -- (-2416.924) [-2418.007] (-2425.964) (-2421.648) * (-2429.315) (-2420.935) (-2429.884) [-2416.161] -- 0:01:19 524500 -- [-2422.166] (-2421.417) (-2420.851) (-2427.656) * (-2422.083) [-2422.840] (-2417.861) (-2425.073) -- 0:01:19 525000 -- [-2420.485] (-2416.340) (-2416.855) (-2425.936) * (-2413.234) (-2425.003) [-2418.603] (-2422.229) -- 0:01:19 Average standard deviation of split frequencies: 0.008066 525500 -- (-2426.461) (-2420.901) [-2414.308] (-2424.572) * (-2414.261) (-2414.061) (-2425.657) [-2425.593] -- 0:01:19 526000 -- (-2415.178) (-2420.293) [-2421.171] (-2425.770) * (-2413.865) [-2416.192] (-2421.930) (-2425.356) -- 0:01:19 526500 -- [-2416.480] (-2415.820) (-2423.007) (-2422.242) * (-2416.033) [-2419.948] (-2425.900) (-2423.037) -- 0:01:19 527000 -- (-2421.062) [-2424.723] (-2420.172) (-2428.554) * (-2424.481) (-2417.569) [-2427.917] (-2418.764) -- 0:01:18 527500 -- (-2420.126) (-2413.035) [-2420.677] (-2426.741) * (-2412.534) (-2422.422) (-2417.076) [-2414.647] -- 0:01:18 528000 -- (-2416.034) (-2422.670) (-2425.859) [-2422.919] * (-2410.565) (-2416.678) (-2422.643) [-2414.986] -- 0:01:18 528500 -- (-2413.079) (-2415.559) (-2414.203) [-2417.807] * (-2415.917) (-2423.774) (-2415.095) [-2418.248] -- 0:01:18 529000 -- [-2414.661] (-2419.087) (-2425.966) (-2413.654) * [-2427.540] (-2423.007) (-2420.524) (-2427.760) -- 0:01:18 529500 -- [-2412.249] (-2416.491) (-2425.587) (-2412.572) * [-2419.185] (-2419.964) (-2422.841) (-2420.783) -- 0:01:18 530000 -- (-2427.357) [-2419.291] (-2421.779) (-2417.417) * (-2415.148) (-2421.199) (-2418.899) [-2414.717] -- 0:01:18 Average standard deviation of split frequencies: 0.008350 530500 -- (-2416.180) (-2420.198) [-2420.812] (-2424.709) * (-2421.813) (-2418.652) [-2420.204] (-2422.731) -- 0:01:18 531000 -- [-2418.612] (-2413.865) (-2417.962) (-2419.477) * (-2421.885) (-2421.058) [-2417.739] (-2422.039) -- 0:01:18 531500 -- (-2419.497) [-2417.808] (-2421.375) (-2422.613) * (-2414.831) (-2411.170) (-2417.279) [-2417.736] -- 0:01:18 532000 -- (-2419.851) (-2416.306) [-2415.235] (-2424.692) * (-2422.840) (-2414.035) (-2415.856) [-2410.513] -- 0:01:18 532500 -- (-2423.046) (-2417.626) [-2413.711] (-2428.454) * (-2415.880) (-2420.368) (-2425.793) [-2415.301] -- 0:01:18 533000 -- [-2421.842] (-2416.266) (-2422.345) (-2420.875) * (-2427.418) (-2422.528) [-2414.751] (-2418.472) -- 0:01:17 533500 -- (-2420.594) [-2415.426] (-2418.138) (-2420.179) * (-2421.930) (-2425.034) (-2416.711) [-2421.148] -- 0:01:17 534000 -- (-2419.878) (-2420.785) (-2416.089) [-2415.155] * (-2424.974) (-2420.253) [-2415.776] (-2429.523) -- 0:01:17 534500 -- (-2413.842) (-2419.977) (-2423.720) [-2416.864] * (-2420.888) (-2416.839) (-2419.262) [-2421.834] -- 0:01:17 535000 -- (-2422.952) [-2419.944] (-2418.805) (-2419.923) * (-2421.685) [-2420.132] (-2420.790) (-2421.259) -- 0:01:17 Average standard deviation of split frequencies: 0.008971 535500 -- (-2430.604) (-2424.436) [-2419.324] (-2416.601) * (-2423.638) [-2420.708] (-2417.159) (-2411.647) -- 0:01:17 536000 -- (-2417.968) (-2421.900) [-2417.869] (-2416.327) * (-2431.689) (-2419.379) (-2415.698) [-2412.993] -- 0:01:17 536500 -- (-2423.507) [-2415.823] (-2413.232) (-2420.644) * [-2411.743] (-2419.427) (-2427.194) (-2419.342) -- 0:01:17 537000 -- (-2418.448) (-2421.014) [-2411.538] (-2420.035) * (-2418.631) (-2421.069) (-2423.177) [-2412.040] -- 0:01:17 537500 -- (-2419.122) (-2417.216) (-2425.462) [-2415.257] * [-2415.206] (-2422.564) (-2420.930) (-2417.546) -- 0:01:17 538000 -- (-2415.558) [-2419.823] (-2416.701) (-2417.625) * (-2419.804) (-2422.514) (-2417.673) [-2423.428] -- 0:01:17 538500 -- [-2416.854] (-2423.768) (-2416.632) (-2420.496) * (-2417.887) (-2413.656) [-2412.370] (-2418.981) -- 0:01:17 539000 -- (-2422.371) (-2418.562) [-2419.943] (-2417.266) * (-2431.234) (-2421.823) (-2416.103) [-2417.255] -- 0:01:16 539500 -- (-2421.970) (-2421.214) [-2412.192] (-2421.760) * (-2415.963) [-2421.194] (-2416.728) (-2419.766) -- 0:01:16 540000 -- (-2418.180) (-2425.539) [-2419.338] (-2419.689) * (-2421.861) (-2416.784) (-2419.030) [-2415.452] -- 0:01:16 Average standard deviation of split frequencies: 0.008196 540500 -- [-2414.531] (-2420.295) (-2418.100) (-2419.420) * (-2414.320) (-2419.413) (-2414.308) [-2415.188] -- 0:01:16 541000 -- (-2417.147) (-2413.183) [-2417.781] (-2423.368) * (-2416.485) (-2417.783) (-2426.420) [-2417.302] -- 0:01:16 541500 -- (-2425.290) [-2415.678] (-2417.620) (-2420.058) * (-2419.323) (-2421.541) (-2429.482) [-2417.748] -- 0:01:16 542000 -- [-2414.596] (-2421.121) (-2414.943) (-2424.375) * (-2422.070) (-2416.082) (-2415.814) [-2417.706] -- 0:01:16 542500 -- (-2413.821) (-2418.360) (-2415.299) [-2420.085] * [-2419.398] (-2419.330) (-2415.860) (-2418.415) -- 0:01:16 543000 -- (-2421.970) [-2412.222] (-2418.497) (-2412.197) * (-2423.018) (-2422.237) [-2425.081] (-2415.122) -- 0:01:16 543500 -- [-2417.851] (-2423.446) (-2418.851) (-2423.437) * (-2418.003) (-2421.832) (-2425.844) [-2421.096] -- 0:01:16 544000 -- [-2415.726] (-2421.120) (-2421.147) (-2410.807) * (-2422.034) (-2428.775) (-2418.583) [-2421.332] -- 0:01:16 544500 -- (-2418.591) [-2428.193] (-2423.858) (-2425.211) * (-2421.400) (-2415.906) (-2426.158) [-2414.538] -- 0:01:16 545000 -- (-2420.826) [-2417.882] (-2423.740) (-2419.964) * (-2424.482) (-2415.246) [-2416.153] (-2416.635) -- 0:01:15 Average standard deviation of split frequencies: 0.009670 545500 -- (-2418.418) (-2417.340) (-2418.947) [-2415.041] * (-2419.418) (-2414.719) [-2418.336] (-2423.183) -- 0:01:15 546000 -- (-2412.557) (-2418.010) (-2415.675) [-2421.549] * (-2422.576) (-2421.480) (-2410.738) [-2418.930] -- 0:01:15 546500 -- (-2417.274) (-2418.935) (-2417.177) [-2416.865] * (-2419.243) (-2417.824) (-2418.842) [-2424.995] -- 0:01:15 547000 -- (-2422.444) (-2420.197) [-2418.004] (-2417.749) * [-2423.912] (-2416.625) (-2420.266) (-2421.022) -- 0:01:16 547500 -- (-2417.868) [-2420.144] (-2422.298) (-2415.262) * (-2429.160) (-2416.708) [-2409.941] (-2424.300) -- 0:01:16 548000 -- (-2419.056) (-2426.699) [-2411.063] (-2416.350) * [-2427.538] (-2426.962) (-2415.368) (-2417.554) -- 0:01:15 548500 -- [-2416.053] (-2426.406) (-2419.069) (-2416.658) * (-2420.577) [-2419.336] (-2419.532) (-2414.460) -- 0:01:15 549000 -- (-2417.798) (-2414.507) (-2427.258) [-2419.243] * [-2415.644] (-2422.779) (-2419.010) (-2416.308) -- 0:01:15 549500 -- (-2416.713) [-2421.751] (-2426.301) (-2416.215) * (-2424.629) [-2417.209] (-2421.155) (-2422.538) -- 0:01:15 550000 -- (-2417.934) (-2417.346) [-2414.525] (-2421.484) * (-2423.577) [-2419.919] (-2425.500) (-2416.320) -- 0:01:15 Average standard deviation of split frequencies: 0.010102 550500 -- (-2421.138) (-2414.343) (-2415.769) [-2423.700] * (-2420.007) [-2414.584] (-2423.814) (-2414.617) -- 0:01:15 551000 -- (-2419.200) [-2415.053] (-2417.336) (-2427.797) * (-2417.991) (-2418.349) [-2417.779] (-2415.500) -- 0:01:14 551500 -- (-2417.005) (-2417.298) [-2416.464] (-2419.813) * (-2420.830) [-2419.696] (-2425.018) (-2422.041) -- 0:01:14 552000 -- (-2418.996) (-2412.475) [-2420.154] (-2416.710) * (-2430.738) (-2419.194) (-2419.331) [-2421.782] -- 0:01:14 552500 -- (-2434.713) (-2415.932) (-2425.925) [-2413.356] * (-2428.090) [-2415.271] (-2418.676) (-2423.767) -- 0:01:15 553000 -- (-2419.349) (-2417.348) [-2420.472] (-2420.803) * (-2421.508) (-2418.131) [-2415.011] (-2421.340) -- 0:01:15 553500 -- (-2417.972) [-2423.047] (-2422.545) (-2420.526) * (-2425.966) (-2415.811) [-2414.320] (-2422.044) -- 0:01:15 554000 -- (-2419.742) [-2422.039] (-2423.808) (-2418.317) * [-2417.779] (-2420.288) (-2416.608) (-2429.209) -- 0:01:14 554500 -- (-2429.438) (-2418.802) [-2417.350] (-2418.914) * [-2413.765] (-2414.697) (-2411.262) (-2421.040) -- 0:01:14 555000 -- (-2422.838) [-2418.349] (-2422.925) (-2412.988) * (-2416.806) (-2419.126) [-2416.207] (-2424.544) -- 0:01:14 Average standard deviation of split frequencies: 0.011700 555500 -- (-2423.694) (-2419.754) (-2415.886) [-2410.845] * (-2425.256) (-2424.096) [-2420.246] (-2423.665) -- 0:01:14 556000 -- (-2422.002) (-2420.327) (-2417.979) [-2418.825] * (-2428.769) [-2415.767] (-2417.905) (-2423.531) -- 0:01:14 556500 -- [-2422.886] (-2419.523) (-2416.125) (-2425.317) * (-2422.342) [-2416.899] (-2422.058) (-2417.269) -- 0:01:14 557000 -- (-2415.109) [-2418.947] (-2415.545) (-2416.295) * (-2416.716) (-2413.763) (-2417.495) [-2418.732] -- 0:01:13 557500 -- (-2420.524) (-2417.326) [-2415.895] (-2413.335) * (-2414.348) (-2424.806) (-2423.645) [-2424.296] -- 0:01:13 558000 -- [-2423.710] (-2419.917) (-2423.106) (-2414.835) * [-2415.309] (-2418.680) (-2423.173) (-2428.585) -- 0:01:13 558500 -- (-2426.990) (-2420.114) [-2416.020] (-2415.478) * (-2422.470) (-2430.464) [-2413.871] (-2423.149) -- 0:01:14 559000 -- (-2425.347) [-2418.144] (-2417.851) (-2419.221) * (-2419.454) (-2422.527) (-2413.555) [-2424.114] -- 0:01:14 559500 -- [-2423.684] (-2420.237) (-2419.624) (-2416.283) * (-2421.945) [-2415.293] (-2417.086) (-2419.028) -- 0:01:14 560000 -- (-2420.810) [-2415.371] (-2417.745) (-2419.541) * (-2421.713) [-2424.450] (-2425.464) (-2419.396) -- 0:01:13 Average standard deviation of split frequencies: 0.011267 560500 -- (-2428.968) (-2425.441) [-2422.127] (-2420.181) * (-2423.258) [-2417.430] (-2420.599) (-2416.372) -- 0:01:13 561000 -- (-2424.766) (-2420.482) (-2420.120) [-2412.181] * (-2417.048) [-2413.547] (-2418.857) (-2426.048) -- 0:01:13 561500 -- (-2422.071) [-2416.928] (-2421.716) (-2421.521) * (-2418.042) (-2421.962) [-2421.278] (-2417.232) -- 0:01:13 562000 -- (-2423.161) [-2417.863] (-2417.479) (-2415.122) * (-2425.700) (-2413.643) (-2417.227) [-2417.190] -- 0:01:13 562500 -- (-2423.473) [-2425.872] (-2419.109) (-2419.596) * (-2426.984) [-2416.501] (-2416.495) (-2414.568) -- 0:01:13 563000 -- (-2416.756) (-2422.056) [-2410.914] (-2424.756) * (-2427.136) [-2416.891] (-2422.686) (-2424.853) -- 0:01:12 563500 -- (-2417.060) (-2427.719) (-2418.137) [-2423.497] * (-2421.884) [-2420.042] (-2414.248) (-2426.461) -- 0:01:12 564000 -- (-2419.748) (-2423.405) (-2424.297) [-2413.844] * [-2423.250] (-2419.452) (-2420.554) (-2422.886) -- 0:01:12 564500 -- (-2416.477) (-2413.673) [-2419.839] (-2415.820) * (-2423.898) [-2422.948] (-2422.732) (-2421.676) -- 0:01:13 565000 -- [-2424.492] (-2421.825) (-2420.287) (-2423.005) * (-2422.437) [-2416.372] (-2434.914) (-2427.640) -- 0:01:13 Average standard deviation of split frequencies: 0.012326 565500 -- (-2417.904) (-2416.359) (-2425.865) [-2416.587] * [-2418.241] (-2432.131) (-2429.916) (-2426.719) -- 0:01:12 566000 -- (-2418.889) (-2418.024) (-2425.170) [-2414.044] * [-2420.293] (-2423.972) (-2423.012) (-2424.699) -- 0:01:12 566500 -- (-2418.834) (-2427.925) (-2418.383) [-2422.004] * (-2411.804) (-2422.255) (-2420.269) [-2417.035] -- 0:01:12 567000 -- (-2416.505) [-2417.191] (-2419.856) (-2415.427) * (-2416.588) (-2422.714) (-2427.366) [-2422.097] -- 0:01:12 567500 -- [-2418.165] (-2414.198) (-2422.280) (-2413.033) * (-2414.953) [-2415.451] (-2415.878) (-2426.368) -- 0:01:12 568000 -- (-2412.419) (-2420.308) (-2422.961) [-2422.922] * (-2422.900) (-2415.638) [-2425.332] (-2421.604) -- 0:01:12 568500 -- [-2415.332] (-2420.326) (-2419.686) (-2417.205) * (-2416.083) [-2419.935] (-2421.823) (-2421.358) -- 0:01:12 569000 -- (-2419.234) (-2425.860) (-2419.366) [-2413.840] * (-2416.654) [-2412.797] (-2419.736) (-2418.590) -- 0:01:11 569500 -- (-2417.257) (-2419.375) (-2416.816) [-2415.558] * (-2417.461) (-2421.842) [-2421.404] (-2418.558) -- 0:01:11 570000 -- [-2410.359] (-2414.984) (-2407.860) (-2413.688) * (-2419.469) (-2423.845) [-2417.093] (-2415.395) -- 0:01:11 Average standard deviation of split frequencies: 0.012060 570500 -- [-2414.071] (-2413.593) (-2416.852) (-2417.774) * (-2423.762) (-2416.825) [-2416.478] (-2416.464) -- 0:01:12 571000 -- (-2418.138) [-2417.340] (-2417.373) (-2416.907) * (-2416.983) (-2418.530) [-2430.002] (-2417.971) -- 0:01:12 571500 -- (-2423.388) [-2420.579] (-2420.795) (-2420.673) * (-2423.917) [-2416.482] (-2422.282) (-2415.847) -- 0:01:11 572000 -- [-2418.269] (-2423.052) (-2418.303) (-2424.176) * [-2419.504] (-2425.234) (-2424.404) (-2415.909) -- 0:01:11 572500 -- [-2422.094] (-2417.260) (-2426.600) (-2416.778) * (-2420.691) (-2413.935) [-2419.343] (-2416.561) -- 0:01:11 573000 -- (-2419.733) (-2413.949) (-2423.016) [-2430.698] * [-2416.476] (-2415.409) (-2417.152) (-2419.368) -- 0:01:11 573500 -- (-2421.602) [-2416.194] (-2423.836) (-2423.532) * (-2418.107) (-2422.979) [-2413.329] (-2413.950) -- 0:01:11 574000 -- (-2420.063) (-2419.779) [-2422.637] (-2424.588) * (-2419.623) [-2417.977] (-2416.692) (-2419.149) -- 0:01:11 574500 -- [-2414.304] (-2423.952) (-2419.071) (-2422.233) * (-2418.218) [-2421.191] (-2420.362) (-2421.759) -- 0:01:11 575000 -- (-2414.970) (-2419.599) (-2422.487) [-2416.055] * (-2416.355) (-2421.289) [-2413.943] (-2420.761) -- 0:01:10 Average standard deviation of split frequencies: 0.011458 575500 -- (-2421.584) (-2415.480) [-2425.129] (-2417.867) * (-2414.839) (-2425.089) (-2418.936) [-2414.930] -- 0:01:10 576000 -- (-2414.064) [-2416.685] (-2433.402) (-2419.756) * (-2419.082) [-2414.725] (-2418.125) (-2423.344) -- 0:01:11 576500 -- (-2421.169) [-2417.124] (-2425.400) (-2424.225) * (-2423.950) (-2418.946) [-2416.954] (-2420.997) -- 0:01:11 577000 -- (-2426.658) (-2418.774) [-2419.233] (-2417.615) * (-2430.680) (-2415.204) (-2415.883) [-2418.550] -- 0:01:11 577500 -- [-2420.679] (-2416.318) (-2429.233) (-2416.312) * (-2427.947) (-2414.502) [-2421.480] (-2417.188) -- 0:01:10 578000 -- [-2415.812] (-2419.147) (-2419.559) (-2416.602) * (-2428.702) [-2413.468] (-2421.698) (-2416.323) -- 0:01:10 578500 -- (-2417.257) (-2422.244) (-2418.369) [-2414.581] * (-2425.817) [-2422.906] (-2420.369) (-2417.303) -- 0:01:10 579000 -- (-2424.833) [-2420.583] (-2415.691) (-2414.815) * [-2424.180] (-2424.242) (-2423.715) (-2416.659) -- 0:01:10 579500 -- (-2422.971) (-2414.077) [-2421.014] (-2414.927) * (-2426.188) (-2420.842) (-2423.267) [-2413.727] -- 0:01:10 580000 -- (-2422.094) [-2413.905] (-2415.009) (-2420.812) * (-2416.819) (-2414.136) (-2420.968) [-2419.221] -- 0:01:10 Average standard deviation of split frequencies: 0.011041 580500 -- (-2418.938) [-2414.877] (-2421.413) (-2418.457) * (-2414.735) (-2413.239) (-2412.731) [-2415.528] -- 0:01:10 581000 -- (-2425.616) (-2424.762) [-2414.445] (-2419.888) * (-2415.911) (-2421.826) [-2416.520] (-2414.770) -- 0:01:09 581500 -- (-2419.792) (-2414.538) (-2418.029) [-2420.423] * (-2414.670) (-2422.887) (-2419.039) [-2416.602] -- 0:01:09 582000 -- (-2416.891) (-2417.269) (-2417.140) [-2414.882] * [-2414.197] (-2417.798) (-2418.523) (-2419.639) -- 0:01:09 582500 -- (-2419.958) [-2422.620] (-2419.037) (-2417.795) * (-2423.697) [-2416.049] (-2424.202) (-2421.751) -- 0:01:10 583000 -- [-2416.539] (-2423.203) (-2417.464) (-2420.959) * (-2419.648) (-2415.685) (-2417.591) [-2418.442] -- 0:01:10 583500 -- (-2415.185) (-2415.386) (-2423.173) [-2417.899] * [-2417.648] (-2420.751) (-2423.694) (-2424.374) -- 0:01:09 584000 -- (-2418.837) (-2420.524) [-2410.549] (-2419.741) * (-2416.261) (-2421.099) (-2423.920) [-2415.530] -- 0:01:09 584500 -- (-2417.775) [-2423.502] (-2428.423) (-2420.888) * [-2413.647] (-2414.998) (-2424.216) (-2418.564) -- 0:01:09 585000 -- (-2416.095) (-2412.661) (-2416.199) [-2415.479] * [-2417.069] (-2416.437) (-2413.392) (-2424.159) -- 0:01:09 Average standard deviation of split frequencies: 0.011423 585500 -- (-2429.538) [-2418.580] (-2415.402) (-2418.155) * (-2419.523) [-2418.223] (-2414.039) (-2425.237) -- 0:01:09 586000 -- [-2423.240] (-2420.429) (-2418.442) (-2422.884) * (-2413.145) [-2421.749] (-2423.094) (-2422.563) -- 0:01:09 586500 -- [-2417.249] (-2420.160) (-2421.241) (-2425.244) * (-2424.463) [-2412.694] (-2425.676) (-2418.585) -- 0:01:09 587000 -- (-2416.675) [-2413.813] (-2434.088) (-2419.952) * [-2422.672] (-2416.858) (-2423.640) (-2416.621) -- 0:01:08 587500 -- (-2421.838) (-2419.239) (-2418.679) [-2417.798] * [-2421.773] (-2415.636) (-2418.625) (-2423.332) -- 0:01:08 588000 -- (-2422.952) (-2417.247) (-2422.725) [-2418.126] * (-2420.681) (-2427.507) (-2412.773) [-2426.144] -- 0:01:08 588500 -- [-2422.507] (-2421.896) (-2423.213) (-2419.474) * (-2421.142) (-2419.810) (-2425.850) [-2426.088] -- 0:01:09 589000 -- (-2422.940) [-2418.196] (-2418.199) (-2421.053) * [-2419.314] (-2421.091) (-2425.061) (-2416.759) -- 0:01:09 589500 -- (-2416.639) [-2420.826] (-2418.581) (-2423.608) * (-2414.757) [-2417.401] (-2415.248) (-2424.347) -- 0:01:08 590000 -- (-2412.799) (-2428.329) (-2434.755) [-2421.576] * (-2424.981) [-2416.707] (-2418.793) (-2418.846) -- 0:01:08 Average standard deviation of split frequencies: 0.010854 590500 -- [-2415.461] (-2411.784) (-2423.843) (-2421.910) * (-2425.555) [-2418.996] (-2418.153) (-2416.739) -- 0:01:08 591000 -- (-2418.633) (-2416.212) (-2424.976) [-2419.401] * (-2425.999) [-2418.859] (-2419.359) (-2420.821) -- 0:01:08 591500 -- (-2425.017) (-2416.628) (-2414.626) [-2419.269] * (-2424.792) (-2424.435) (-2415.253) [-2414.981] -- 0:01:08 592000 -- (-2420.155) [-2414.984] (-2419.581) (-2412.851) * (-2421.850) [-2412.462] (-2415.708) (-2418.630) -- 0:01:08 592500 -- [-2417.348] (-2420.820) (-2416.668) (-2421.105) * (-2425.460) (-2422.725) [-2415.249] (-2418.307) -- 0:01:08 593000 -- [-2418.864] (-2419.515) (-2419.778) (-2422.975) * (-2418.759) [-2414.746] (-2419.532) (-2417.838) -- 0:01:07 593500 -- (-2417.988) [-2418.650] (-2418.185) (-2419.793) * (-2417.384) [-2417.596] (-2428.403) (-2430.561) -- 0:01:07 594000 -- (-2422.103) (-2421.524) (-2422.239) [-2425.948] * (-2423.808) (-2413.786) [-2415.550] (-2426.138) -- 0:01:07 594500 -- (-2422.763) [-2414.584] (-2419.699) (-2435.199) * (-2413.288) [-2417.727] (-2414.615) (-2422.047) -- 0:01:08 595000 -- (-2416.264) [-2412.733] (-2426.659) (-2420.429) * (-2418.688) [-2415.757] (-2420.948) (-2420.031) -- 0:01:08 Average standard deviation of split frequencies: 0.011390 595500 -- (-2414.565) [-2415.029] (-2420.937) (-2423.442) * (-2416.651) [-2415.477] (-2421.112) (-2417.295) -- 0:01:07 596000 -- (-2417.424) (-2420.121) (-2422.294) [-2415.740] * [-2423.344] (-2418.298) (-2426.924) (-2422.452) -- 0:01:07 596500 -- (-2413.196) [-2417.534] (-2420.180) (-2415.025) * [-2412.973] (-2416.146) (-2421.570) (-2416.542) -- 0:01:07 597000 -- [-2413.465] (-2423.039) (-2418.491) (-2420.896) * (-2414.648) [-2418.744] (-2417.757) (-2415.757) -- 0:01:07 597500 -- [-2413.823] (-2423.535) (-2427.830) (-2423.428) * (-2415.506) [-2420.862] (-2422.644) (-2415.248) -- 0:01:07 598000 -- (-2415.047) [-2416.738] (-2419.829) (-2419.938) * [-2416.882] (-2430.641) (-2416.885) (-2416.532) -- 0:01:07 598500 -- [-2414.804] (-2425.181) (-2420.522) (-2421.859) * (-2424.367) (-2416.534) [-2419.120] (-2418.462) -- 0:01:07 599000 -- (-2422.627) [-2425.924] (-2422.797) (-2419.416) * (-2420.006) (-2415.443) [-2414.155] (-2420.561) -- 0:01:06 599500 -- (-2419.346) [-2421.124] (-2422.505) (-2424.871) * [-2419.488] (-2424.933) (-2418.654) (-2417.886) -- 0:01:06 600000 -- (-2413.746) (-2429.718) (-2431.179) [-2416.061] * (-2418.749) (-2411.802) [-2413.889] (-2420.722) -- 0:01:06 Average standard deviation of split frequencies: 0.008829 600500 -- (-2410.248) [-2431.019] (-2421.845) (-2420.459) * (-2425.178) (-2415.119) [-2418.630] (-2424.902) -- 0:01:07 601000 -- (-2418.778) (-2414.690) (-2428.114) [-2419.466] * (-2428.310) (-2423.888) (-2418.933) [-2418.677] -- 0:01:07 601500 -- (-2417.135) (-2418.278) (-2418.672) [-2414.000] * [-2422.892] (-2423.077) (-2419.760) (-2418.925) -- 0:01:06 602000 -- (-2419.634) (-2420.651) [-2418.694] (-2414.943) * (-2420.949) [-2419.951] (-2419.549) (-2416.661) -- 0:01:06 602500 -- (-2415.497) (-2420.033) [-2417.564] (-2414.084) * (-2421.086) [-2414.594] (-2416.632) (-2414.663) -- 0:01:06 603000 -- [-2419.449] (-2421.650) (-2415.465) (-2414.952) * (-2418.682) [-2415.912] (-2420.720) (-2417.066) -- 0:01:06 603500 -- [-2425.989] (-2416.265) (-2419.469) (-2415.656) * (-2427.360) (-2416.495) [-2423.578] (-2420.916) -- 0:01:06 604000 -- (-2421.090) [-2418.561] (-2426.442) (-2419.717) * (-2417.541) [-2416.900] (-2421.099) (-2422.088) -- 0:01:06 604500 -- (-2420.765) (-2416.359) (-2423.665) [-2416.622] * (-2418.794) [-2413.645] (-2433.250) (-2416.957) -- 0:01:06 605000 -- (-2412.817) (-2415.627) (-2425.152) [-2427.654] * [-2420.563] (-2422.994) (-2423.634) (-2426.404) -- 0:01:05 Average standard deviation of split frequencies: 0.009179 605500 -- (-2417.271) [-2417.662] (-2424.960) (-2413.212) * [-2419.779] (-2424.003) (-2426.429) (-2422.593) -- 0:01:05 606000 -- (-2420.245) (-2430.199) (-2427.696) [-2419.547] * (-2417.301) (-2420.855) (-2417.786) [-2415.319] -- 0:01:05 606500 -- (-2417.274) (-2419.737) (-2417.700) [-2420.214] * [-2421.359] (-2426.396) (-2426.289) (-2420.762) -- 0:01:06 607000 -- (-2417.924) (-2417.918) (-2424.338) [-2415.999] * (-2422.635) [-2415.663] (-2421.605) (-2424.431) -- 0:01:06 607500 -- (-2421.189) [-2414.618] (-2425.671) (-2424.409) * [-2415.971] (-2431.509) (-2420.628) (-2414.264) -- 0:01:05 608000 -- (-2420.370) (-2414.718) (-2419.009) [-2416.455] * (-2418.770) [-2421.512] (-2420.979) (-2420.952) -- 0:01:05 608500 -- (-2423.715) (-2422.349) (-2419.984) [-2417.370] * (-2419.644) (-2424.883) [-2421.624] (-2416.900) -- 0:01:05 609000 -- (-2422.072) (-2423.544) [-2412.018] (-2418.554) * (-2421.119) (-2419.426) (-2422.115) [-2420.335] -- 0:01:05 609500 -- (-2419.618) (-2422.277) (-2411.787) [-2418.163] * (-2420.630) (-2423.088) (-2422.213) [-2422.463] -- 0:01:05 610000 -- [-2418.786] (-2432.010) (-2414.514) (-2418.050) * (-2418.577) (-2419.039) [-2421.307] (-2415.157) -- 0:01:05 Average standard deviation of split frequencies: 0.008491 610500 -- (-2414.616) (-2419.709) [-2415.880] (-2423.147) * [-2421.761] (-2420.295) (-2419.558) (-2417.972) -- 0:01:05 611000 -- [-2418.311] (-2415.603) (-2426.994) (-2431.059) * (-2426.541) [-2417.487] (-2419.054) (-2413.923) -- 0:01:04 611500 -- (-2416.883) [-2416.366] (-2420.074) (-2421.569) * [-2420.317] (-2421.580) (-2416.758) (-2416.198) -- 0:01:04 612000 -- (-2413.945) (-2417.026) (-2413.770) [-2415.060] * (-2418.773) [-2420.726] (-2419.285) (-2418.566) -- 0:01:04 612500 -- (-2419.878) (-2426.915) (-2418.178) [-2416.079] * [-2414.596] (-2422.113) (-2417.869) (-2414.457) -- 0:01:05 613000 -- [-2416.355] (-2421.992) (-2421.151) (-2418.846) * (-2415.121) (-2418.221) [-2418.870] (-2414.684) -- 0:01:05 613500 -- [-2415.321] (-2426.348) (-2416.060) (-2415.115) * (-2418.556) (-2413.072) (-2419.584) [-2415.670] -- 0:01:04 614000 -- (-2419.607) (-2418.115) [-2413.522] (-2419.816) * (-2419.154) [-2413.045] (-2418.903) (-2421.327) -- 0:01:04 614500 -- (-2421.996) (-2416.047) (-2425.125) [-2420.290] * (-2418.222) [-2411.653] (-2424.239) (-2420.687) -- 0:01:04 615000 -- (-2422.094) (-2421.396) [-2422.225] (-2425.500) * [-2419.931] (-2416.007) (-2421.222) (-2416.344) -- 0:01:04 Average standard deviation of split frequencies: 0.008227 615500 -- (-2426.851) (-2425.688) [-2421.846] (-2419.116) * (-2426.375) (-2431.315) (-2424.191) [-2421.236] -- 0:01:04 616000 -- (-2419.377) [-2425.401] (-2424.570) (-2420.980) * (-2421.749) [-2422.829] (-2414.346) (-2419.822) -- 0:01:04 616500 -- (-2419.472) (-2428.147) [-2417.864] (-2420.306) * (-2415.628) (-2418.707) [-2422.686] (-2418.670) -- 0:01:04 617000 -- (-2422.956) (-2425.713) (-2416.574) [-2416.869] * (-2420.551) [-2412.919] (-2429.549) (-2425.743) -- 0:01:03 617500 -- (-2419.305) (-2422.381) (-2415.445) [-2416.842] * [-2415.248] (-2412.552) (-2428.065) (-2417.768) -- 0:01:03 618000 -- (-2426.206) (-2419.380) [-2414.835] (-2418.050) * (-2417.800) (-2424.946) (-2426.536) [-2415.643] -- 0:01:03 618500 -- (-2423.128) [-2417.075] (-2425.398) (-2413.228) * (-2426.346) (-2418.515) (-2417.148) [-2412.900] -- 0:01:04 619000 -- (-2421.537) (-2413.458) (-2417.719) [-2412.932] * [-2424.358] (-2420.017) (-2422.633) (-2421.398) -- 0:01:04 619500 -- (-2420.234) (-2418.521) (-2413.127) [-2418.299] * [-2417.861] (-2425.702) (-2416.292) (-2410.914) -- 0:01:03 620000 -- [-2416.685] (-2419.290) (-2413.832) (-2419.359) * (-2420.206) (-2416.186) [-2418.458] (-2425.331) -- 0:01:03 Average standard deviation of split frequencies: 0.007405 620500 -- (-2419.167) [-2415.553] (-2422.744) (-2412.319) * (-2419.539) [-2411.812] (-2415.750) (-2422.100) -- 0:01:03 621000 -- (-2421.716) (-2420.730) (-2421.084) [-2421.685] * (-2421.704) [-2420.827] (-2419.503) (-2428.314) -- 0:01:03 621500 -- (-2427.166) (-2418.111) [-2416.089] (-2414.534) * (-2422.796) (-2424.122) [-2415.869] (-2425.770) -- 0:01:03 622000 -- (-2423.141) (-2421.972) [-2420.089] (-2422.320) * (-2415.733) (-2420.746) (-2415.453) [-2413.928] -- 0:01:03 622500 -- (-2415.731) (-2422.257) [-2419.943] (-2416.583) * [-2415.482] (-2425.251) (-2416.162) (-2418.905) -- 0:01:03 623000 -- (-2416.125) (-2421.681) [-2409.105] (-2417.774) * (-2419.105) [-2426.417] (-2420.674) (-2419.953) -- 0:01:02 623500 -- (-2414.926) [-2418.483] (-2413.961) (-2416.126) * [-2417.835] (-2415.590) (-2420.946) (-2418.195) -- 0:01:02 624000 -- (-2416.690) [-2419.978] (-2413.487) (-2415.237) * (-2416.783) (-2433.018) (-2421.871) [-2415.283] -- 0:01:02 624500 -- (-2423.301) (-2416.776) (-2418.096) [-2414.340] * [-2418.894] (-2430.348) (-2414.818) (-2415.061) -- 0:01:03 625000 -- (-2426.244) (-2423.863) [-2419.338] (-2421.992) * (-2419.209) [-2425.839] (-2423.447) (-2417.879) -- 0:01:03 Average standard deviation of split frequencies: 0.008095 625500 -- [-2418.408] (-2416.399) (-2418.195) (-2414.840) * (-2426.278) (-2420.354) (-2424.952) [-2412.222] -- 0:01:02 626000 -- (-2422.595) (-2420.190) (-2423.890) [-2418.252] * (-2420.909) (-2420.263) (-2414.322) [-2416.778] -- 0:01:02 626500 -- (-2417.892) (-2420.607) [-2425.779] (-2427.052) * (-2415.446) [-2421.917] (-2416.913) (-2425.924) -- 0:01:02 627000 -- [-2417.084] (-2417.892) (-2437.123) (-2417.363) * [-2417.663] (-2419.331) (-2417.147) (-2425.744) -- 0:01:02 627500 -- (-2421.745) [-2417.901] (-2423.295) (-2426.742) * (-2414.169) (-2418.709) (-2418.937) [-2414.727] -- 0:01:02 628000 -- [-2418.900] (-2418.117) (-2422.652) (-2433.796) * (-2420.601) (-2418.150) [-2418.600] (-2421.906) -- 0:01:02 628500 -- (-2416.665) [-2419.523] (-2424.056) (-2425.421) * (-2418.488) [-2416.601] (-2421.082) (-2418.284) -- 0:01:02 629000 -- (-2417.916) (-2414.696) (-2417.426) [-2416.622] * (-2422.625) (-2425.982) [-2417.189] (-2420.594) -- 0:01:01 629500 -- (-2412.978) (-2413.395) (-2415.610) [-2420.068] * (-2415.930) (-2417.815) [-2416.661] (-2417.301) -- 0:01:01 630000 -- [-2426.954] (-2421.090) (-2424.495) (-2414.483) * (-2414.186) (-2419.578) [-2420.050] (-2418.222) -- 0:01:01 Average standard deviation of split frequencies: 0.006167 630500 -- [-2419.113] (-2421.974) (-2427.541) (-2418.373) * [-2414.997] (-2422.761) (-2413.137) (-2417.397) -- 0:01:02 631000 -- (-2423.345) (-2421.680) [-2415.967] (-2416.345) * (-2418.795) [-2411.801] (-2412.739) (-2420.762) -- 0:01:01 631500 -- (-2421.108) (-2415.576) [-2411.268] (-2419.871) * [-2418.734] (-2427.972) (-2418.222) (-2424.507) -- 0:01:01 632000 -- (-2420.022) [-2419.220] (-2416.602) (-2416.092) * (-2423.837) [-2417.859] (-2418.327) (-2411.603) -- 0:01:01 632500 -- (-2422.149) (-2419.450) (-2414.639) [-2416.043] * (-2418.564) [-2413.372] (-2413.399) (-2416.472) -- 0:01:01 633000 -- (-2422.983) [-2422.090] (-2418.630) (-2414.780) * (-2422.647) (-2414.090) [-2416.620] (-2420.172) -- 0:01:01 633500 -- (-2415.256) (-2418.073) [-2413.664] (-2416.921) * (-2420.762) [-2415.732] (-2420.232) (-2421.410) -- 0:01:01 634000 -- (-2421.893) (-2415.858) [-2420.434] (-2417.342) * [-2418.748] (-2424.538) (-2420.901) (-2420.891) -- 0:01:01 634500 -- (-2415.551) [-2412.521] (-2419.162) (-2416.664) * [-2412.772] (-2419.468) (-2423.280) (-2419.188) -- 0:01:01 635000 -- (-2414.338) [-2415.356] (-2420.397) (-2417.246) * (-2414.935) [-2421.446] (-2418.621) (-2421.542) -- 0:01:00 Average standard deviation of split frequencies: 0.005003 635500 -- [-2415.540] (-2415.352) (-2417.657) (-2419.668) * (-2418.840) (-2415.925) (-2425.647) [-2414.461] -- 0:01:00 636000 -- (-2418.238) (-2420.079) (-2418.695) [-2414.495] * (-2419.983) (-2420.049) [-2426.572] (-2421.286) -- 0:01:00 636500 -- (-2420.360) (-2419.207) (-2413.766) [-2415.741] * (-2422.828) [-2419.202] (-2418.793) (-2420.927) -- 0:01:01 637000 -- (-2415.522) (-2418.434) (-2415.969) [-2419.448] * (-2423.472) (-2424.203) (-2413.935) [-2415.896] -- 0:01:00 637500 -- (-2425.352) (-2420.503) [-2416.623] (-2422.623) * (-2420.292) (-2426.540) [-2414.586] (-2419.658) -- 0:01:00 638000 -- (-2426.793) [-2417.809] (-2417.232) (-2417.752) * (-2419.582) (-2425.190) [-2414.256] (-2416.122) -- 0:01:00 638500 -- (-2417.232) [-2418.399] (-2416.344) (-2412.091) * (-2415.017) [-2415.903] (-2421.370) (-2421.052) -- 0:01:00 639000 -- [-2419.558] (-2419.382) (-2417.006) (-2421.813) * (-2421.748) [-2417.110] (-2420.312) (-2418.092) -- 0:01:00 639500 -- (-2420.246) (-2425.598) [-2420.286] (-2415.253) * (-2422.031) (-2422.861) (-2420.761) [-2414.504] -- 0:01:00 640000 -- (-2411.747) [-2414.934] (-2418.023) (-2420.216) * [-2413.122] (-2422.984) (-2418.644) (-2417.283) -- 0:01:00 Average standard deviation of split frequencies: 0.005151 640500 -- (-2425.277) (-2418.156) [-2415.025] (-2426.275) * (-2414.907) [-2417.823] (-2416.850) (-2416.224) -- 0:01:00 641000 -- (-2415.948) (-2418.695) [-2420.846] (-2425.322) * (-2418.927) [-2416.209] (-2414.675) (-2424.376) -- 0:00:59 641500 -- (-2414.640) (-2415.199) [-2412.092] (-2426.847) * [-2421.984] (-2420.172) (-2418.853) (-2418.843) -- 0:00:59 642000 -- [-2412.773] (-2421.781) (-2422.356) (-2417.348) * (-2419.636) (-2417.813) [-2414.403] (-2423.924) -- 0:01:00 642500 -- [-2426.653] (-2421.761) (-2420.047) (-2418.466) * (-2419.124) [-2416.017] (-2415.856) (-2422.294) -- 0:01:00 643000 -- (-2421.462) [-2417.463] (-2417.950) (-2424.124) * (-2421.774) (-2425.068) (-2427.516) [-2420.581] -- 0:00:59 643500 -- (-2418.427) (-2419.955) (-2418.177) [-2418.697] * [-2414.797] (-2431.301) (-2423.532) (-2414.527) -- 0:00:59 644000 -- [-2420.963] (-2416.145) (-2419.426) (-2420.473) * (-2414.996) (-2414.542) (-2414.531) [-2421.431] -- 0:00:59 644500 -- (-2425.091) [-2420.889] (-2420.069) (-2415.998) * [-2418.376] (-2421.531) (-2417.768) (-2417.882) -- 0:00:59 645000 -- [-2419.024] (-2415.401) (-2420.152) (-2413.017) * (-2419.356) (-2427.712) [-2411.685] (-2416.242) -- 0:00:59 Average standard deviation of split frequencies: 0.004196 645500 -- [-2419.539] (-2415.363) (-2421.415) (-2418.389) * (-2422.246) (-2420.825) [-2415.385] (-2419.279) -- 0:00:59 646000 -- (-2415.651) [-2420.018] (-2421.369) (-2417.331) * (-2416.600) [-2417.334] (-2417.052) (-2418.814) -- 0:00:59 646500 -- [-2417.816] (-2416.569) (-2419.879) (-2415.586) * (-2414.239) [-2416.393] (-2415.239) (-2422.824) -- 0:00:59 647000 -- (-2425.115) [-2417.654] (-2413.713) (-2418.204) * (-2418.871) [-2418.574] (-2425.101) (-2411.760) -- 0:00:58 647500 -- [-2419.276] (-2419.646) (-2421.977) (-2415.983) * (-2416.504) (-2430.723) (-2422.506) [-2422.393] -- 0:00:58 648000 -- (-2420.819) (-2423.208) (-2425.610) [-2420.236] * (-2418.913) [-2417.636] (-2420.914) (-2423.679) -- 0:00:59 648500 -- [-2416.161] (-2416.405) (-2417.446) (-2448.476) * [-2413.339] (-2418.574) (-2424.167) (-2418.913) -- 0:00:59 649000 -- (-2419.046) (-2421.281) (-2420.302) [-2415.274] * (-2417.052) (-2421.114) (-2414.874) [-2424.522] -- 0:00:58 649500 -- [-2411.256] (-2418.603) (-2415.948) (-2424.176) * (-2417.654) (-2430.376) [-2413.827] (-2422.485) -- 0:00:58 650000 -- (-2419.700) (-2418.590) [-2413.673] (-2414.448) * (-2419.368) [-2422.502] (-2410.923) (-2425.327) -- 0:00:58 Average standard deviation of split frequencies: 0.004528 650500 -- [-2420.992] (-2426.923) (-2417.654) (-2425.057) * (-2419.579) [-2412.135] (-2415.366) (-2413.355) -- 0:00:58 651000 -- (-2420.278) (-2416.855) [-2421.151] (-2412.971) * [-2418.536] (-2418.520) (-2412.597) (-2422.758) -- 0:00:58 651500 -- (-2415.118) (-2421.853) (-2421.683) [-2414.560] * [-2418.114] (-2422.132) (-2415.863) (-2417.765) -- 0:00:58 652000 -- (-2415.962) [-2422.838] (-2419.048) (-2421.851) * (-2417.518) (-2419.647) [-2413.865] (-2423.547) -- 0:00:58 652500 -- (-2414.545) [-2417.731] (-2413.934) (-2419.726) * (-2420.260) [-2418.312] (-2415.387) (-2427.322) -- 0:00:58 653000 -- [-2414.785] (-2414.452) (-2415.167) (-2417.693) * (-2410.692) (-2414.842) [-2420.991] (-2419.733) -- 0:00:57 653500 -- (-2420.436) (-2416.117) (-2418.409) [-2420.877] * (-2425.814) (-2418.451) (-2423.906) [-2420.196] -- 0:00:58 654000 -- (-2424.818) [-2412.301] (-2416.380) (-2421.885) * (-2419.224) [-2415.348] (-2416.425) (-2415.376) -- 0:00:58 654500 -- (-2421.184) (-2420.962) [-2418.583] (-2425.984) * (-2419.357) (-2414.292) (-2421.807) [-2413.105] -- 0:00:58 655000 -- (-2418.661) (-2423.964) [-2419.375] (-2419.148) * [-2416.313] (-2420.093) (-2419.695) (-2415.182) -- 0:00:57 Average standard deviation of split frequencies: 0.005030 655500 -- [-2421.240] (-2426.103) (-2424.694) (-2421.033) * (-2417.676) (-2417.430) (-2415.329) [-2416.263] -- 0:00:57 656000 -- [-2415.882] (-2422.921) (-2415.936) (-2420.435) * [-2422.347] (-2420.157) (-2422.204) (-2426.384) -- 0:00:57 656500 -- (-2418.390) (-2422.900) (-2417.019) [-2413.534] * (-2422.277) [-2416.763] (-2423.323) (-2416.437) -- 0:00:57 657000 -- (-2427.416) [-2429.708] (-2417.160) (-2423.810) * (-2414.891) [-2415.941] (-2416.123) (-2418.801) -- 0:00:57 657500 -- (-2425.180) (-2425.122) [-2414.587] (-2413.281) * (-2420.818) [-2420.789] (-2417.643) (-2415.284) -- 0:00:57 658000 -- [-2417.616] (-2419.982) (-2413.283) (-2429.073) * (-2426.029) (-2430.136) [-2415.185] (-2416.449) -- 0:00:57 658500 -- [-2417.734] (-2419.033) (-2416.946) (-2419.506) * (-2419.406) [-2418.933] (-2416.274) (-2415.655) -- 0:00:57 659000 -- (-2423.236) [-2414.098] (-2414.817) (-2413.419) * (-2422.253) (-2422.197) [-2416.293] (-2421.666) -- 0:00:57 659500 -- [-2415.420] (-2419.470) (-2421.026) (-2418.496) * (-2429.237) [-2416.314] (-2427.254) (-2414.330) -- 0:00:57 660000 -- [-2421.133] (-2429.067) (-2417.483) (-2424.773) * (-2423.743) (-2418.713) (-2418.730) [-2421.354] -- 0:00:57 Average standard deviation of split frequencies: 0.005173 660500 -- (-2417.839) (-2421.396) (-2417.400) [-2411.806] * [-2421.715] (-2418.357) (-2427.465) (-2418.677) -- 0:00:57 661000 -- (-2416.741) [-2417.174] (-2419.047) (-2414.687) * (-2421.490) (-2421.828) (-2424.366) [-2417.281] -- 0:00:56 661500 -- (-2420.217) (-2414.770) [-2419.071] (-2418.383) * (-2418.644) (-2418.031) [-2416.704] (-2420.465) -- 0:00:56 662000 -- (-2424.487) (-2415.823) [-2419.096] (-2424.035) * (-2428.068) (-2418.772) (-2415.759) [-2425.784] -- 0:00:56 662500 -- [-2419.113] (-2421.183) (-2419.120) (-2422.893) * [-2419.886] (-2417.762) (-2415.550) (-2424.260) -- 0:00:56 663000 -- (-2421.510) [-2412.820] (-2418.453) (-2420.761) * (-2415.234) (-2414.087) [-2418.503] (-2419.967) -- 0:00:56 663500 -- (-2420.905) (-2417.361) [-2423.273] (-2419.203) * (-2413.358) (-2421.699) [-2415.504] (-2415.730) -- 0:00:56 664000 -- [-2416.009] (-2421.556) (-2423.405) (-2409.598) * (-2427.036) (-2422.579) [-2417.241] (-2416.867) -- 0:00:56 664500 -- (-2413.801) (-2427.009) [-2416.855] (-2422.089) * (-2420.276) (-2419.520) (-2428.696) [-2417.193] -- 0:00:56 665000 -- (-2418.680) (-2413.939) [-2418.756] (-2419.513) * (-2418.223) (-2417.867) (-2413.450) [-2423.725] -- 0:00:56 Average standard deviation of split frequencies: 0.006193 665500 -- [-2418.718] (-2415.376) (-2415.464) (-2420.255) * [-2423.511] (-2416.135) (-2410.391) (-2415.313) -- 0:00:56 666000 -- (-2418.458) (-2422.614) (-2414.371) [-2415.964] * (-2420.562) (-2426.125) (-2424.696) [-2416.945] -- 0:00:56 666500 -- [-2419.191] (-2421.461) (-2418.450) (-2420.861) * (-2420.594) (-2412.892) [-2412.796] (-2424.224) -- 0:00:56 667000 -- (-2425.617) (-2419.203) (-2414.974) [-2412.793] * (-2420.233) (-2419.138) (-2417.009) [-2416.935] -- 0:00:55 667500 -- (-2423.763) (-2418.203) (-2413.462) [-2416.121] * [-2422.873] (-2419.705) (-2414.309) (-2421.107) -- 0:00:55 668000 -- (-2420.069) (-2419.482) (-2427.402) [-2413.893] * (-2426.333) (-2416.876) [-2419.204] (-2422.019) -- 0:00:55 668500 -- (-2420.174) (-2417.808) [-2414.244] (-2418.087) * [-2417.787] (-2423.352) (-2420.596) (-2431.005) -- 0:00:55 669000 -- (-2422.711) [-2418.118] (-2416.023) (-2416.822) * (-2417.205) (-2417.280) [-2414.525] (-2427.396) -- 0:00:55 669500 -- (-2418.258) (-2422.232) [-2415.495] (-2416.741) * [-2413.806] (-2415.802) (-2418.727) (-2417.692) -- 0:00:55 670000 -- (-2415.184) (-2414.650) (-2417.958) [-2423.232] * (-2426.011) (-2417.747) (-2412.796) [-2419.112] -- 0:00:55 Average standard deviation of split frequencies: 0.006502 670500 -- (-2416.330) [-2413.055] (-2421.902) (-2414.925) * [-2423.323] (-2421.979) (-2411.923) (-2422.246) -- 0:00:55 671000 -- (-2415.264) [-2415.452] (-2419.354) (-2419.567) * (-2423.288) (-2421.293) (-2410.958) [-2421.265] -- 0:00:55 671500 -- [-2418.047] (-2420.042) (-2425.829) (-2422.075) * [-2412.575] (-2421.869) (-2432.336) (-2416.699) -- 0:00:55 672000 -- (-2421.869) (-2417.814) (-2429.856) [-2419.566] * (-2419.790) (-2416.051) (-2423.943) [-2413.392] -- 0:00:55 672500 -- [-2416.289] (-2417.888) (-2435.153) (-2426.481) * (-2412.942) (-2425.565) [-2420.258] (-2420.726) -- 0:00:55 673000 -- (-2422.253) [-2423.393] (-2424.615) (-2416.083) * [-2421.245] (-2425.325) (-2419.873) (-2420.529) -- 0:00:54 673500 -- (-2425.244) [-2421.436] (-2424.067) (-2411.420) * (-2420.959) (-2420.041) (-2427.216) [-2418.170] -- 0:00:54 674000 -- (-2425.775) [-2422.227] (-2418.137) (-2417.990) * (-2418.794) [-2416.245] (-2427.527) (-2419.365) -- 0:00:54 674500 -- [-2413.337] (-2423.831) (-2422.225) (-2415.042) * (-2416.247) (-2424.621) [-2423.903] (-2414.004) -- 0:00:54 675000 -- [-2417.636] (-2421.384) (-2415.172) (-2429.707) * (-2417.573) (-2420.400) (-2419.364) [-2417.654] -- 0:00:54 Average standard deviation of split frequencies: 0.005056 675500 -- (-2418.761) [-2415.562] (-2425.000) (-2415.783) * (-2420.087) [-2419.600] (-2418.993) (-2416.019) -- 0:00:54 676000 -- (-2419.247) (-2410.754) [-2416.484] (-2425.192) * (-2412.165) (-2422.710) [-2417.659] (-2417.191) -- 0:00:54 676500 -- (-2426.822) (-2413.443) [-2420.422] (-2417.220) * [-2417.236] (-2424.986) (-2415.516) (-2421.307) -- 0:00:54 677000 -- (-2427.350) (-2416.503) [-2419.706] (-2413.667) * (-2419.434) (-2426.317) [-2415.684] (-2425.321) -- 0:00:54 677500 -- (-2422.173) (-2428.225) [-2419.449] (-2423.014) * (-2428.965) [-2414.934] (-2426.831) (-2418.255) -- 0:00:54 678000 -- (-2419.837) (-2415.260) (-2417.343) [-2416.661] * [-2416.681] (-2417.353) (-2421.961) (-2413.380) -- 0:00:54 678500 -- (-2423.382) [-2418.466] (-2418.323) (-2421.964) * (-2420.213) (-2417.504) (-2418.072) [-2420.480] -- 0:00:54 679000 -- [-2420.195] (-2417.707) (-2420.320) (-2431.209) * (-2427.328) (-2417.143) (-2411.006) [-2415.540] -- 0:00:53 679500 -- [-2416.726] (-2417.595) (-2412.388) (-2416.872) * (-2426.672) [-2414.152] (-2418.499) (-2422.904) -- 0:00:53 680000 -- (-2417.710) [-2418.085] (-2418.883) (-2420.868) * (-2425.084) (-2417.723) [-2419.518] (-2419.314) -- 0:00:53 Average standard deviation of split frequencies: 0.004675 680500 -- (-2417.504) [-2415.453] (-2420.426) (-2419.228) * (-2415.588) [-2414.559] (-2416.189) (-2415.876) -- 0:00:53 681000 -- (-2418.536) [-2418.250] (-2416.891) (-2412.843) * [-2419.137] (-2412.741) (-2418.222) (-2421.774) -- 0:00:53 681500 -- (-2415.639) [-2412.000] (-2411.971) (-2417.988) * (-2416.052) [-2419.365] (-2417.531) (-2423.773) -- 0:00:53 682000 -- [-2418.945] (-2416.090) (-2420.758) (-2415.727) * (-2419.793) (-2423.255) (-2422.209) [-2413.394] -- 0:00:53 682500 -- (-2419.272) (-2415.227) [-2415.876] (-2417.731) * (-2423.099) (-2419.136) [-2419.860] (-2429.221) -- 0:00:53 683000 -- (-2417.865) (-2417.340) [-2416.948] (-2427.192) * [-2413.266] (-2429.885) (-2425.178) (-2422.704) -- 0:00:53 683500 -- (-2420.563) [-2413.495] (-2419.559) (-2423.316) * (-2427.505) [-2416.857] (-2418.828) (-2418.694) -- 0:00:53 684000 -- (-2416.698) [-2416.689] (-2420.817) (-2421.038) * (-2423.262) (-2420.611) [-2425.307] (-2419.372) -- 0:00:53 684500 -- (-2416.455) (-2414.639) (-2425.144) [-2419.007] * (-2427.068) (-2420.539) [-2413.874] (-2421.358) -- 0:00:53 685000 -- (-2418.665) [-2418.901] (-2420.023) (-2426.336) * (-2415.941) (-2418.069) [-2418.132] (-2418.008) -- 0:00:52 Average standard deviation of split frequencies: 0.004467 685500 -- (-2416.073) (-2422.039) (-2417.438) [-2419.678] * (-2418.423) (-2418.137) [-2411.829] (-2424.746) -- 0:00:52 686000 -- (-2412.649) (-2421.384) [-2415.639] (-2415.042) * (-2426.926) (-2412.675) [-2412.272] (-2411.286) -- 0:00:52 686500 -- (-2421.846) [-2414.856] (-2415.775) (-2413.508) * (-2423.484) (-2416.159) [-2423.206] (-2419.459) -- 0:00:52 687000 -- [-2424.122] (-2422.065) (-2417.332) (-2416.836) * (-2424.752) (-2422.399) [-2413.285] (-2415.562) -- 0:00:52 687500 -- (-2417.832) (-2422.139) (-2423.937) [-2415.623] * (-2423.427) (-2417.529) [-2420.112] (-2417.314) -- 0:00:52 688000 -- [-2416.836] (-2420.401) (-2421.832) (-2415.201) * (-2419.871) (-2418.134) (-2420.915) [-2417.464] -- 0:00:52 688500 -- (-2420.968) [-2416.498] (-2424.834) (-2425.063) * [-2417.073] (-2418.073) (-2409.936) (-2424.804) -- 0:00:52 689000 -- (-2424.930) (-2418.960) (-2416.493) [-2418.365] * (-2410.945) (-2417.523) [-2417.180] (-2423.513) -- 0:00:51 689500 -- (-2426.323) (-2422.637) [-2421.701] (-2422.336) * [-2412.024] (-2414.821) (-2419.544) (-2418.225) -- 0:00:52 690000 -- (-2416.984) (-2417.777) (-2425.612) [-2421.373] * [-2418.066] (-2413.422) (-2424.113) (-2415.742) -- 0:00:52 Average standard deviation of split frequencies: 0.004948 690500 -- (-2418.288) (-2417.551) (-2422.964) [-2427.252] * (-2419.117) (-2415.814) [-2418.282] (-2418.843) -- 0:00:51 691000 -- (-2421.540) [-2416.370] (-2429.618) (-2416.895) * [-2414.066] (-2418.008) (-2418.927) (-2421.796) -- 0:00:51 691500 -- [-2418.959] (-2415.433) (-2423.569) (-2425.888) * (-2418.643) (-2415.720) [-2411.831] (-2427.274) -- 0:00:51 692000 -- (-2420.520) [-2421.037] (-2430.824) (-2421.771) * (-2418.349) (-2418.447) (-2418.390) [-2417.033] -- 0:00:51 692500 -- (-2412.838) [-2414.865] (-2420.560) (-2428.248) * [-2414.505] (-2419.891) (-2418.549) (-2416.485) -- 0:00:51 693000 -- (-2417.122) (-2416.257) [-2413.392] (-2431.182) * (-2416.650) (-2414.873) [-2414.605] (-2420.846) -- 0:00:51 693500 -- [-2422.755] (-2418.349) (-2424.417) (-2417.996) * [-2416.691] (-2424.300) (-2419.344) (-2422.207) -- 0:00:51 694000 -- (-2416.833) [-2416.253] (-2423.979) (-2419.165) * (-2420.333) (-2422.649) [-2412.681] (-2419.664) -- 0:00:51 694500 -- (-2419.396) (-2418.909) [-2418.778] (-2417.894) * (-2419.364) [-2415.101] (-2416.023) (-2420.917) -- 0:00:51 695000 -- (-2411.814) (-2435.331) (-2420.730) [-2420.616] * (-2422.157) (-2420.961) (-2412.855) [-2421.724] -- 0:00:50 Average standard deviation of split frequencies: 0.004572 695500 -- (-2422.482) (-2426.304) (-2420.629) [-2417.757] * [-2418.176] (-2420.180) (-2418.186) (-2416.122) -- 0:00:51 696000 -- (-2416.742) (-2419.028) [-2415.579] (-2417.527) * [-2417.860] (-2420.003) (-2417.603) (-2419.047) -- 0:00:51 696500 -- (-2413.035) (-2417.133) (-2419.660) [-2418.361] * [-2413.683] (-2422.083) (-2421.371) (-2416.763) -- 0:00:50 697000 -- (-2422.233) [-2430.069] (-2427.158) (-2421.783) * (-2423.577) (-2424.696) (-2424.309) [-2414.392] -- 0:00:50 697500 -- (-2426.764) (-2414.890) (-2421.417) [-2419.647] * [-2417.982] (-2419.104) (-2416.859) (-2417.298) -- 0:00:50 698000 -- (-2419.312) [-2412.053] (-2423.057) (-2427.426) * (-2421.491) (-2420.463) (-2418.494) [-2414.308] -- 0:00:50 698500 -- (-2424.013) [-2411.741] (-2421.128) (-2417.263) * (-2418.295) (-2420.347) (-2419.649) [-2418.787] -- 0:00:50 699000 -- (-2419.020) (-2413.533) [-2416.309] (-2426.936) * (-2420.585) (-2425.589) [-2412.762] (-2415.777) -- 0:00:50 699500 -- (-2419.393) [-2411.106] (-2420.167) (-2415.130) * [-2419.834] (-2423.099) (-2420.486) (-2418.031) -- 0:00:50 700000 -- (-2418.291) (-2419.550) [-2415.853] (-2425.489) * (-2418.320) (-2419.062) [-2413.340] (-2423.850) -- 0:00:50 Average standard deviation of split frequencies: 0.003869 700500 -- (-2417.302) (-2429.158) [-2418.217] (-2421.344) * (-2429.776) (-2413.782) [-2416.991] (-2420.862) -- 0:00:50 701000 -- (-2419.850) (-2414.876) (-2416.861) [-2417.623] * [-2418.899] (-2415.353) (-2413.023) (-2421.371) -- 0:00:49 701500 -- (-2416.314) (-2421.045) [-2416.678] (-2420.338) * (-2418.759) (-2416.628) [-2417.549] (-2417.653) -- 0:00:50 702000 -- [-2419.578] (-2423.526) (-2428.123) (-2415.987) * [-2414.562] (-2416.423) (-2423.857) (-2428.008) -- 0:00:50 702500 -- (-2415.956) (-2419.175) (-2416.622) [-2420.833] * (-2421.708) (-2418.243) (-2416.790) [-2418.099] -- 0:00:49 703000 -- (-2418.080) (-2423.042) (-2414.333) [-2415.484] * (-2423.384) (-2426.714) [-2416.042] (-2422.667) -- 0:00:49 703500 -- (-2423.922) (-2417.642) [-2427.077] (-2417.098) * (-2422.722) (-2426.607) (-2424.076) [-2423.735] -- 0:00:49 704000 -- (-2416.978) (-2415.146) (-2423.982) [-2421.817] * (-2418.478) (-2411.676) [-2423.115] (-2419.492) -- 0:00:49 704500 -- (-2416.703) (-2427.217) (-2421.988) [-2423.291] * (-2417.576) [-2413.161] (-2421.146) (-2418.706) -- 0:00:49 705000 -- [-2414.789] (-2416.122) (-2420.451) (-2423.603) * [-2418.530] (-2425.172) (-2417.038) (-2418.055) -- 0:00:49 Average standard deviation of split frequencies: 0.004340 705500 -- [-2415.788] (-2414.304) (-2415.856) (-2422.893) * (-2418.977) [-2416.404] (-2431.946) (-2415.967) -- 0:00:49 706000 -- [-2423.168] (-2419.811) (-2420.720) (-2414.441) * [-2422.023] (-2415.296) (-2422.596) (-2417.726) -- 0:00:49 706500 -- (-2421.759) (-2418.102) (-2420.574) [-2418.802] * (-2417.543) (-2420.988) [-2412.732] (-2418.046) -- 0:00:49 707000 -- (-2418.455) (-2417.782) [-2417.892] (-2421.022) * (-2415.385) (-2420.702) [-2417.962] (-2420.659) -- 0:00:48 707500 -- (-2421.084) (-2418.345) [-2415.149] (-2424.213) * (-2417.048) (-2417.168) [-2422.953] (-2420.216) -- 0:00:49 708000 -- (-2418.270) (-2417.737) (-2421.413) [-2421.490] * [-2419.377] (-2416.229) (-2417.981) (-2425.315) -- 0:00:49 708500 -- (-2425.618) (-2415.462) [-2418.941] (-2425.876) * [-2414.462] (-2424.920) (-2414.185) (-2416.468) -- 0:00:48 709000 -- (-2421.637) (-2425.145) [-2418.721] (-2420.995) * [-2414.242] (-2415.801) (-2421.819) (-2417.728) -- 0:00:48 709500 -- (-2415.208) (-2416.012) [-2417.260] (-2418.510) * [-2419.672] (-2423.858) (-2421.598) (-2422.495) -- 0:00:48 710000 -- (-2418.227) (-2419.424) [-2421.116] (-2423.803) * [-2414.927] (-2424.790) (-2418.422) (-2413.385) -- 0:00:48 Average standard deviation of split frequencies: 0.004809 710500 -- (-2419.465) (-2418.699) (-2412.721) [-2422.667] * (-2413.996) (-2428.358) (-2417.124) [-2414.658] -- 0:00:48 711000 -- (-2416.608) [-2414.691] (-2418.964) (-2422.504) * (-2415.376) (-2424.358) [-2411.624] (-2417.633) -- 0:00:48 711500 -- (-2419.109) (-2419.286) (-2417.839) [-2426.041] * (-2419.878) [-2415.515] (-2420.522) (-2423.781) -- 0:00:48 712000 -- (-2435.414) (-2421.130) [-2410.047] (-2424.651) * [-2415.615] (-2416.136) (-2422.780) (-2421.926) -- 0:00:48 712500 -- (-2420.547) (-2416.371) (-2426.710) [-2416.504] * (-2416.768) (-2416.323) [-2411.705] (-2424.062) -- 0:00:48 713000 -- (-2420.489) (-2420.472) (-2418.374) [-2416.305] * (-2410.098) (-2413.940) (-2428.826) [-2422.551] -- 0:00:47 713500 -- [-2413.237] (-2416.927) (-2414.883) (-2422.201) * (-2416.890) (-2418.929) [-2419.239] (-2422.965) -- 0:00:48 714000 -- (-2424.954) [-2424.000] (-2417.361) (-2422.454) * [-2423.072] (-2424.947) (-2419.149) (-2417.147) -- 0:00:48 714500 -- (-2418.161) (-2416.723) [-2414.436] (-2417.696) * (-2419.424) (-2420.917) (-2420.712) [-2424.395] -- 0:00:47 715000 -- (-2418.127) (-2422.242) (-2418.763) [-2413.184] * (-2427.377) (-2418.564) (-2422.783) [-2415.028] -- 0:00:47 Average standard deviation of split frequencies: 0.004444 715500 -- [-2417.181] (-2423.161) (-2419.382) (-2416.009) * [-2417.232] (-2413.399) (-2420.289) (-2425.737) -- 0:00:47 716000 -- [-2417.582] (-2416.424) (-2421.919) (-2415.950) * (-2424.123) [-2414.765] (-2420.078) (-2417.785) -- 0:00:47 716500 -- (-2419.602) (-2416.142) (-2428.234) [-2412.595] * (-2414.690) [-2415.510] (-2415.113) (-2419.694) -- 0:00:47 717000 -- (-2419.026) (-2412.200) [-2418.972] (-2417.625) * [-2419.944] (-2417.175) (-2423.787) (-2416.284) -- 0:00:47 717500 -- (-2419.790) (-2421.213) [-2423.050] (-2416.997) * [-2420.177] (-2420.872) (-2423.191) (-2417.781) -- 0:00:47 718000 -- [-2416.385] (-2420.936) (-2412.934) (-2419.622) * (-2423.051) [-2420.602] (-2419.013) (-2424.109) -- 0:00:47 718500 -- (-2420.598) (-2416.895) [-2423.165] (-2416.195) * (-2419.724) (-2417.541) [-2418.322] (-2421.410) -- 0:00:47 719000 -- [-2410.998] (-2414.369) (-2421.760) (-2420.696) * (-2414.091) [-2417.457] (-2418.093) (-2428.001) -- 0:00:46 719500 -- [-2412.336] (-2431.224) (-2416.690) (-2419.193) * (-2422.837) [-2416.217] (-2422.390) (-2413.984) -- 0:00:46 720000 -- [-2416.766] (-2421.464) (-2416.988) (-2417.403) * [-2423.183] (-2416.061) (-2424.251) (-2423.280) -- 0:00:47 Average standard deviation of split frequencies: 0.004252 720500 -- (-2411.094) (-2423.181) (-2424.548) [-2417.986] * (-2430.269) [-2417.060] (-2427.782) (-2416.832) -- 0:00:46 721000 -- (-2419.272) (-2413.925) [-2414.579] (-2417.530) * (-2423.415) (-2410.881) [-2418.452] (-2420.771) -- 0:00:46 721500 -- (-2418.005) [-2419.108] (-2415.685) (-2416.535) * (-2419.944) (-2419.486) [-2414.549] (-2417.348) -- 0:00:46 722000 -- (-2420.902) (-2421.714) [-2418.245] (-2414.398) * (-2432.138) (-2418.980) (-2419.297) [-2413.882] -- 0:00:46 722500 -- [-2424.935] (-2416.328) (-2415.839) (-2417.848) * (-2425.906) [-2417.875] (-2421.491) (-2415.321) -- 0:00:46 723000 -- (-2417.942) [-2417.567] (-2419.143) (-2418.472) * (-2418.450) (-2418.217) (-2415.508) [-2420.870] -- 0:00:46 723500 -- [-2420.367] (-2420.473) (-2419.933) (-2421.337) * (-2422.897) [-2420.576] (-2413.974) (-2422.660) -- 0:00:46 724000 -- (-2419.285) (-2414.671) [-2409.281] (-2416.081) * (-2423.883) [-2419.445] (-2422.295) (-2422.261) -- 0:00:46 724500 -- (-2414.973) (-2420.820) [-2422.645] (-2426.777) * (-2428.458) (-2413.584) (-2421.074) [-2416.702] -- 0:00:46 725000 -- (-2421.422) (-2416.206) (-2420.591) [-2409.871] * (-2418.085) [-2417.965] (-2424.760) (-2416.912) -- 0:00:45 Average standard deviation of split frequencies: 0.004545 725500 -- [-2416.862] (-2414.237) (-2417.160) (-2415.696) * (-2425.239) (-2412.813) (-2412.999) [-2427.292] -- 0:00:45 726000 -- [-2416.198] (-2415.887) (-2420.312) (-2419.248) * (-2417.140) (-2417.579) [-2419.469] (-2417.904) -- 0:00:46 726500 -- (-2422.112) [-2414.785] (-2413.906) (-2426.294) * [-2415.613] (-2418.442) (-2417.697) (-2420.595) -- 0:00:45 727000 -- (-2421.160) (-2414.026) (-2416.187) [-2419.099] * [-2416.299] (-2420.416) (-2415.898) (-2415.928) -- 0:00:45 727500 -- [-2418.991] (-2410.986) (-2413.481) (-2421.709) * (-2415.803) (-2423.108) [-2415.453] (-2416.093) -- 0:00:45 728000 -- (-2422.476) [-2418.643] (-2418.125) (-2420.190) * [-2419.484] (-2428.604) (-2415.136) (-2417.644) -- 0:00:45 728500 -- (-2420.555) (-2413.682) (-2417.981) [-2426.857] * [-2423.339] (-2425.597) (-2427.951) (-2423.394) -- 0:00:45 729000 -- (-2421.285) (-2418.897) [-2426.560] (-2419.978) * (-2416.706) [-2413.391] (-2422.134) (-2416.196) -- 0:00:45 729500 -- (-2425.159) (-2416.494) [-2417.814] (-2422.537) * (-2411.168) [-2414.815] (-2415.714) (-2433.897) -- 0:00:45 730000 -- (-2422.099) [-2410.616] (-2418.853) (-2427.753) * (-2415.111) (-2416.996) [-2415.366] (-2428.626) -- 0:00:45 Average standard deviation of split frequencies: 0.004516 730500 -- (-2426.444) (-2418.461) (-2421.072) [-2421.856] * (-2417.100) (-2421.311) (-2422.109) [-2423.244] -- 0:00:45 731000 -- (-2421.261) (-2415.843) [-2419.888] (-2416.083) * (-2419.609) (-2420.170) [-2420.355] (-2419.946) -- 0:00:44 731500 -- (-2414.238) [-2418.157] (-2418.255) (-2416.343) * (-2425.357) [-2419.485] (-2420.061) (-2422.940) -- 0:00:44 732000 -- (-2414.504) [-2414.081] (-2415.879) (-2416.100) * (-2418.402) (-2418.687) [-2415.752] (-2425.997) -- 0:00:45 732500 -- (-2421.238) [-2425.036] (-2419.729) (-2426.106) * [-2416.103] (-2415.358) (-2420.227) (-2418.261) -- 0:00:44 733000 -- (-2417.757) (-2417.626) (-2414.824) [-2419.048] * (-2422.080) (-2416.047) (-2425.789) [-2420.556] -- 0:00:44 733500 -- (-2421.098) (-2417.717) (-2416.722) [-2426.588] * (-2415.677) (-2424.989) [-2416.674] (-2429.260) -- 0:00:44 734000 -- (-2422.250) (-2423.350) (-2418.289) [-2422.388] * (-2419.516) (-2416.421) (-2419.345) [-2421.200] -- 0:00:44 734500 -- (-2425.013) (-2417.809) [-2420.125] (-2415.956) * (-2417.467) [-2415.502] (-2419.457) (-2416.173) -- 0:00:44 735000 -- (-2423.925) [-2420.958] (-2423.725) (-2416.216) * (-2422.262) [-2413.167] (-2422.782) (-2422.554) -- 0:00:44 Average standard deviation of split frequencies: 0.004644 735500 -- [-2417.531] (-2414.385) (-2417.918) (-2416.510) * (-2422.127) (-2417.783) (-2416.571) [-2412.936] -- 0:00:44 736000 -- (-2423.552) (-2416.055) (-2419.595) [-2412.871] * [-2411.799] (-2423.086) (-2433.211) (-2418.408) -- 0:00:44 736500 -- (-2413.539) (-2410.869) (-2417.780) [-2416.020] * [-2418.194] (-2419.099) (-2431.197) (-2425.124) -- 0:00:44 737000 -- (-2415.277) (-2413.103) (-2423.864) [-2417.887] * (-2419.366) [-2418.586] (-2424.625) (-2427.295) -- 0:00:43 737500 -- (-2417.997) (-2424.010) [-2421.724] (-2421.486) * [-2423.681] (-2415.872) (-2427.252) (-2421.730) -- 0:00:43 738000 -- (-2423.756) (-2416.096) (-2423.778) [-2414.180] * [-2416.384] (-2425.753) (-2419.449) (-2417.949) -- 0:00:44 738500 -- [-2419.025] (-2424.022) (-2428.354) (-2416.961) * (-2418.234) (-2427.163) (-2424.868) [-2419.072] -- 0:00:43 739000 -- (-2419.195) (-2419.413) [-2423.946] (-2424.285) * (-2424.574) [-2414.311] (-2410.609) (-2419.578) -- 0:00:43 739500 -- (-2415.466) [-2420.348] (-2419.785) (-2419.222) * [-2423.489] (-2420.364) (-2416.011) (-2425.044) -- 0:00:43 740000 -- (-2417.781) (-2418.282) [-2421.610] (-2425.499) * (-2418.011) [-2427.146] (-2415.773) (-2421.385) -- 0:00:43 Average standard deviation of split frequencies: 0.004614 740500 -- [-2422.149] (-2418.882) (-2423.443) (-2420.409) * (-2424.940) (-2422.434) [-2419.554] (-2411.554) -- 0:00:43 741000 -- (-2420.010) (-2416.769) (-2418.282) [-2415.922] * (-2423.400) (-2416.698) (-2421.179) [-2416.637] -- 0:00:43 741500 -- (-2420.371) [-2414.001] (-2420.529) (-2423.216) * (-2419.881) (-2420.487) [-2417.822] (-2424.588) -- 0:00:43 742000 -- [-2416.750] (-2416.454) (-2420.049) (-2415.934) * (-2431.593) (-2417.712) [-2415.401] (-2421.101) -- 0:00:43 742500 -- (-2421.576) [-2417.404] (-2417.708) (-2423.574) * (-2426.764) (-2418.815) [-2419.467] (-2415.635) -- 0:00:43 743000 -- (-2426.654) (-2416.918) [-2415.550] (-2423.660) * (-2424.390) (-2422.546) [-2419.417] (-2417.856) -- 0:00:42 743500 -- (-2422.588) (-2422.080) [-2420.838] (-2421.252) * [-2422.257] (-2422.482) (-2424.609) (-2417.887) -- 0:00:42 744000 -- (-2416.325) [-2419.203] (-2412.390) (-2426.987) * (-2421.943) (-2422.670) [-2418.951] (-2414.666) -- 0:00:43 744500 -- [-2416.290] (-2423.055) (-2423.521) (-2422.680) * (-2421.088) (-2424.220) (-2413.222) [-2419.057] -- 0:00:42 745000 -- (-2413.816) (-2416.698) [-2418.193] (-2421.135) * (-2419.166) (-2418.772) (-2424.114) [-2419.645] -- 0:00:42 Average standard deviation of split frequencies: 0.004581 745500 -- [-2419.559] (-2418.455) (-2417.918) (-2424.546) * (-2418.284) (-2424.156) (-2418.373) [-2419.584] -- 0:00:42 746000 -- (-2415.924) (-2419.116) [-2417.169] (-2425.353) * (-2417.961) (-2415.885) [-2419.730] (-2416.116) -- 0:00:42 746500 -- (-2429.539) [-2420.976] (-2415.888) (-2412.994) * (-2421.407) (-2417.540) [-2410.072] (-2420.678) -- 0:00:42 747000 -- (-2423.090) (-2418.473) [-2416.290] (-2418.084) * [-2414.514] (-2425.738) (-2416.394) (-2420.588) -- 0:00:42 747500 -- (-2415.761) (-2426.603) [-2423.044] (-2420.951) * (-2422.177) (-2422.454) [-2415.553] (-2414.166) -- 0:00:42 748000 -- (-2416.571) [-2416.832] (-2426.356) (-2420.513) * (-2420.222) [-2415.439] (-2418.713) (-2424.463) -- 0:00:42 748500 -- (-2411.846) (-2428.357) (-2415.712) [-2417.076] * (-2423.611) [-2417.556] (-2421.970) (-2420.609) -- 0:00:42 749000 -- (-2419.848) (-2419.297) [-2416.277] (-2419.368) * [-2415.151] (-2425.742) (-2418.767) (-2419.603) -- 0:00:41 749500 -- (-2424.453) (-2419.065) [-2412.693] (-2420.818) * [-2424.790] (-2422.324) (-2422.283) (-2413.547) -- 0:00:41 750000 -- [-2421.915] (-2420.161) (-2419.582) (-2425.054) * (-2431.383) (-2418.598) (-2414.280) [-2416.023] -- 0:00:42 Average standard deviation of split frequencies: 0.004710 750500 -- [-2412.631] (-2422.252) (-2427.624) (-2422.244) * (-2420.209) (-2421.809) (-2414.909) [-2418.854] -- 0:00:41 751000 -- [-2411.643] (-2417.711) (-2427.990) (-2423.943) * (-2414.507) (-2419.758) [-2418.081] (-2421.932) -- 0:00:41 751500 -- (-2419.808) (-2417.738) (-2423.042) [-2415.020] * (-2417.636) (-2416.396) [-2418.587] (-2423.087) -- 0:00:41 752000 -- (-2418.414) (-2427.203) (-2421.475) [-2411.883] * (-2420.141) [-2421.310] (-2416.755) (-2424.425) -- 0:00:41 752500 -- [-2424.652] (-2422.617) (-2418.567) (-2428.886) * (-2425.842) [-2418.265] (-2415.204) (-2415.295) -- 0:00:41 753000 -- (-2417.258) (-2426.706) (-2422.290) [-2417.179] * (-2416.714) [-2415.376] (-2425.448) (-2418.422) -- 0:00:41 753500 -- [-2418.289] (-2419.622) (-2420.573) (-2414.013) * (-2422.687) (-2422.831) [-2415.626] (-2420.192) -- 0:00:41 754000 -- (-2422.164) [-2414.240] (-2425.725) (-2424.774) * (-2416.003) (-2413.585) [-2417.688] (-2419.735) -- 0:00:41 754500 -- [-2424.872] (-2421.527) (-2423.298) (-2421.418) * (-2421.985) (-2417.947) [-2421.144] (-2426.592) -- 0:00:40 755000 -- [-2414.611] (-2419.635) (-2417.520) (-2418.541) * (-2417.150) (-2421.402) (-2418.510) [-2419.997] -- 0:00:40 Average standard deviation of split frequencies: 0.004677 755500 -- (-2419.661) [-2414.898] (-2421.225) (-2427.846) * [-2417.084] (-2415.639) (-2421.688) (-2416.836) -- 0:00:40 756000 -- (-2421.752) [-2414.668] (-2417.775) (-2423.745) * (-2417.429) [-2412.735] (-2423.081) (-2421.744) -- 0:00:40 756500 -- [-2412.369] (-2419.466) (-2415.642) (-2418.315) * (-2424.973) [-2416.778] (-2422.360) (-2420.677) -- 0:00:40 757000 -- (-2415.735) [-2412.623] (-2418.186) (-2419.611) * (-2422.042) (-2415.265) [-2421.544] (-2420.908) -- 0:00:40 757500 -- [-2415.015] (-2421.765) (-2418.599) (-2420.387) * (-2419.861) [-2417.383] (-2419.111) (-2422.727) -- 0:00:40 758000 -- [-2415.722] (-2419.350) (-2413.571) (-2415.861) * (-2422.462) (-2418.064) (-2425.564) [-2417.939] -- 0:00:40 758500 -- (-2419.597) [-2419.148] (-2413.752) (-2412.856) * [-2421.668] (-2417.646) (-2431.390) (-2415.565) -- 0:00:40 759000 -- (-2414.957) [-2416.093] (-2428.987) (-2421.373) * (-2419.284) [-2417.531] (-2417.328) (-2416.820) -- 0:00:40 759500 -- [-2424.986] (-2428.622) (-2425.707) (-2417.382) * [-2411.806] (-2421.747) (-2418.495) (-2420.279) -- 0:00:40 760000 -- (-2417.845) [-2417.528] (-2416.345) (-2418.615) * (-2421.789) (-2414.806) [-2426.934] (-2417.560) -- 0:00:40 Average standard deviation of split frequencies: 0.005113 760500 -- (-2412.613) (-2415.541) (-2417.391) [-2420.085] * (-2420.691) (-2418.696) (-2420.447) [-2412.257] -- 0:00:39 761000 -- [-2416.297] (-2420.209) (-2418.717) (-2418.740) * (-2414.873) (-2422.142) [-2419.659] (-2424.452) -- 0:00:39 761500 -- (-2418.252) (-2420.174) (-2420.153) [-2415.145] * (-2420.470) (-2416.881) (-2411.604) [-2416.256] -- 0:00:39 762000 -- (-2417.332) [-2413.366] (-2413.640) (-2418.490) * [-2420.803] (-2420.300) (-2419.387) (-2423.270) -- 0:00:39 762500 -- [-2416.959] (-2418.477) (-2419.714) (-2416.350) * (-2417.514) (-2414.303) (-2424.397) [-2421.099] -- 0:00:39 763000 -- (-2426.505) [-2417.774] (-2424.242) (-2422.849) * (-2419.652) (-2420.334) [-2418.257] (-2424.038) -- 0:00:39 763500 -- (-2420.258) [-2419.718] (-2422.107) (-2420.987) * (-2420.949) (-2425.452) (-2427.830) [-2425.484] -- 0:00:39 764000 -- (-2424.544) (-2417.923) [-2418.307] (-2418.747) * (-2419.483) (-2427.344) [-2421.873] (-2428.214) -- 0:00:39 764500 -- [-2417.752] (-2418.001) (-2424.308) (-2423.318) * (-2420.000) (-2419.603) [-2416.517] (-2423.759) -- 0:00:39 765000 -- (-2422.107) (-2416.854) [-2415.386] (-2419.843) * (-2414.477) [-2416.486] (-2419.897) (-2421.296) -- 0:00:39 Average standard deviation of split frequencies: 0.005077 765500 -- (-2417.558) (-2412.150) [-2416.788] (-2418.091) * (-2409.576) (-2413.412) [-2416.308] (-2428.648) -- 0:00:39 766000 -- (-2429.052) [-2409.855] (-2418.575) (-2423.204) * [-2413.812] (-2414.245) (-2423.673) (-2415.012) -- 0:00:39 766500 -- (-2414.493) (-2421.094) [-2419.660] (-2424.231) * (-2420.768) [-2416.178] (-2426.501) (-2419.785) -- 0:00:38 767000 -- [-2416.712] (-2418.965) (-2422.196) (-2419.748) * (-2415.940) (-2417.307) [-2420.328] (-2418.452) -- 0:00:38 767500 -- (-2414.913) (-2416.763) [-2415.784] (-2425.875) * [-2429.335] (-2415.271) (-2426.143) (-2422.452) -- 0:00:38 768000 -- (-2422.250) (-2417.121) (-2414.406) [-2420.906] * (-2417.154) (-2418.515) [-2419.818] (-2425.873) -- 0:00:38 768500 -- (-2417.273) [-2416.028] (-2420.034) (-2416.948) * [-2415.035] (-2420.109) (-2422.729) (-2419.261) -- 0:00:38 769000 -- (-2424.880) (-2418.267) [-2420.331] (-2419.295) * (-2425.531) [-2413.831] (-2424.753) (-2425.745) -- 0:00:38 769500 -- (-2422.849) (-2421.122) (-2420.036) [-2414.952] * [-2415.771] (-2414.894) (-2430.222) (-2417.909) -- 0:00:38 770000 -- (-2425.406) (-2424.681) (-2421.652) [-2416.845] * (-2418.751) [-2414.509] (-2417.108) (-2416.077) -- 0:00:38 Average standard deviation of split frequencies: 0.006576 770500 -- (-2423.879) (-2415.215) [-2419.732] (-2423.893) * (-2418.553) (-2418.620) (-2417.715) [-2418.433] -- 0:00:38 771000 -- [-2433.979] (-2420.442) (-2425.129) (-2423.511) * (-2423.869) (-2428.689) [-2416.821] (-2417.123) -- 0:00:38 771500 -- (-2424.025) [-2417.212] (-2423.302) (-2425.339) * (-2421.977) [-2414.841] (-2417.288) (-2417.651) -- 0:00:38 772000 -- (-2418.845) [-2417.738] (-2419.575) (-2416.708) * (-2417.906) [-2417.986] (-2426.558) (-2417.604) -- 0:00:38 772500 -- [-2422.265] (-2415.188) (-2421.665) (-2421.001) * (-2418.420) [-2418.274] (-2422.933) (-2416.920) -- 0:00:37 773000 -- (-2424.567) (-2420.666) [-2414.774] (-2417.415) * (-2421.448) (-2419.854) [-2415.983] (-2414.639) -- 0:00:37 773500 -- (-2419.199) (-2418.832) (-2419.670) [-2428.119] * (-2420.678) [-2418.994] (-2412.593) (-2416.101) -- 0:00:37 774000 -- [-2411.347] (-2418.053) (-2418.941) (-2421.191) * (-2418.426) [-2417.563] (-2414.338) (-2414.901) -- 0:00:37 774500 -- (-2416.250) (-2418.153) [-2418.808] (-2421.834) * (-2419.177) (-2414.107) [-2414.545] (-2414.932) -- 0:00:37 775000 -- (-2420.189) (-2419.977) [-2418.813] (-2426.927) * (-2415.580) (-2423.338) (-2422.204) [-2415.128] -- 0:00:37 Average standard deviation of split frequencies: 0.007290 775500 -- (-2419.735) (-2421.189) [-2413.391] (-2428.062) * (-2414.443) [-2419.470] (-2419.562) (-2419.066) -- 0:00:37 776000 -- (-2422.278) (-2419.613) [-2415.584] (-2425.109) * (-2423.552) (-2414.194) (-2419.145) [-2423.921] -- 0:00:37 776500 -- [-2417.818] (-2419.801) (-2416.806) (-2417.304) * (-2423.034) (-2418.161) [-2420.226] (-2417.518) -- 0:00:37 777000 -- (-2420.720) (-2418.157) [-2417.610] (-2418.383) * (-2418.831) [-2420.471] (-2420.083) (-2426.495) -- 0:00:37 777500 -- (-2416.892) (-2424.351) [-2412.689] (-2416.905) * (-2414.418) [-2412.068] (-2426.450) (-2423.289) -- 0:00:37 778000 -- (-2418.000) (-2432.529) [-2416.265] (-2415.691) * (-2418.429) (-2415.732) (-2421.164) [-2428.208] -- 0:00:37 778500 -- (-2427.520) (-2427.311) [-2421.531] (-2412.661) * (-2417.263) (-2415.438) (-2420.600) [-2417.627] -- 0:00:36 779000 -- (-2416.356) [-2424.599] (-2414.088) (-2419.514) * [-2423.435] (-2412.413) (-2416.655) (-2416.490) -- 0:00:36 779500 -- (-2424.488) (-2422.466) [-2417.785] (-2418.104) * (-2416.777) (-2420.445) (-2421.579) [-2419.426] -- 0:00:36 780000 -- (-2420.342) [-2418.322] (-2422.854) (-2410.381) * (-2417.945) (-2422.550) (-2423.930) [-2424.902] -- 0:00:36 Average standard deviation of split frequencies: 0.006642 780500 -- (-2423.362) (-2422.783) (-2432.112) [-2417.305] * [-2422.083] (-2416.042) (-2416.789) (-2420.699) -- 0:00:36 781000 -- (-2422.472) (-2426.180) [-2417.904] (-2421.017) * (-2420.739) [-2416.195] (-2417.391) (-2417.441) -- 0:00:36 781500 -- (-2416.933) (-2420.199) (-2422.278) [-2422.788] * [-2421.126] (-2414.880) (-2417.099) (-2428.427) -- 0:00:36 782000 -- [-2419.515] (-2427.035) (-2422.168) (-2413.929) * (-2422.763) (-2420.247) (-2418.999) [-2416.155] -- 0:00:36 782500 -- [-2419.465] (-2414.901) (-2428.952) (-2416.375) * (-2414.263) [-2421.016] (-2423.583) (-2418.814) -- 0:00:36 783000 -- (-2429.477) [-2415.044] (-2424.185) (-2413.886) * (-2418.044) [-2418.737] (-2419.405) (-2423.639) -- 0:00:36 783500 -- [-2419.530] (-2416.708) (-2426.073) (-2416.730) * (-2429.868) (-2419.346) (-2416.273) [-2416.700] -- 0:00:36 784000 -- [-2417.385] (-2430.082) (-2430.287) (-2416.033) * [-2416.867] (-2422.397) (-2416.578) (-2419.328) -- 0:00:36 784500 -- (-2416.668) (-2415.791) [-2417.122] (-2421.916) * (-2423.689) (-2422.835) (-2416.384) [-2418.140] -- 0:00:35 785000 -- (-2419.599) (-2417.192) [-2416.908] (-2416.015) * [-2415.746] (-2423.588) (-2420.761) (-2416.959) -- 0:00:35 Average standard deviation of split frequencies: 0.006597 785500 -- (-2423.760) (-2431.090) (-2424.605) [-2421.811] * [-2417.602] (-2415.307) (-2425.635) (-2422.966) -- 0:00:35 786000 -- (-2423.870) (-2421.414) [-2421.824] (-2421.561) * (-2415.871) (-2416.531) [-2416.405] (-2418.241) -- 0:00:35 786500 -- [-2417.351] (-2414.392) (-2420.232) (-2425.196) * [-2414.417] (-2421.013) (-2417.956) (-2424.792) -- 0:00:35 787000 -- [-2415.482] (-2417.481) (-2416.736) (-2415.724) * (-2415.545) (-2415.159) [-2411.347] (-2425.565) -- 0:00:35 787500 -- (-2415.946) [-2416.265] (-2417.801) (-2424.807) * (-2418.378) (-2414.010) [-2412.739] (-2424.746) -- 0:00:35 788000 -- (-2416.070) (-2415.906) [-2417.672] (-2421.728) * (-2417.247) (-2419.617) [-2419.509] (-2421.115) -- 0:00:35 788500 -- (-2418.337) [-2415.845] (-2416.693) (-2420.866) * (-2421.187) (-2417.982) (-2417.944) [-2422.548] -- 0:00:35 789000 -- (-2422.358) [-2417.782] (-2416.335) (-2419.814) * (-2417.437) (-2419.020) [-2417.342] (-2417.609) -- 0:00:35 789500 -- (-2421.516) (-2419.284) [-2413.772] (-2418.501) * [-2421.007] (-2422.439) (-2420.978) (-2418.874) -- 0:00:35 790000 -- (-2420.961) (-2415.973) [-2420.281] (-2422.055) * (-2420.833) (-2421.457) (-2415.849) [-2416.414] -- 0:00:35 Average standard deviation of split frequencies: 0.006856 790500 -- (-2417.480) [-2418.481] (-2415.654) (-2419.659) * (-2419.948) (-2421.484) [-2412.936] (-2421.175) -- 0:00:34 791000 -- (-2420.394) (-2419.009) [-2414.392] (-2415.218) * (-2419.081) (-2424.267) [-2415.962] (-2416.175) -- 0:00:34 791500 -- [-2418.495] (-2425.188) (-2423.914) (-2425.002) * (-2420.513) (-2417.003) [-2421.367] (-2411.535) -- 0:00:34 792000 -- (-2418.986) (-2417.946) [-2416.873] (-2418.367) * (-2412.661) (-2427.174) (-2417.519) [-2416.858] -- 0:00:34 792500 -- [-2418.139] (-2419.315) (-2415.597) (-2425.763) * (-2412.813) [-2420.828] (-2417.317) (-2416.801) -- 0:00:34 793000 -- (-2425.841) (-2419.473) [-2418.718] (-2425.180) * (-2419.035) (-2417.629) [-2422.895] (-2420.062) -- 0:00:34 793500 -- (-2418.034) (-2421.342) (-2424.464) [-2415.298] * (-2421.889) (-2418.117) [-2425.187] (-2420.599) -- 0:00:34 794000 -- (-2421.232) [-2414.302] (-2417.307) (-2418.015) * (-2418.534) (-2414.887) [-2418.408] (-2416.389) -- 0:00:34 794500 -- (-2425.643) (-2411.527) (-2418.952) [-2411.504] * (-2426.654) (-2418.087) [-2421.493] (-2426.652) -- 0:00:34 795000 -- (-2417.877) (-2412.943) [-2417.653] (-2418.194) * (-2427.116) [-2417.130] (-2412.691) (-2417.935) -- 0:00:34 Average standard deviation of split frequencies: 0.006810 795500 -- [-2423.333] (-2422.218) (-2426.355) (-2417.099) * (-2421.511) (-2418.605) (-2415.906) [-2414.861] -- 0:00:34 796000 -- (-2429.310) (-2423.158) (-2422.216) [-2411.929] * (-2418.550) (-2417.304) [-2413.195] (-2428.664) -- 0:00:34 796500 -- (-2419.605) (-2431.290) (-2417.785) [-2424.719] * (-2416.025) [-2416.966] (-2421.588) (-2422.907) -- 0:00:33 797000 -- [-2417.707] (-2422.870) (-2420.591) (-2429.429) * (-2418.932) (-2430.548) [-2418.179] (-2426.035) -- 0:00:33 797500 -- (-2421.653) [-2410.794] (-2411.352) (-2410.394) * (-2417.134) (-2415.819) [-2417.328] (-2418.890) -- 0:00:33 798000 -- (-2415.546) (-2417.017) (-2423.442) [-2412.549] * [-2419.831] (-2420.758) (-2415.354) (-2414.390) -- 0:00:33 798500 -- (-2415.864) [-2412.408] (-2416.394) (-2423.597) * (-2421.461) (-2413.772) [-2415.146] (-2419.384) -- 0:00:33 799000 -- [-2419.239] (-2415.290) (-2420.155) (-2426.135) * [-2422.123] (-2418.545) (-2421.284) (-2426.179) -- 0:00:33 799500 -- (-2414.590) (-2415.310) (-2416.163) [-2431.487] * [-2420.876] (-2418.147) (-2422.488) (-2429.450) -- 0:00:33 800000 -- [-2416.399] (-2416.718) (-2421.089) (-2422.638) * (-2419.573) (-2415.476) (-2425.221) [-2424.017] -- 0:00:33 Average standard deviation of split frequencies: 0.006918 800500 -- (-2418.183) (-2418.563) [-2424.226] (-2418.059) * (-2424.596) (-2420.361) [-2420.527] (-2426.757) -- 0:00:33 801000 -- (-2427.064) [-2413.605] (-2413.504) (-2418.840) * (-2419.541) (-2415.400) [-2420.669] (-2422.343) -- 0:00:33 801500 -- (-2419.776) [-2415.913] (-2416.573) (-2417.716) * [-2416.163] (-2421.349) (-2421.281) (-2421.736) -- 0:00:33 802000 -- (-2420.628) [-2413.381] (-2423.468) (-2422.170) * [-2424.591] (-2419.843) (-2418.943) (-2419.426) -- 0:00:33 802500 -- (-2421.178) [-2410.834] (-2416.689) (-2420.993) * [-2424.967] (-2423.092) (-2423.696) (-2414.333) -- 0:00:32 803000 -- [-2428.266] (-2415.832) (-2420.135) (-2420.336) * [-2416.644] (-2427.072) (-2431.574) (-2413.507) -- 0:00:32 803500 -- (-2418.760) [-2418.422] (-2421.996) (-2417.994) * (-2421.297) (-2414.414) (-2420.175) [-2415.356] -- 0:00:32 804000 -- [-2416.668] (-2426.662) (-2420.292) (-2418.620) * [-2414.185] (-2417.368) (-2422.466) (-2416.118) -- 0:00:32 804500 -- (-2420.470) [-2415.513] (-2420.354) (-2412.526) * [-2414.850] (-2419.858) (-2416.272) (-2413.321) -- 0:00:32 805000 -- [-2421.226] (-2422.336) (-2418.889) (-2417.358) * (-2422.043) (-2424.210) [-2418.809] (-2425.211) -- 0:00:32 Average standard deviation of split frequencies: 0.007018 805500 -- (-2425.868) [-2419.017] (-2417.926) (-2418.412) * [-2418.846] (-2412.841) (-2414.629) (-2425.041) -- 0:00:32 806000 -- (-2423.553) (-2414.120) [-2414.184] (-2418.539) * (-2417.775) [-2417.364] (-2412.164) (-2423.224) -- 0:00:32 806500 -- (-2425.676) (-2419.021) [-2417.516] (-2420.333) * (-2411.625) (-2417.741) [-2417.048] (-2419.967) -- 0:00:32 807000 -- (-2419.736) [-2422.890] (-2419.035) (-2426.239) * (-2418.889) (-2414.787) (-2417.913) [-2414.350] -- 0:00:32 807500 -- (-2427.002) (-2418.897) (-2419.964) [-2419.413] * (-2417.189) (-2418.079) (-2416.544) [-2421.572] -- 0:00:32 808000 -- (-2417.650) (-2415.300) (-2418.664) [-2421.540] * (-2415.165) [-2424.454] (-2421.115) (-2419.129) -- 0:00:32 808500 -- (-2420.212) (-2412.702) (-2416.999) [-2418.826] * (-2417.377) (-2420.650) [-2416.902] (-2422.452) -- 0:00:31 809000 -- [-2422.246] (-2415.626) (-2421.337) (-2420.786) * [-2418.770] (-2417.664) (-2422.842) (-2424.258) -- 0:00:31 809500 -- (-2416.102) (-2419.022) [-2415.986] (-2427.842) * (-2427.337) (-2416.733) [-2421.131] (-2416.741) -- 0:00:31 810000 -- (-2419.512) (-2419.100) [-2415.643] (-2417.162) * (-2420.603) (-2421.262) [-2420.216] (-2415.000) -- 0:00:31 Average standard deviation of split frequencies: 0.006397 810500 -- (-2426.793) (-2417.509) (-2417.936) [-2414.774] * (-2417.802) (-2428.315) [-2416.213] (-2412.532) -- 0:00:31 811000 -- [-2422.422] (-2428.648) (-2413.202) (-2414.969) * (-2417.208) [-2417.952] (-2416.482) (-2422.281) -- 0:00:31 811500 -- [-2421.787] (-2423.843) (-2422.098) (-2412.143) * (-2414.048) [-2422.045] (-2417.423) (-2421.440) -- 0:00:31 812000 -- [-2424.212] (-2418.678) (-2414.752) (-2414.544) * (-2421.748) (-2416.292) (-2415.015) [-2419.550] -- 0:00:31 812500 -- (-2420.554) [-2414.510] (-2417.327) (-2417.243) * [-2416.853] (-2421.550) (-2418.012) (-2415.232) -- 0:00:31 813000 -- (-2424.542) (-2414.216) (-2422.897) [-2412.592] * (-2415.827) [-2419.377] (-2420.160) (-2423.170) -- 0:00:31 813500 -- (-2425.881) (-2414.667) (-2416.664) [-2417.838] * (-2427.478) (-2412.650) [-2411.833] (-2428.435) -- 0:00:31 814000 -- (-2419.742) (-2415.055) (-2411.732) [-2415.024] * (-2415.881) [-2415.646] (-2424.153) (-2425.125) -- 0:00:31 814500 -- (-2422.798) [-2413.673] (-2416.218) (-2417.823) * (-2417.491) (-2417.048) [-2419.103] (-2426.649) -- 0:00:30 815000 -- [-2415.900] (-2425.550) (-2421.525) (-2418.187) * [-2416.299] (-2416.558) (-2421.844) (-2429.646) -- 0:00:30 Average standard deviation of split frequencies: 0.007077 815500 -- [-2416.659] (-2414.199) (-2418.810) (-2426.862) * (-2414.455) (-2424.296) (-2422.800) [-2425.025] -- 0:00:30 816000 -- (-2416.874) (-2417.068) [-2416.334] (-2414.077) * [-2415.484] (-2424.389) (-2424.272) (-2416.891) -- 0:00:30 816500 -- (-2418.454) (-2422.992) (-2418.486) [-2427.104] * [-2418.979] (-2423.105) (-2420.584) (-2419.024) -- 0:00:30 817000 -- [-2418.419] (-2422.177) (-2422.312) (-2418.930) * (-2424.380) [-2418.852] (-2418.100) (-2417.224) -- 0:00:30 817500 -- (-2411.299) (-2424.839) [-2415.796] (-2417.932) * (-2416.506) (-2423.529) [-2413.561] (-2418.258) -- 0:00:30 818000 -- [-2415.384] (-2422.328) (-2420.142) (-2423.031) * (-2414.553) (-2417.638) [-2413.687] (-2411.665) -- 0:00:30 818500 -- (-2415.959) (-2420.326) (-2416.559) [-2420.312] * (-2417.681) (-2422.436) (-2420.927) [-2418.050] -- 0:00:30 819000 -- (-2425.382) [-2416.573] (-2420.218) (-2419.291) * (-2414.882) (-2424.123) [-2414.591] (-2421.324) -- 0:00:30 819500 -- (-2419.478) (-2417.812) (-2421.353) [-2414.780] * (-2415.471) (-2434.001) [-2417.917] (-2416.832) -- 0:00:30 820000 -- [-2414.594] (-2414.906) (-2421.407) (-2415.465) * (-2412.684) (-2425.063) [-2417.818] (-2422.921) -- 0:00:30 Average standard deviation of split frequencies: 0.007037 820500 -- (-2415.288) (-2417.213) (-2414.687) [-2417.123] * (-2421.164) (-2414.177) (-2421.127) [-2417.367] -- 0:00:29 821000 -- (-2425.777) (-2419.143) [-2413.781] (-2420.121) * (-2413.328) (-2425.141) (-2420.763) [-2418.208] -- 0:00:29 821500 -- (-2435.786) [-2420.648] (-2420.151) (-2423.001) * (-2424.823) (-2426.384) [-2416.255] (-2421.483) -- 0:00:29 822000 -- [-2419.481] (-2421.908) (-2424.351) (-2417.239) * (-2416.711) (-2418.134) (-2423.528) [-2418.731] -- 0:00:29 822500 -- (-2421.951) [-2416.606] (-2417.183) (-2435.356) * (-2413.910) (-2420.374) [-2416.532] (-2420.819) -- 0:00:29 823000 -- (-2413.592) (-2418.907) [-2415.862] (-2427.058) * [-2420.110] (-2422.433) (-2414.912) (-2423.485) -- 0:00:29 823500 -- (-2415.382) (-2414.150) [-2421.219] (-2422.750) * (-2418.605) (-2429.539) (-2420.508) [-2418.183] -- 0:00:29 824000 -- [-2413.748] (-2420.000) (-2420.870) (-2414.457) * (-2425.632) [-2416.358] (-2419.464) (-2428.349) -- 0:00:29 824500 -- [-2411.672] (-2425.581) (-2412.558) (-2412.276) * (-2415.990) [-2422.153] (-2425.523) (-2419.091) -- 0:00:29 825000 -- [-2416.170] (-2418.509) (-2419.178) (-2417.065) * (-2419.586) [-2414.902] (-2418.839) (-2417.460) -- 0:00:29 Average standard deviation of split frequencies: 0.006848 825500 -- (-2423.521) (-2419.144) (-2416.671) [-2414.866] * (-2424.358) (-2415.423) [-2416.429] (-2421.120) -- 0:00:29 826000 -- (-2420.287) [-2412.603] (-2413.957) (-2422.273) * (-2433.001) [-2417.526] (-2415.697) (-2422.541) -- 0:00:29 826500 -- [-2416.859] (-2419.874) (-2414.223) (-2419.177) * (-2416.556) [-2423.956] (-2422.654) (-2418.484) -- 0:00:28 827000 -- (-2415.142) [-2419.758] (-2425.227) (-2420.930) * (-2413.262) [-2417.339] (-2422.403) (-2419.409) -- 0:00:28 827500 -- (-2417.869) (-2417.251) (-2422.848) [-2414.533] * [-2417.345] (-2415.912) (-2429.428) (-2420.462) -- 0:00:28 828000 -- (-2416.187) (-2415.953) (-2417.084) [-2418.950] * (-2421.892) (-2417.176) [-2415.378] (-2414.345) -- 0:00:28 828500 -- (-2426.448) (-2421.514) (-2422.279) [-2415.585] * (-2422.160) [-2416.312] (-2421.432) (-2416.372) -- 0:00:28 829000 -- (-2423.987) (-2418.688) [-2418.714] (-2422.479) * (-2420.788) (-2422.831) [-2420.695] (-2413.691) -- 0:00:28 829500 -- [-2418.135] (-2424.882) (-2419.638) (-2424.232) * (-2414.311) [-2424.006] (-2416.739) (-2422.463) -- 0:00:28 830000 -- (-2421.516) (-2418.737) [-2421.123] (-2412.532) * (-2411.091) [-2416.419] (-2426.393) (-2426.831) -- 0:00:28 Average standard deviation of split frequencies: 0.006526 830500 -- (-2428.690) (-2414.540) (-2421.731) [-2418.693] * [-2412.720] (-2424.407) (-2417.507) (-2419.219) -- 0:00:28 831000 -- (-2421.744) (-2420.213) [-2413.328] (-2417.118) * (-2418.233) [-2419.515] (-2415.376) (-2425.619) -- 0:00:28 831500 -- (-2423.644) [-2416.954] (-2415.197) (-2420.928) * (-2418.843) (-2424.387) [-2414.597] (-2423.925) -- 0:00:28 832000 -- (-2428.243) (-2414.606) (-2419.752) [-2420.330] * (-2422.088) (-2418.208) (-2416.925) [-2422.277] -- 0:00:28 832500 -- (-2421.112) [-2411.520] (-2424.105) (-2418.137) * (-2420.742) (-2417.876) [-2417.400] (-2421.541) -- 0:00:27 833000 -- (-2433.434) (-2421.417) (-2417.789) [-2417.268] * (-2425.600) (-2424.101) [-2412.752] (-2417.212) -- 0:00:27 833500 -- (-2431.253) [-2419.290] (-2419.213) (-2422.486) * [-2414.429] (-2414.437) (-2417.494) (-2418.804) -- 0:00:27 834000 -- (-2422.344) (-2429.343) [-2421.137] (-2422.294) * (-2410.816) [-2416.657] (-2416.130) (-2418.742) -- 0:00:27 834500 -- (-2429.778) [-2417.150] (-2427.238) (-2419.775) * (-2425.682) [-2416.797] (-2425.949) (-2420.778) -- 0:00:27 835000 -- (-2424.021) (-2420.871) (-2419.438) [-2418.088] * (-2417.930) [-2416.264] (-2426.415) (-2415.344) -- 0:00:27 Average standard deviation of split frequencies: 0.005921 835500 -- (-2418.312) [-2422.358] (-2424.005) (-2413.394) * (-2420.512) (-2420.591) (-2427.074) [-2418.305] -- 0:00:27 836000 -- (-2421.379) (-2417.447) [-2418.830] (-2420.494) * [-2420.282] (-2419.283) (-2420.024) (-2426.884) -- 0:00:27 836500 -- [-2416.760] (-2416.559) (-2421.036) (-2418.037) * [-2420.772] (-2424.509) (-2415.766) (-2425.537) -- 0:00:27 837000 -- (-2421.377) [-2415.743] (-2424.001) (-2415.630) * [-2423.255] (-2416.816) (-2418.034) (-2417.882) -- 0:00:27 837500 -- (-2419.693) (-2420.254) [-2422.242] (-2415.921) * (-2420.773) [-2411.075] (-2420.408) (-2418.046) -- 0:00:27 838000 -- (-2411.122) (-2417.302) (-2426.613) [-2416.153] * [-2423.800] (-2417.890) (-2416.659) (-2421.617) -- 0:00:27 838500 -- (-2415.615) [-2416.269] (-2421.222) (-2411.484) * (-2425.923) (-2422.810) (-2420.470) [-2417.549] -- 0:00:26 839000 -- (-2419.742) (-2425.974) [-2420.121] (-2416.846) * [-2420.919] (-2420.985) (-2418.151) (-2419.681) -- 0:00:26 839500 -- [-2425.272] (-2424.901) (-2417.358) (-2422.102) * [-2416.801] (-2421.818) (-2416.571) (-2421.090) -- 0:00:26 840000 -- (-2423.064) (-2421.910) [-2413.805] (-2418.873) * (-2413.133) [-2418.245] (-2419.460) (-2421.234) -- 0:00:26 Average standard deviation of split frequencies: 0.006028 840500 -- (-2419.705) [-2416.875] (-2411.114) (-2426.100) * (-2416.726) (-2413.691) [-2415.156] (-2415.932) -- 0:00:26 841000 -- (-2421.621) (-2418.364) (-2415.378) [-2417.614] * (-2423.211) (-2423.732) [-2413.418] (-2419.997) -- 0:00:26 841500 -- (-2418.301) (-2420.320) (-2417.282) [-2417.561] * (-2420.617) [-2423.837] (-2422.280) (-2414.798) -- 0:00:26 842000 -- (-2419.253) (-2416.170) (-2416.584) [-2415.919] * (-2420.536) (-2421.733) (-2417.601) [-2416.146] -- 0:00:26 842500 -- (-2419.417) (-2413.768) [-2420.675] (-2419.047) * (-2415.034) (-2417.753) (-2422.031) [-2426.226] -- 0:00:26 843000 -- [-2420.982] (-2413.741) (-2420.392) (-2415.952) * (-2428.410) (-2416.843) (-2418.318) [-2416.851] -- 0:00:26 843500 -- (-2417.545) (-2411.295) (-2424.519) [-2419.625] * (-2417.284) (-2428.164) (-2416.303) [-2416.343] -- 0:00:26 844000 -- [-2414.912] (-2415.197) (-2423.153) (-2416.271) * [-2422.345] (-2422.853) (-2416.505) (-2419.855) -- 0:00:26 844500 -- [-2417.025] (-2417.888) (-2416.732) (-2421.747) * [-2413.411] (-2422.483) (-2422.260) (-2420.801) -- 0:00:25 845000 -- [-2419.720] (-2418.032) (-2417.994) (-2425.207) * (-2422.721) (-2421.327) (-2417.695) [-2415.089] -- 0:00:25 Average standard deviation of split frequencies: 0.005433 845500 -- (-2413.292) (-2421.494) (-2418.639) [-2419.032] * (-2433.789) (-2419.360) [-2414.066] (-2430.182) -- 0:00:25 846000 -- [-2413.279] (-2418.539) (-2417.648) (-2426.133) * (-2422.574) (-2414.484) [-2415.137] (-2428.152) -- 0:00:25 846500 -- [-2413.215] (-2426.395) (-2416.745) (-2420.908) * (-2418.834) (-2419.021) (-2419.613) [-2422.323] -- 0:00:25 847000 -- (-2414.598) [-2421.096] (-2427.874) (-2418.621) * [-2423.566] (-2424.639) (-2424.101) (-2416.058) -- 0:00:25 847500 -- (-2412.871) (-2417.520) (-2421.931) [-2419.117] * (-2418.014) (-2422.289) (-2415.034) [-2416.095] -- 0:00:25 848000 -- (-2416.063) (-2425.986) [-2418.999] (-2415.769) * (-2418.662) (-2418.088) (-2415.401) [-2421.688] -- 0:00:25 848500 -- (-2417.734) (-2429.842) [-2417.061] (-2419.288) * (-2420.244) (-2423.886) [-2415.560] (-2420.188) -- 0:00:25 849000 -- (-2418.626) (-2417.426) [-2416.806] (-2416.966) * (-2419.019) (-2418.520) [-2417.516] (-2420.581) -- 0:00:25 849500 -- (-2412.854) [-2412.287] (-2418.909) (-2426.796) * (-2416.845) (-2415.789) (-2422.948) [-2422.470] -- 0:00:25 850000 -- (-2418.058) [-2416.532] (-2416.400) (-2428.753) * (-2418.073) (-2413.509) (-2419.489) [-2414.118] -- 0:00:25 Average standard deviation of split frequencies: 0.005126 850500 -- (-2417.672) [-2410.850] (-2417.644) (-2421.116) * [-2422.247] (-2415.716) (-2422.671) (-2416.163) -- 0:00:24 851000 -- (-2421.553) [-2409.891] (-2420.023) (-2418.943) * (-2420.564) (-2423.859) [-2414.603] (-2417.724) -- 0:00:24 851500 -- (-2418.191) (-2415.020) [-2418.433] (-2421.425) * (-2421.008) [-2417.875] (-2416.233) (-2423.154) -- 0:00:24 852000 -- (-2426.583) (-2415.823) (-2417.817) [-2417.133] * (-2418.600) [-2415.599] (-2419.920) (-2415.744) -- 0:00:24 852500 -- [-2420.673] (-2415.679) (-2422.668) (-2423.466) * (-2424.375) [-2414.910] (-2421.797) (-2417.840) -- 0:00:24 853000 -- (-2423.605) (-2418.241) [-2418.759] (-2424.875) * [-2417.612] (-2413.830) (-2418.215) (-2415.947) -- 0:00:24 853500 -- (-2414.314) (-2412.946) (-2414.826) [-2419.327] * [-2419.058] (-2416.223) (-2415.806) (-2415.560) -- 0:00:24 854000 -- (-2415.111) (-2423.221) [-2413.259] (-2419.912) * [-2413.680] (-2411.759) (-2426.306) (-2420.467) -- 0:00:24 854500 -- [-2417.895] (-2421.843) (-2414.083) (-2425.950) * (-2419.173) [-2415.951] (-2414.883) (-2430.377) -- 0:00:24 855000 -- (-2417.220) (-2424.678) [-2423.454] (-2420.345) * (-2417.411) (-2421.088) [-2419.472] (-2428.004) -- 0:00:24 Average standard deviation of split frequencies: 0.005507 855500 -- (-2421.484) (-2417.214) [-2419.194] (-2422.556) * [-2416.325] (-2417.547) (-2417.422) (-2415.808) -- 0:00:24 856000 -- (-2421.459) (-2419.390) (-2426.888) [-2415.484] * (-2426.071) (-2416.007) [-2421.796] (-2420.968) -- 0:00:24 856500 -- (-2428.433) [-2415.523] (-2418.080) (-2416.178) * (-2410.205) (-2410.911) [-2418.843] (-2420.060) -- 0:00:23 857000 -- (-2424.031) (-2420.192) [-2425.245] (-2424.225) * (-2418.072) (-2415.364) [-2423.456] (-2413.830) -- 0:00:23 857500 -- (-2419.914) [-2414.719] (-2421.240) (-2415.706) * (-2412.293) (-2416.100) [-2420.890] (-2415.981) -- 0:00:23 858000 -- (-2425.349) (-2418.713) (-2417.088) [-2417.369] * (-2423.327) (-2424.975) (-2413.728) [-2418.119] -- 0:00:23 858500 -- [-2420.147] (-2418.539) (-2413.027) (-2430.986) * (-2420.328) (-2427.356) (-2417.034) [-2416.853] -- 0:00:23 859000 -- (-2422.125) (-2426.050) (-2418.964) [-2420.273] * (-2417.036) (-2424.278) (-2420.547) [-2419.136] -- 0:00:23 859500 -- (-2425.561) (-2416.711) [-2418.009] (-2419.124) * (-2417.590) (-2424.177) [-2414.246] (-2418.992) -- 0:00:23 860000 -- (-2426.237) [-2418.972] (-2421.885) (-2419.604) * [-2417.329] (-2422.586) (-2421.981) (-2421.287) -- 0:00:23 Average standard deviation of split frequencies: 0.006710 860500 -- (-2419.908) (-2418.278) [-2417.444] (-2418.798) * (-2422.238) [-2412.954] (-2426.618) (-2421.535) -- 0:00:23 861000 -- (-2420.672) (-2417.741) [-2416.765] (-2427.597) * (-2420.950) [-2418.678] (-2418.998) (-2420.195) -- 0:00:23 861500 -- (-2423.962) [-2415.860] (-2418.710) (-2414.876) * (-2423.308) (-2422.201) (-2419.654) [-2421.743] -- 0:00:23 862000 -- (-2417.962) (-2418.424) (-2423.952) [-2415.255] * (-2420.231) (-2420.768) [-2413.908] (-2426.996) -- 0:00:23 862500 -- (-2420.955) (-2418.623) [-2421.829] (-2420.061) * [-2423.590] (-2418.941) (-2418.959) (-2415.613) -- 0:00:22 863000 -- (-2421.560) (-2416.683) (-2416.977) [-2425.067] * (-2420.403) (-2421.213) (-2414.032) [-2413.522] -- 0:00:22 863500 -- (-2418.951) [-2421.359] (-2426.544) (-2414.929) * [-2423.179] (-2417.695) (-2430.279) (-2417.558) -- 0:00:22 864000 -- (-2418.233) (-2422.335) [-2421.878] (-2420.773) * (-2418.324) (-2419.001) [-2416.860] (-2419.446) -- 0:00:22 864500 -- [-2415.094] (-2420.581) (-2420.498) (-2416.349) * (-2428.081) (-2418.212) [-2414.062] (-2415.196) -- 0:00:22 865000 -- (-2422.657) [-2418.548] (-2420.578) (-2424.867) * (-2418.802) [-2423.105] (-2413.890) (-2420.982) -- 0:00:22 Average standard deviation of split frequencies: 0.006940 865500 -- (-2420.971) (-2416.000) [-2415.522] (-2415.428) * (-2415.397) (-2420.451) (-2419.135) [-2418.047] -- 0:00:22 866000 -- (-2425.068) (-2423.626) (-2419.445) [-2423.607] * (-2415.349) [-2418.264] (-2420.139) (-2418.826) -- 0:00:22 866500 -- (-2423.219) (-2422.679) (-2417.411) [-2416.174] * [-2419.848] (-2419.323) (-2419.575) (-2417.436) -- 0:00:22 867000 -- (-2417.504) (-2424.414) (-2417.691) [-2417.978] * [-2417.574] (-2419.174) (-2413.455) (-2419.333) -- 0:00:22 867500 -- (-2415.535) (-2417.352) [-2423.110] (-2415.139) * (-2413.085) (-2413.717) [-2416.023] (-2420.191) -- 0:00:22 868000 -- (-2427.408) [-2418.834] (-2416.193) (-2418.273) * (-2417.650) [-2415.961] (-2420.986) (-2418.579) -- 0:00:22 868500 -- (-2414.227) [-2421.296] (-2421.764) (-2425.190) * (-2415.126) [-2424.231] (-2422.167) (-2423.509) -- 0:00:21 869000 -- (-2416.185) (-2422.811) (-2418.102) [-2419.978] * (-2417.196) [-2418.507] (-2425.661) (-2417.947) -- 0:00:21 869500 -- (-2418.727) [-2418.490] (-2420.762) (-2426.263) * (-2420.044) (-2417.446) [-2422.619] (-2423.615) -- 0:00:21 870000 -- [-2414.282] (-2421.846) (-2417.515) (-2420.218) * (-2415.466) (-2416.571) (-2420.720) [-2412.002] -- 0:00:21 Average standard deviation of split frequencies: 0.006768 870500 -- (-2416.153) (-2415.318) [-2418.060] (-2420.333) * [-2419.002] (-2418.554) (-2422.650) (-2415.417) -- 0:00:21 871000 -- (-2422.598) (-2415.195) [-2419.576] (-2419.859) * (-2421.317) (-2420.004) [-2416.382] (-2414.629) -- 0:00:21 871500 -- (-2417.717) [-2417.188] (-2421.660) (-2414.684) * (-2414.752) (-2422.698) [-2419.846] (-2412.921) -- 0:00:21 872000 -- (-2425.432) (-2422.294) (-2413.365) [-2417.074] * (-2418.663) [-2425.842] (-2412.519) (-2420.410) -- 0:00:21 872500 -- (-2416.974) [-2420.651] (-2422.377) (-2413.627) * (-2415.002) (-2423.064) (-2418.126) [-2419.143] -- 0:00:21 873000 -- (-2416.516) (-2422.260) [-2420.473] (-2416.166) * (-2419.365) (-2420.730) [-2413.597] (-2418.300) -- 0:00:21 873500 -- (-2421.967) (-2427.537) [-2417.120] (-2423.178) * [-2414.187] (-2425.300) (-2413.099) (-2419.960) -- 0:00:21 874000 -- (-2416.579) (-2423.352) [-2417.971] (-2420.435) * (-2415.250) (-2413.565) [-2414.987] (-2414.153) -- 0:00:21 874500 -- (-2414.677) (-2419.091) [-2419.192] (-2419.988) * (-2415.505) (-2424.885) [-2415.307] (-2419.506) -- 0:00:20 875000 -- (-2420.027) (-2422.471) (-2421.708) [-2414.629] * (-2416.623) (-2430.041) [-2418.423] (-2422.561) -- 0:00:20 Average standard deviation of split frequencies: 0.007265 875500 -- [-2416.517] (-2422.781) (-2421.326) (-2421.227) * (-2412.264) [-2416.244] (-2421.620) (-2418.316) -- 0:00:20 876000 -- (-2417.114) [-2423.665] (-2419.669) (-2423.397) * (-2422.063) (-2422.847) (-2417.610) [-2418.441] -- 0:00:20 876500 -- [-2414.713] (-2422.338) (-2414.341) (-2418.020) * (-2418.690) (-2431.253) [-2412.243] (-2415.197) -- 0:00:20 877000 -- [-2411.924] (-2423.586) (-2417.590) (-2418.790) * (-2418.229) [-2423.963] (-2415.538) (-2415.054) -- 0:00:20 877500 -- [-2418.877] (-2421.601) (-2417.387) (-2429.461) * (-2413.447) (-2416.474) (-2415.399) [-2418.560] -- 0:00:20 878000 -- (-2420.052) [-2417.965] (-2420.701) (-2417.907) * (-2421.047) (-2428.415) (-2424.246) [-2418.188] -- 0:00:20 878500 -- (-2419.125) [-2416.879] (-2419.027) (-2419.955) * (-2417.090) (-2421.227) (-2419.370) [-2427.897] -- 0:00:20 879000 -- (-2416.548) (-2415.991) [-2416.320] (-2429.473) * [-2416.339] (-2423.713) (-2423.866) (-2428.491) -- 0:00:20 879500 -- [-2412.440] (-2419.215) (-2418.799) (-2424.908) * [-2418.129] (-2421.118) (-2422.003) (-2425.866) -- 0:00:20 880000 -- (-2421.518) (-2421.204) (-2417.098) [-2421.395] * [-2421.151] (-2418.817) (-2419.751) (-2419.444) -- 0:00:20 Average standard deviation of split frequencies: 0.008029 880500 -- (-2422.200) (-2427.121) (-2417.849) [-2421.302] * (-2432.042) (-2413.304) [-2411.416] (-2419.445) -- 0:00:19 881000 -- (-2411.583) (-2421.143) [-2416.235] (-2422.644) * (-2416.959) [-2416.198] (-2416.087) (-2418.840) -- 0:00:19 881500 -- (-2415.333) [-2412.792] (-2416.189) (-2424.790) * (-2417.871) [-2417.783] (-2420.131) (-2420.691) -- 0:00:19 882000 -- (-2416.362) [-2417.005] (-2415.685) (-2417.331) * [-2418.059] (-2421.302) (-2423.056) (-2425.866) -- 0:00:19 882500 -- [-2417.263] (-2417.625) (-2427.410) (-2419.549) * [-2420.088] (-2414.419) (-2421.505) (-2423.337) -- 0:00:19 883000 -- (-2418.588) (-2417.754) (-2427.826) [-2421.092] * [-2418.912] (-2429.973) (-2420.244) (-2426.187) -- 0:00:19 883500 -- (-2414.824) [-2418.761] (-2428.555) (-2420.343) * (-2427.084) (-2425.794) [-2411.533] (-2426.528) -- 0:00:19 884000 -- (-2413.621) [-2418.081] (-2427.618) (-2423.570) * [-2417.645] (-2424.702) (-2418.813) (-2420.918) -- 0:00:19 884500 -- (-2417.996) [-2419.038] (-2429.813) (-2427.535) * (-2422.210) (-2423.536) [-2417.691] (-2417.222) -- 0:00:19 885000 -- (-2423.956) [-2416.940] (-2420.803) (-2422.090) * (-2416.786) (-2421.071) (-2413.357) [-2413.803] -- 0:00:19 Average standard deviation of split frequencies: 0.008779 885500 -- (-2416.482) (-2425.082) [-2418.073] (-2415.711) * [-2418.067] (-2426.208) (-2420.030) (-2423.353) -- 0:00:19 886000 -- [-2418.248] (-2419.397) (-2417.775) (-2419.314) * (-2414.803) (-2418.466) [-2415.785] (-2426.474) -- 0:00:19 886500 -- (-2419.055) (-2414.920) [-2424.956] (-2424.427) * (-2420.123) (-2416.710) [-2419.086] (-2423.191) -- 0:00:18 887000 -- [-2420.140] (-2414.284) (-2416.297) (-2419.988) * (-2413.742) [-2417.733] (-2423.874) (-2420.302) -- 0:00:18 887500 -- (-2418.823) (-2421.602) (-2417.217) [-2422.115] * (-2419.250) (-2427.248) [-2416.601] (-2417.681) -- 0:00:18 888000 -- (-2415.569) (-2419.383) [-2421.288] (-2413.650) * (-2424.548) (-2422.820) (-2414.060) [-2415.160] -- 0:00:18 888500 -- [-2415.661] (-2422.018) (-2425.455) (-2413.038) * [-2421.024] (-2416.353) (-2422.421) (-2424.898) -- 0:00:18 889000 -- (-2423.291) (-2422.844) (-2417.204) [-2416.956] * [-2417.836] (-2440.698) (-2418.362) (-2423.415) -- 0:00:18 889500 -- (-2420.061) [-2420.095] (-2425.381) (-2418.079) * [-2413.986] (-2412.064) (-2423.447) (-2415.768) -- 0:00:18 890000 -- (-2431.325) (-2421.302) [-2416.038] (-2419.454) * (-2418.645) (-2415.301) [-2413.110] (-2416.921) -- 0:00:18 Average standard deviation of split frequencies: 0.008733 890500 -- [-2418.703] (-2418.928) (-2427.696) (-2417.851) * (-2430.086) (-2416.797) [-2418.456] (-2413.627) -- 0:00:18 891000 -- [-2416.060] (-2422.577) (-2423.820) (-2423.546) * (-2427.858) (-2414.658) [-2415.589] (-2421.967) -- 0:00:18 891500 -- [-2418.705] (-2414.603) (-2430.208) (-2435.328) * [-2421.850] (-2418.853) (-2414.629) (-2417.162) -- 0:00:18 892000 -- (-2422.637) (-2425.856) (-2424.007) [-2413.344] * (-2422.868) (-2422.406) (-2414.991) [-2415.129] -- 0:00:18 892500 -- (-2422.272) (-2411.247) (-2421.237) [-2412.362] * (-2416.442) [-2415.465] (-2425.677) (-2425.696) -- 0:00:17 893000 -- (-2417.151) (-2412.226) (-2418.079) [-2413.260] * (-2414.202) (-2419.288) [-2419.145] (-2417.495) -- 0:00:17 893500 -- [-2421.748] (-2423.899) (-2414.832) (-2421.733) * [-2414.294] (-2417.656) (-2428.834) (-2422.123) -- 0:00:17 894000 -- [-2415.785] (-2419.466) (-2419.935) (-2416.387) * [-2415.202] (-2413.281) (-2416.985) (-2420.557) -- 0:00:17 894500 -- (-2424.484) (-2417.198) (-2415.818) [-2421.465] * (-2415.389) (-2421.593) [-2415.352] (-2415.301) -- 0:00:17 895000 -- [-2416.394] (-2424.752) (-2411.016) (-2421.375) * (-2414.860) (-2421.001) [-2417.984] (-2414.812) -- 0:00:17 Average standard deviation of split frequencies: 0.007892 895500 -- (-2415.944) (-2421.316) [-2417.823] (-2414.412) * (-2420.216) (-2418.291) [-2414.849] (-2414.824) -- 0:00:17 896000 -- [-2414.835] (-2419.375) (-2418.001) (-2418.852) * (-2417.083) (-2418.844) [-2415.874] (-2414.792) -- 0:00:17 896500 -- (-2419.510) [-2420.622] (-2420.006) (-2413.480) * [-2415.037] (-2422.041) (-2416.913) (-2419.613) -- 0:00:17 897000 -- (-2419.292) (-2418.196) (-2416.363) [-2426.915] * (-2419.415) [-2416.017] (-2424.159) (-2419.742) -- 0:00:17 897500 -- (-2419.585) (-2420.137) (-2417.470) [-2416.203] * [-2418.064] (-2419.668) (-2422.075) (-2421.301) -- 0:00:17 898000 -- (-2420.763) (-2415.831) [-2412.890] (-2422.845) * (-2417.318) (-2418.800) (-2429.325) [-2415.557] -- 0:00:17 898500 -- (-2414.155) [-2416.762] (-2415.578) (-2417.305) * [-2414.865] (-2416.436) (-2420.740) (-2417.943) -- 0:00:16 899000 -- (-2419.862) [-2417.623] (-2411.234) (-2415.715) * [-2420.139] (-2421.224) (-2413.673) (-2414.637) -- 0:00:16 899500 -- [-2419.955] (-2419.772) (-2415.892) (-2414.105) * (-2422.349) [-2411.059] (-2416.252) (-2418.137) -- 0:00:16 900000 -- (-2424.826) (-2419.414) [-2412.388] (-2409.949) * (-2414.452) [-2416.144] (-2416.726) (-2416.924) -- 0:00:16 Average standard deviation of split frequencies: 0.007720 900500 -- (-2422.815) [-2420.545] (-2419.230) (-2412.157) * (-2419.530) (-2422.746) (-2417.659) [-2417.495] -- 0:00:16 901000 -- [-2418.980] (-2419.830) (-2423.839) (-2412.587) * [-2415.168] (-2421.901) (-2422.244) (-2418.714) -- 0:00:16 901500 -- (-2418.405) [-2420.516] (-2421.557) (-2414.242) * (-2421.346) (-2418.476) [-2421.368] (-2425.273) -- 0:00:16 902000 -- (-2416.589) (-2419.814) [-2417.602] (-2420.035) * (-2420.831) [-2419.255] (-2422.787) (-2421.680) -- 0:00:16 902500 -- (-2424.033) [-2419.944] (-2424.815) (-2418.422) * [-2421.209] (-2423.341) (-2418.798) (-2421.738) -- 0:00:16 903000 -- (-2419.348) [-2422.138] (-2423.045) (-2416.562) * (-2419.409) (-2427.393) [-2415.338] (-2417.282) -- 0:00:16 903500 -- (-2415.775) [-2421.481] (-2419.932) (-2416.881) * [-2419.585] (-2428.184) (-2415.019) (-2420.750) -- 0:00:16 904000 -- (-2414.612) (-2421.509) (-2419.719) [-2414.933] * [-2418.160] (-2422.266) (-2426.056) (-2419.888) -- 0:00:16 904500 -- (-2416.643) (-2416.296) [-2415.638] (-2421.698) * (-2421.835) (-2416.630) (-2432.918) [-2416.113] -- 0:00:15 905000 -- (-2415.503) (-2411.172) [-2416.730] (-2419.036) * (-2424.075) [-2417.164] (-2417.753) (-2418.855) -- 0:00:15 Average standard deviation of split frequencies: 0.006634 905500 -- [-2426.942] (-2413.056) (-2419.142) (-2418.225) * (-2426.263) (-2416.963) [-2415.088] (-2414.890) -- 0:00:15 906000 -- (-2420.780) (-2418.208) (-2423.361) [-2419.367] * [-2414.896] (-2420.621) (-2419.352) (-2423.224) -- 0:00:15 906500 -- (-2429.072) [-2426.841] (-2423.780) (-2412.846) * (-2418.507) (-2417.367) [-2417.595] (-2415.909) -- 0:00:15 907000 -- [-2410.591] (-2413.948) (-2421.649) (-2416.646) * (-2415.569) [-2420.408] (-2419.805) (-2419.787) -- 0:00:15 907500 -- (-2425.238) (-2421.235) (-2420.608) [-2414.345] * (-2424.799) (-2423.298) (-2423.659) [-2417.369] -- 0:00:15 908000 -- (-2422.657) (-2416.646) [-2423.259] (-2415.688) * (-2419.447) (-2419.875) [-2423.373] (-2420.744) -- 0:00:15 908500 -- (-2418.652) [-2418.296] (-2418.225) (-2423.149) * (-2427.090) (-2427.036) [-2421.440] (-2413.472) -- 0:00:15 909000 -- [-2423.090] (-2417.256) (-2416.768) (-2424.712) * [-2420.018] (-2415.918) (-2416.514) (-2418.535) -- 0:00:15 909500 -- [-2420.257] (-2416.386) (-2415.859) (-2416.824) * (-2417.802) (-2421.414) (-2419.401) [-2419.620] -- 0:00:15 910000 -- (-2423.852) [-2420.076] (-2424.734) (-2415.897) * (-2423.988) [-2422.761] (-2415.135) (-2417.198) -- 0:00:15 Average standard deviation of split frequencies: 0.006212 910500 -- (-2418.952) (-2426.582) [-2431.449] (-2420.327) * [-2416.939] (-2422.603) (-2425.754) (-2419.429) -- 0:00:14 911000 -- (-2412.849) (-2421.082) [-2414.775] (-2419.162) * (-2416.483) (-2416.156) [-2418.053] (-2412.461) -- 0:00:14 911500 -- (-2418.248) (-2423.177) [-2428.093] (-2420.177) * (-2412.739) (-2421.113) [-2421.024] (-2424.275) -- 0:00:14 912000 -- (-2415.529) (-2419.456) [-2414.413] (-2419.814) * (-2421.691) (-2417.726) [-2424.225] (-2418.197) -- 0:00:14 912500 -- (-2416.723) (-2420.083) [-2419.767] (-2415.202) * (-2420.940) (-2411.615) (-2420.937) [-2419.302] -- 0:00:14 913000 -- (-2416.325) [-2424.589] (-2416.843) (-2417.628) * (-2415.645) (-2413.179) (-2425.507) [-2420.992] -- 0:00:14 913500 -- (-2414.557) (-2416.789) (-2422.736) [-2426.668] * (-2424.264) [-2411.932] (-2422.195) (-2412.423) -- 0:00:14 914000 -- (-2416.153) (-2418.537) (-2416.416) [-2424.072] * (-2422.342) [-2417.318] (-2422.102) (-2415.300) -- 0:00:14 914500 -- (-2429.295) (-2417.304) [-2419.333] (-2426.914) * (-2411.908) (-2422.336) (-2433.222) [-2420.369] -- 0:00:14 915000 -- (-2419.343) (-2416.040) [-2416.633] (-2424.835) * (-2421.606) [-2414.581] (-2417.208) (-2417.332) -- 0:00:14 Average standard deviation of split frequencies: 0.005918 915500 -- [-2423.159] (-2421.593) (-2414.777) (-2418.451) * (-2427.944) (-2420.086) (-2423.333) [-2414.654] -- 0:00:14 916000 -- (-2422.172) [-2418.143] (-2414.083) (-2422.080) * (-2425.843) (-2422.011) (-2429.359) [-2418.232] -- 0:00:14 916500 -- (-2424.785) (-2421.662) (-2413.528) [-2414.502] * (-2426.742) (-2422.779) (-2418.440) [-2416.895] -- 0:00:13 917000 -- [-2415.623] (-2419.974) (-2414.715) (-2421.611) * (-2420.974) (-2426.470) (-2418.866) [-2419.192] -- 0:00:13 917500 -- (-2421.203) (-2423.847) [-2413.403] (-2416.142) * (-2423.729) (-2425.259) (-2424.575) [-2418.052] -- 0:00:13 918000 -- [-2415.428] (-2417.020) (-2420.554) (-2416.729) * (-2420.454) (-2425.264) [-2422.958] (-2418.892) -- 0:00:13 918500 -- [-2423.847] (-2420.598) (-2423.178) (-2420.914) * (-2421.959) (-2428.342) [-2416.995] (-2421.492) -- 0:00:13 919000 -- (-2417.497) (-2414.400) (-2423.484) [-2414.688] * (-2422.403) [-2419.710] (-2417.268) (-2421.548) -- 0:00:13 919500 -- [-2422.651] (-2415.799) (-2414.658) (-2414.182) * [-2415.824] (-2417.616) (-2414.688) (-2420.938) -- 0:00:13 920000 -- (-2415.236) (-2418.372) [-2414.822] (-2420.418) * (-2416.610) [-2419.625] (-2419.155) (-2427.430) -- 0:00:13 Average standard deviation of split frequencies: 0.005760 920500 -- (-2424.800) (-2421.451) (-2420.188) [-2416.200] * (-2416.100) (-2418.662) (-2423.134) [-2413.626] -- 0:00:13 921000 -- (-2413.697) [-2416.318] (-2421.311) (-2423.637) * [-2410.871] (-2431.412) (-2416.912) (-2417.809) -- 0:00:13 921500 -- (-2418.750) (-2422.771) [-2416.059] (-2434.788) * [-2411.652] (-2421.689) (-2421.305) (-2420.479) -- 0:00:13 922000 -- [-2419.689] (-2424.889) (-2417.534) (-2424.303) * [-2416.395] (-2417.228) (-2422.477) (-2432.402) -- 0:00:13 922500 -- (-2419.857) (-2420.507) (-2416.089) [-2421.532] * (-2420.411) (-2415.870) (-2421.589) [-2420.959] -- 0:00:12 923000 -- [-2416.773] (-2413.398) (-2419.548) (-2421.909) * (-2420.222) (-2416.447) [-2417.878] (-2426.995) -- 0:00:12 923500 -- (-2417.755) (-2419.204) [-2420.716] (-2415.524) * (-2418.269) (-2412.820) [-2418.434] (-2425.939) -- 0:00:12 924000 -- (-2418.986) (-2415.987) [-2416.166] (-2415.569) * (-2419.619) [-2415.222] (-2423.235) (-2419.160) -- 0:00:12 924500 -- (-2423.051) (-2415.818) (-2415.465) [-2422.301] * [-2417.726] (-2419.699) (-2419.874) (-2418.453) -- 0:00:12 925000 -- (-2420.920) (-2422.489) [-2418.983] (-2424.491) * [-2417.721] (-2418.682) (-2422.958) (-2417.852) -- 0:00:12 Average standard deviation of split frequencies: 0.005727 925500 -- (-2420.605) (-2419.933) [-2412.815] (-2424.321) * [-2412.253] (-2416.214) (-2417.271) (-2416.969) -- 0:00:12 926000 -- (-2419.743) (-2423.543) [-2418.495] (-2429.485) * (-2420.189) (-2414.533) [-2422.971] (-2418.860) -- 0:00:12 926500 -- (-2418.187) [-2421.646] (-2417.958) (-2422.408) * (-2420.597) (-2419.173) [-2419.888] (-2415.150) -- 0:00:12 927000 -- (-2418.442) (-2417.626) [-2427.099] (-2421.538) * [-2412.082] (-2422.030) (-2414.647) (-2416.362) -- 0:00:12 927500 -- (-2416.539) (-2420.641) (-2421.450) [-2417.468] * [-2422.685] (-2421.790) (-2417.379) (-2417.806) -- 0:00:12 928000 -- (-2419.445) [-2419.824] (-2419.120) (-2421.104) * (-2417.799) (-2427.158) [-2417.573] (-2421.123) -- 0:00:12 928500 -- [-2417.870] (-2428.297) (-2417.598) (-2425.640) * (-2425.049) (-2418.788) [-2417.744] (-2424.660) -- 0:00:11 929000 -- (-2430.607) (-2419.008) [-2418.119] (-2417.101) * (-2420.170) [-2411.927] (-2418.181) (-2427.014) -- 0:00:11 929500 -- (-2428.300) (-2417.944) [-2415.983] (-2422.049) * (-2416.619) (-2415.432) (-2414.508) [-2421.334] -- 0:00:11 930000 -- (-2417.305) (-2413.520) [-2424.406] (-2416.858) * [-2414.474] (-2420.791) (-2412.836) (-2419.315) -- 0:00:11 Average standard deviation of split frequencies: 0.004939 930500 -- (-2421.789) [-2416.470] (-2420.074) (-2422.685) * (-2415.956) [-2417.523] (-2420.809) (-2421.539) -- 0:00:11 931000 -- [-2421.117] (-2414.700) (-2413.343) (-2419.049) * (-2422.048) (-2420.745) (-2417.076) [-2421.895] -- 0:00:11 931500 -- (-2411.929) (-2425.606) (-2419.770) [-2423.237] * (-2421.094) (-2415.167) (-2414.965) [-2413.708] -- 0:00:11 932000 -- (-2414.112) (-2418.751) (-2418.042) [-2421.386] * (-2421.512) [-2411.370] (-2425.547) (-2412.113) -- 0:00:11 932500 -- (-2418.317) (-2415.071) [-2424.288] (-2414.392) * [-2416.802] (-2415.815) (-2413.695) (-2422.502) -- 0:00:11 933000 -- [-2416.634] (-2420.261) (-2417.286) (-2414.082) * (-2416.483) (-2424.417) [-2417.766] (-2414.233) -- 0:00:11 933500 -- (-2420.979) [-2420.895] (-2418.107) (-2416.875) * (-2410.069) (-2415.410) (-2430.536) [-2417.653] -- 0:00:11 934000 -- (-2415.735) (-2418.065) (-2415.281) [-2415.318] * (-2415.236) [-2414.904] (-2418.675) (-2417.430) -- 0:00:11 934500 -- (-2418.423) (-2415.461) [-2420.757] (-2413.009) * [-2417.195] (-2433.234) (-2425.895) (-2423.283) -- 0:00:10 935000 -- [-2416.888] (-2424.570) (-2416.989) (-2415.635) * (-2417.214) (-2415.663) [-2417.109] (-2422.343) -- 0:00:10 Average standard deviation of split frequencies: 0.004910 935500 -- (-2415.948) [-2417.291] (-2425.625) (-2417.758) * (-2423.763) [-2413.058] (-2422.131) (-2426.574) -- 0:00:10 936000 -- (-2419.662) (-2416.061) [-2416.353] (-2418.651) * [-2414.089] (-2415.893) (-2416.257) (-2420.894) -- 0:00:10 936500 -- (-2417.954) (-2417.206) [-2412.601] (-2433.132) * (-2410.977) (-2414.834) [-2414.793] (-2419.130) -- 0:00:10 937000 -- (-2413.598) [-2412.546] (-2415.079) (-2420.586) * (-2415.475) [-2414.316] (-2418.086) (-2417.770) -- 0:00:10 937500 -- (-2412.497) (-2415.895) (-2416.533) [-2421.012] * (-2418.378) (-2416.118) (-2427.203) [-2415.537] -- 0:00:10 938000 -- (-2416.984) [-2414.696] (-2419.878) (-2416.051) * (-2418.882) (-2416.360) (-2427.338) [-2416.828] -- 0:00:10 938500 -- (-2423.959) (-2420.019) [-2415.228] (-2424.064) * (-2420.761) [-2412.776] (-2417.890) (-2419.962) -- 0:00:10 939000 -- (-2426.489) (-2417.322) (-2422.107) [-2424.750] * (-2423.113) (-2422.047) [-2423.061] (-2418.836) -- 0:00:10 939500 -- (-2422.154) [-2420.336] (-2414.615) (-2417.595) * (-2418.320) [-2417.381] (-2425.807) (-2414.053) -- 0:00:10 940000 -- (-2426.055) (-2414.791) [-2417.295] (-2415.207) * (-2421.687) (-2419.782) [-2422.657] (-2415.278) -- 0:00:10 Average standard deviation of split frequencies: 0.005137 940500 -- (-2430.625) (-2418.468) (-2414.510) [-2413.176] * (-2422.623) (-2422.455) [-2427.239] (-2415.436) -- 0:00:09 941000 -- (-2424.149) (-2417.864) (-2417.937) [-2419.248] * [-2423.539] (-2417.722) (-2419.121) (-2421.605) -- 0:00:09 941500 -- [-2418.590] (-2419.425) (-2416.774) (-2428.916) * (-2418.045) [-2417.691] (-2427.228) (-2416.801) -- 0:00:09 942000 -- (-2419.439) (-2413.029) [-2415.374] (-2416.533) * (-2419.712) (-2418.309) [-2422.842] (-2426.457) -- 0:00:09 942500 -- [-2412.625] (-2418.935) (-2418.736) (-2424.164) * [-2419.211] (-2416.862) (-2420.901) (-2425.497) -- 0:00:09 943000 -- (-2415.945) [-2421.040] (-2413.637) (-2412.961) * (-2418.985) (-2416.628) (-2415.337) [-2425.224] -- 0:00:09 943500 -- (-2412.603) [-2426.579] (-2425.678) (-2428.650) * (-2416.715) [-2417.416] (-2417.945) (-2422.701) -- 0:00:09 944000 -- (-2428.833) [-2416.916] (-2422.995) (-2419.605) * (-2428.298) (-2422.600) (-2419.957) [-2417.391] -- 0:00:09 944500 -- (-2413.904) (-2420.006) [-2412.924] (-2421.945) * (-2417.248) (-2415.990) (-2418.674) [-2414.860] -- 0:00:09 945000 -- [-2415.378] (-2418.282) (-2419.220) (-2421.893) * (-2421.059) (-2420.058) (-2417.230) [-2424.047] -- 0:00:09 Average standard deviation of split frequencies: 0.005232 945500 -- [-2415.973] (-2420.471) (-2423.264) (-2416.464) * (-2423.184) (-2422.087) [-2414.914] (-2429.432) -- 0:00:09 946000 -- (-2415.657) [-2422.518] (-2416.862) (-2424.825) * (-2420.617) [-2417.310] (-2428.064) (-2423.272) -- 0:00:09 946500 -- [-2414.940] (-2421.458) (-2421.379) (-2420.901) * [-2417.611] (-2412.873) (-2417.199) (-2415.785) -- 0:00:08 947000 -- (-2420.481) [-2425.148] (-2412.847) (-2425.168) * (-2420.875) (-2418.465) (-2421.269) [-2417.236] -- 0:00:08 947500 -- (-2419.962) [-2419.997] (-2420.708) (-2425.702) * [-2422.680] (-2419.193) (-2411.003) (-2417.650) -- 0:00:08 948000 -- [-2414.125] (-2420.121) (-2422.918) (-2419.417) * [-2413.611] (-2422.661) (-2420.212) (-2427.706) -- 0:00:08 948500 -- (-2413.808) (-2425.149) [-2420.486] (-2415.827) * (-2416.041) (-2413.581) [-2418.505] (-2421.108) -- 0:00:08 949000 -- (-2421.415) [-2420.100] (-2417.746) (-2419.198) * [-2417.173] (-2416.374) (-2415.459) (-2420.964) -- 0:00:08 949500 -- (-2413.127) (-2415.797) (-2428.680) [-2425.298] * [-2414.331] (-2417.390) (-2410.338) (-2426.290) -- 0:00:08 950000 -- (-2419.020) [-2414.534] (-2424.807) (-2415.241) * (-2425.433) (-2411.596) (-2415.571) [-2422.286] -- 0:00:08 Average standard deviation of split frequencies: 0.005455 950500 -- (-2420.801) [-2411.683] (-2432.382) (-2418.587) * (-2415.864) [-2416.044] (-2420.579) (-2424.675) -- 0:00:08 951000 -- (-2415.265) [-2416.981] (-2422.946) (-2415.336) * (-2420.759) (-2416.235) [-2415.429] (-2417.844) -- 0:00:08 951500 -- [-2420.772] (-2427.655) (-2428.806) (-2414.841) * (-2422.369) [-2413.236] (-2414.079) (-2420.100) -- 0:00:08 952000 -- (-2420.684) [-2418.295] (-2419.429) (-2419.405) * (-2420.868) (-2417.505) (-2423.993) [-2420.147] -- 0:00:08 952500 -- (-2417.139) (-2417.493) [-2414.585] (-2417.993) * (-2425.341) (-2422.686) [-2416.426] (-2421.466) -- 0:00:07 953000 -- (-2422.236) (-2422.869) [-2414.127] (-2418.881) * (-2424.012) (-2428.032) [-2417.157] (-2419.207) -- 0:00:07 953500 -- [-2417.090] (-2418.917) (-2415.754) (-2414.489) * (-2415.336) (-2420.142) [-2417.483] (-2422.192) -- 0:00:07 954000 -- [-2413.563] (-2417.919) (-2419.294) (-2416.073) * (-2418.963) (-2411.511) [-2417.320] (-2417.573) -- 0:00:07 954500 -- (-2422.398) (-2427.794) (-2422.775) [-2415.236] * (-2418.729) (-2417.975) [-2415.404] (-2415.522) -- 0:00:07 955000 -- (-2420.014) (-2421.157) [-2415.807] (-2416.993) * [-2421.495] (-2416.583) (-2412.328) (-2423.023) -- 0:00:07 Average standard deviation of split frequencies: 0.005671 955500 -- [-2415.338] (-2418.886) (-2415.180) (-2421.611) * (-2417.894) (-2417.825) (-2416.567) [-2416.556] -- 0:00:07 956000 -- (-2417.058) (-2420.291) [-2415.024] (-2417.993) * (-2420.480) (-2422.031) (-2421.008) [-2411.720] -- 0:00:07 956500 -- (-2418.803) [-2419.587] (-2418.743) (-2419.293) * (-2421.607) (-2418.256) [-2421.594] (-2419.680) -- 0:00:07 957000 -- [-2411.990] (-2418.607) (-2424.177) (-2423.939) * (-2417.481) (-2421.426) (-2418.094) [-2416.129] -- 0:00:07 957500 -- [-2421.127] (-2418.605) (-2416.690) (-2437.183) * [-2418.098] (-2418.877) (-2418.622) (-2423.344) -- 0:00:07 958000 -- (-2416.664) [-2414.309] (-2423.328) (-2419.043) * (-2419.358) (-2431.545) [-2418.177] (-2420.955) -- 0:00:07 958500 -- [-2418.146] (-2417.581) (-2422.799) (-2416.827) * (-2416.554) (-2420.778) [-2415.826] (-2423.184) -- 0:00:06 959000 -- (-2417.189) (-2422.494) (-2429.189) [-2422.900] * (-2424.328) (-2423.129) [-2417.934] (-2422.002) -- 0:00:06 959500 -- (-2423.331) (-2418.539) (-2428.380) [-2420.183] * [-2412.531] (-2424.190) (-2426.790) (-2418.340) -- 0:00:06 960000 -- (-2417.850) [-2420.543] (-2421.113) (-2421.499) * (-2416.588) [-2419.205] (-2415.019) (-2429.126) -- 0:00:06 Average standard deviation of split frequencies: 0.006502 960500 -- (-2424.512) (-2416.538) (-2418.438) [-2420.158] * (-2417.339) (-2422.705) [-2416.861] (-2426.195) -- 0:00:06 961000 -- (-2423.276) (-2420.493) [-2420.243] (-2416.506) * (-2415.327) (-2432.136) [-2423.511] (-2415.441) -- 0:00:06 961500 -- (-2425.907) (-2409.985) [-2418.784] (-2419.668) * [-2418.422] (-2414.007) (-2420.049) (-2423.385) -- 0:00:06 962000 -- [-2416.582] (-2422.319) (-2416.842) (-2417.292) * (-2422.278) (-2418.873) [-2412.567] (-2418.162) -- 0:00:06 962500 -- (-2424.795) [-2421.492] (-2415.936) (-2418.819) * (-2423.286) (-2418.553) (-2418.150) [-2417.717] -- 0:00:06 963000 -- [-2420.258] (-2419.721) (-2422.498) (-2426.443) * (-2430.061) (-2417.308) [-2414.355] (-2423.607) -- 0:00:06 963500 -- (-2417.893) (-2421.088) [-2418.017] (-2416.776) * (-2431.489) (-2419.568) [-2415.353] (-2419.055) -- 0:00:06 964000 -- [-2417.617] (-2415.448) (-2426.128) (-2420.046) * [-2431.248] (-2416.066) (-2422.853) (-2422.505) -- 0:00:06 964500 -- (-2424.988) (-2425.102) (-2417.404) [-2421.859] * (-2425.378) (-2418.416) [-2422.148] (-2427.173) -- 0:00:05 965000 -- (-2421.330) [-2423.291] (-2422.780) (-2418.091) * (-2419.645) (-2425.200) [-2419.542] (-2421.814) -- 0:00:05 Average standard deviation of split frequencies: 0.007198 965500 -- (-2421.911) (-2425.237) (-2418.903) [-2415.835] * (-2417.920) [-2418.361] (-2420.473) (-2421.433) -- 0:00:05 966000 -- (-2424.803) (-2416.971) [-2423.525] (-2429.578) * (-2422.927) (-2426.156) [-2419.383] (-2418.410) -- 0:00:05 966500 -- [-2413.353] (-2417.182) (-2416.937) (-2421.587) * (-2416.024) [-2423.012] (-2417.338) (-2417.453) -- 0:00:05 967000 -- [-2420.574] (-2423.453) (-2417.749) (-2419.655) * (-2413.187) (-2427.892) (-2419.241) [-2413.723] -- 0:00:05 967500 -- [-2418.298] (-2421.659) (-2419.610) (-2420.837) * [-2424.459] (-2423.113) (-2424.149) (-2419.613) -- 0:00:05 968000 -- [-2414.629] (-2417.210) (-2412.493) (-2421.475) * (-2418.224) (-2418.694) [-2420.245] (-2410.146) -- 0:00:05 968500 -- (-2416.931) (-2416.300) (-2424.061) [-2412.656] * [-2413.028] (-2427.682) (-2422.272) (-2413.259) -- 0:00:05 969000 -- (-2425.537) [-2418.599] (-2423.013) (-2430.807) * (-2421.923) [-2415.628] (-2423.851) (-2418.342) -- 0:00:05 969500 -- [-2413.302] (-2420.119) (-2415.655) (-2417.140) * [-2420.161] (-2422.014) (-2423.686) (-2417.655) -- 0:00:05 970000 -- [-2411.039] (-2415.046) (-2414.691) (-2419.784) * [-2416.037] (-2417.907) (-2419.634) (-2422.351) -- 0:00:05 Average standard deviation of split frequencies: 0.007163 970500 -- (-2418.495) (-2418.187) [-2415.524] (-2424.149) * [-2420.218] (-2422.086) (-2429.285) (-2417.338) -- 0:00:04 971000 -- (-2419.611) (-2416.308) [-2422.699] (-2415.614) * [-2413.776] (-2414.452) (-2423.671) (-2413.265) -- 0:00:04 971500 -- [-2418.400] (-2420.003) (-2424.933) (-2413.807) * (-2416.483) (-2416.553) (-2425.455) [-2417.615] -- 0:00:04 972000 -- (-2416.831) [-2419.334] (-2426.939) (-2413.117) * (-2418.760) (-2429.480) (-2427.533) [-2413.435] -- 0:00:04 972500 -- (-2420.650) (-2417.651) (-2428.194) [-2414.155] * (-2417.216) [-2420.181] (-2421.482) (-2419.626) -- 0:00:04 973000 -- (-2419.960) (-2416.395) [-2416.640] (-2422.928) * (-2416.975) (-2415.459) (-2421.010) [-2419.050] -- 0:00:04 973500 -- [-2424.126] (-2417.974) (-2423.164) (-2417.413) * (-2419.177) [-2413.976] (-2418.454) (-2425.345) -- 0:00:04 974000 -- (-2423.624) (-2425.428) [-2426.719] (-2427.146) * (-2421.032) (-2417.909) (-2417.717) [-2422.773] -- 0:00:04 974500 -- (-2416.191) (-2421.342) [-2418.365] (-2430.994) * [-2419.624] (-2417.213) (-2422.054) (-2419.728) -- 0:00:04 975000 -- (-2419.920) (-2415.205) [-2416.287] (-2422.336) * (-2414.856) (-2412.188) (-2417.452) [-2415.575] -- 0:00:04 Average standard deviation of split frequencies: 0.006400 975500 -- (-2417.331) [-2416.088] (-2414.123) (-2427.187) * [-2417.198] (-2423.664) (-2421.456) (-2416.490) -- 0:00:04 976000 -- (-2415.193) [-2417.201] (-2412.789) (-2426.361) * [-2420.368] (-2426.300) (-2414.512) (-2422.368) -- 0:00:04 976500 -- (-2416.649) (-2419.775) [-2414.651] (-2417.783) * (-2420.564) (-2424.675) (-2421.129) [-2416.370] -- 0:00:03 977000 -- [-2416.533] (-2426.930) (-2415.707) (-2420.844) * (-2417.833) (-2418.819) (-2417.905) [-2416.222] -- 0:00:03 977500 -- (-2420.263) (-2424.072) [-2416.220] (-2421.880) * [-2418.534] (-2418.141) (-2413.791) (-2424.433) -- 0:00:03 978000 -- (-2420.964) (-2427.069) [-2411.874] (-2415.796) * (-2421.088) (-2415.485) (-2419.973) [-2420.092] -- 0:00:03 978500 -- (-2420.323) [-2421.364] (-2418.925) (-2415.277) * (-2424.143) (-2420.026) (-2422.475) [-2416.817] -- 0:00:03 979000 -- (-2415.118) [-2417.861] (-2419.128) (-2414.068) * (-2429.034) [-2418.988] (-2412.477) (-2419.697) -- 0:00:03 979500 -- [-2422.837] (-2418.768) (-2415.637) (-2417.253) * (-2430.757) (-2419.965) [-2414.824] (-2416.830) -- 0:00:03 980000 -- (-2417.406) [-2413.440] (-2416.429) (-2425.448) * (-2430.058) [-2417.928] (-2417.981) (-2422.349) -- 0:00:03 Average standard deviation of split frequencies: 0.007451 980500 -- (-2416.903) (-2416.456) (-2425.594) [-2415.147] * (-2428.013) (-2416.126) (-2418.317) [-2416.596] -- 0:00:03 981000 -- (-2413.397) (-2418.433) [-2415.188] (-2423.760) * (-2415.405) [-2414.264] (-2426.198) (-2418.800) -- 0:00:03 981500 -- (-2417.131) [-2419.553] (-2421.041) (-2415.492) * [-2418.651] (-2421.467) (-2434.769) (-2410.583) -- 0:00:03 982000 -- (-2417.767) (-2416.438) [-2414.895] (-2418.857) * (-2426.581) (-2417.322) [-2420.146] (-2416.881) -- 0:00:03 982500 -- (-2417.451) (-2413.902) (-2426.011) [-2420.165] * (-2421.386) (-2413.282) [-2417.350] (-2417.827) -- 0:00:02 983000 -- (-2421.924) [-2422.708] (-2426.121) (-2429.526) * [-2420.025] (-2418.320) (-2424.084) (-2419.351) -- 0:00:02 983500 -- (-2422.095) (-2415.756) (-2412.262) [-2414.199] * [-2419.075] (-2420.137) (-2415.452) (-2414.768) -- 0:00:02 984000 -- [-2416.938] (-2417.924) (-2417.876) (-2413.621) * (-2423.310) (-2415.228) (-2416.874) [-2413.159] -- 0:00:02 984500 -- (-2428.915) [-2423.254] (-2419.698) (-2422.789) * (-2418.775) (-2416.536) (-2418.822) [-2416.052] -- 0:00:02 985000 -- (-2419.056) [-2420.082] (-2416.664) (-2418.943) * (-2415.605) [-2413.638] (-2419.484) (-2421.557) -- 0:00:02 Average standard deviation of split frequencies: 0.007530 985500 -- (-2418.397) (-2416.313) [-2417.831] (-2421.356) * [-2414.032] (-2419.153) (-2427.872) (-2422.852) -- 0:00:02 986000 -- (-2415.971) [-2417.515] (-2417.849) (-2427.232) * (-2422.198) (-2421.649) (-2417.164) [-2415.618] -- 0:00:02 986500 -- (-2418.530) (-2415.716) (-2425.696) [-2421.723] * (-2421.930) [-2420.955] (-2416.681) (-2416.678) -- 0:00:02 987000 -- (-2418.904) (-2415.440) (-2418.326) [-2418.314] * [-2412.150] (-2415.098) (-2426.276) (-2418.515) -- 0:00:02 987500 -- (-2421.189) [-2416.251] (-2414.619) (-2417.270) * (-2417.484) (-2425.469) (-2420.719) [-2420.043] -- 0:00:02 988000 -- (-2420.955) [-2420.769] (-2413.673) (-2416.265) * [-2413.411] (-2414.001) (-2421.730) (-2430.562) -- 0:00:02 988500 -- (-2420.124) (-2416.250) [-2413.980] (-2421.346) * [-2427.294] (-2417.827) (-2414.558) (-2419.329) -- 0:00:01 989000 -- (-2412.227) [-2414.660] (-2418.100) (-2421.262) * (-2416.166) [-2417.612] (-2414.038) (-2420.253) -- 0:00:01 989500 -- (-2414.952) [-2416.911] (-2412.945) (-2415.406) * (-2412.412) (-2423.656) (-2429.451) [-2413.788] -- 0:00:01 990000 -- (-2419.957) (-2417.756) [-2412.739] (-2420.933) * (-2415.697) (-2436.250) (-2420.534) [-2418.480] -- 0:00:01 Average standard deviation of split frequencies: 0.007732 990500 -- [-2415.713] (-2412.969) (-2424.254) (-2414.001) * (-2418.241) [-2417.537] (-2420.807) (-2414.805) -- 0:00:01 991000 -- (-2415.170) (-2414.922) (-2420.651) [-2414.821] * [-2418.984] (-2420.608) (-2418.300) (-2417.283) -- 0:00:01 991500 -- (-2418.413) (-2418.013) [-2422.329] (-2422.603) * (-2420.212) (-2421.106) [-2416.811] (-2419.060) -- 0:00:01 992000 -- (-2418.666) [-2416.663] (-2422.830) (-2415.314) * (-2417.169) (-2414.465) (-2436.405) [-2422.179] -- 0:00:01 992500 -- (-2415.054) (-2419.519) (-2429.176) [-2422.165] * (-2425.655) (-2419.651) [-2417.935] (-2420.197) -- 0:00:01 993000 -- (-2414.151) (-2425.384) [-2419.335] (-2422.227) * [-2414.633] (-2417.175) (-2417.957) (-2430.722) -- 0:00:01 993500 -- [-2417.798] (-2422.181) (-2420.326) (-2415.531) * (-2423.422) [-2417.108] (-2420.317) (-2417.737) -- 0:00:01 994000 -- (-2417.902) (-2419.507) [-2417.750] (-2420.133) * (-2419.360) (-2414.277) [-2421.035] (-2418.180) -- 0:00:01 994500 -- (-2420.131) [-2413.224] (-2426.059) (-2415.726) * (-2425.463) (-2417.014) (-2415.734) [-2410.930] -- 0:00:00 995000 -- (-2418.608) (-2414.824) (-2422.354) [-2425.966] * (-2425.439) [-2412.682] (-2424.013) (-2414.788) -- 0:00:00 Average standard deviation of split frequencies: 0.007336 995500 -- [-2414.229] (-2419.109) (-2421.484) (-2422.089) * (-2417.317) [-2417.466] (-2419.214) (-2419.183) -- 0:00:00 996000 -- (-2424.379) [-2420.223] (-2424.071) (-2433.092) * [-2416.403] (-2415.448) (-2419.763) (-2417.426) -- 0:00:00 996500 -- (-2416.958) (-2421.486) (-2419.560) [-2426.697] * (-2415.969) (-2421.258) [-2417.425] (-2418.334) -- 0:00:00 997000 -- (-2417.821) [-2415.590] (-2421.349) (-2427.504) * (-2426.469) (-2420.845) [-2420.345] (-2419.856) -- 0:00:00 997500 -- (-2416.826) (-2421.422) [-2418.393] (-2431.009) * (-2430.756) (-2420.272) [-2429.876] (-2418.922) -- 0:00:00 998000 -- [-2413.742] (-2416.769) (-2419.519) (-2422.035) * [-2421.214] (-2423.025) (-2421.344) (-2422.068) -- 0:00:00 998500 -- (-2428.619) [-2411.703] (-2419.789) (-2421.708) * (-2420.597) (-2416.797) (-2421.594) [-2417.679] -- 0:00:00 999000 -- (-2415.735) (-2418.249) (-2421.936) [-2420.512] * (-2418.745) (-2421.688) [-2419.822] (-2416.437) -- 0:00:00 999500 -- (-2417.743) (-2419.038) [-2421.933] (-2416.003) * (-2419.194) (-2420.394) [-2409.634] (-2418.036) -- 0:00:00 1000000 -- (-2420.396) (-2423.319) (-2420.895) [-2421.581] * (-2413.023) (-2420.629) [-2414.038] (-2418.871) -- 0:00:00 Average standard deviation of split frequencies: 0.007773 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2420.396073 -- 11.882069 Chain 1 -- -2420.396070 -- 11.882069 Chain 2 -- -2423.319321 -- 11.872597 Chain 2 -- -2423.319330 -- 11.872597 Chain 3 -- -2420.894962 -- 14.136706 Chain 3 -- -2420.894962 -- 14.136706 Chain 4 -- -2421.581115 -- 13.521841 Chain 4 -- -2421.581115 -- 13.521841 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2413.023070 -- 8.650267 Chain 1 -- -2413.023051 -- 8.650267 Chain 2 -- -2420.629110 -- 12.696170 Chain 2 -- -2420.629111 -- 12.696170 Chain 3 -- -2414.037712 -- 13.629167 Chain 3 -- -2414.037715 -- 13.629167 Chain 4 -- -2418.870691 -- 12.470796 Chain 4 -- -2418.870695 -- 12.470796 Analysis completed in 2 mins 47 seconds Analysis used 167.26 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2407.72 Likelihood of best state for "cold" chain of run 2 was -2407.72 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 53.0 % ( 40 %) Dirichlet(Revmat{all}) 65.4 % ( 49 %) Slider(Revmat{all}) 24.1 % ( 19 %) Dirichlet(Pi{all}) 26.7 % ( 27 %) Slider(Pi{all}) 64.5 % ( 31 %) Multiplier(Alpha{1,2}) 42.0 % ( 32 %) Multiplier(Alpha{3}) 40.9 % ( 29 %) Slider(Pinvar{all}) 14.2 % ( 18 %) ExtSPR(Tau{all},V{all}) 8.4 % ( 7 %) ExtTBR(Tau{all},V{all}) 14.4 % ( 13 %) NNI(Tau{all},V{all}) 15.7 % ( 16 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 21 %) Multiplier(V{all}) 36.3 % ( 30 %) Nodeslider(V{all}) 25.4 % ( 20 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 51.9 % ( 45 %) Dirichlet(Revmat{all}) 65.4 % ( 50 %) Slider(Revmat{all}) 24.1 % ( 26 %) Dirichlet(Pi{all}) 26.7 % ( 23 %) Slider(Pi{all}) 64.6 % ( 34 %) Multiplier(Alpha{1,2}) 42.0 % ( 19 %) Multiplier(Alpha{3}) 41.3 % ( 25 %) Slider(Pinvar{all}) 14.5 % ( 15 %) ExtSPR(Tau{all},V{all}) 8.4 % ( 12 %) ExtTBR(Tau{all},V{all}) 14.5 % ( 10 %) NNI(Tau{all},V{all}) 15.5 % ( 14 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 27 %) Multiplier(V{all}) 36.2 % ( 42 %) Nodeslider(V{all}) 25.4 % ( 19 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.82 0.66 0.53 2 | 166549 0.83 0.68 3 | 167009 166996 0.85 4 | 166217 166739 166490 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.82 0.66 0.53 2 | 166673 0.84 0.69 3 | 166928 166810 0.85 4 | 166464 166236 166889 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2416.25 | 2 2 2 | | 2 1 1 | | 2 1 2 2 2 1 2 | |11 2 2 1 1 221 2 22 1 1 1 1 2 2 | |2 1 22* 2 22 1 1 1 1 11 2 2 2 21 1 | | * * 1 2 * 2 1* 11* 22 21 1 *| | 1 2 12 2 1 1 2 1 11 2 2 | | 21 1 2 1 2 1 1 2 2 21 1 * | | 1 1 1 1 1 1 2 2112 | | 2 2 2 1 | | | | 1 | | | | | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2420.81 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2413.83 -2426.99 2 -2414.07 -2424.97 -------------------------------------- TOTAL -2413.94 -2426.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.556558 0.006634 0.406277 0.719295 0.548050 1258.52 1293.27 1.000 r(A<->C){all} 0.061721 0.000568 0.019533 0.110070 0.059674 1049.15 1060.80 1.000 r(A<->G){all} 0.304211 0.003060 0.196530 0.407952 0.300783 754.02 768.11 1.001 r(A<->T){all} 0.119967 0.001740 0.044598 0.202388 0.116152 583.49 722.17 1.000 r(C<->G){all} 0.042319 0.000240 0.011324 0.071546 0.041246 972.06 1001.90 1.000 r(C<->T){all} 0.407791 0.003086 0.304153 0.521389 0.406057 803.92 887.04 1.002 r(G<->T){all} 0.063992 0.000557 0.020788 0.109547 0.061420 1023.83 1048.07 1.001 pi(A){all} 0.240638 0.000161 0.214939 0.264442 0.240394 1434.12 1449.86 1.000 pi(C){all} 0.272588 0.000169 0.245651 0.295977 0.272551 1293.71 1316.92 1.000 pi(G){all} 0.279551 0.000174 0.251590 0.303451 0.279558 1208.59 1232.19 1.000 pi(T){all} 0.207223 0.000133 0.184975 0.229367 0.207113 1170.67 1181.94 1.000 alpha{1,2} 0.033798 0.000457 0.000229 0.071049 0.031841 1399.63 1410.21 1.000 alpha{3} 3.286184 0.908698 1.588927 5.169913 3.155399 1501.00 1501.00 1.000 pinvar{all} 0.590164 0.001292 0.512907 0.653991 0.591793 1382.59 1441.79 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**... 8 -- ...**. 9 -- ...*** 10 -- .**..* ------------ Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 2959 0.985676 0.000471 0.985343 0.986009 2 8 2572 0.856762 0.008480 0.850766 0.862758 2 9 2407 0.801799 0.007066 0.796802 0.806795 2 10 376 0.125250 0.015075 0.114590 0.135909 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.039078 0.000112 0.020413 0.060530 0.038211 1.000 2 length{all}[2] 0.037847 0.000097 0.019916 0.056972 0.036899 1.000 2 length{all}[3] 0.007853 0.000020 0.000744 0.016751 0.007152 1.000 2 length{all}[4] 0.034479 0.000105 0.016531 0.055757 0.033567 1.000 2 length{all}[5] 0.044868 0.000146 0.020991 0.067837 0.043547 1.000 2 length{all}[6] 0.343785 0.004759 0.210756 0.472527 0.335458 1.000 2 length{all}[7] 0.014939 0.000045 0.002920 0.028009 0.014241 1.000 2 length{all}[8] 0.019874 0.000128 0.000009 0.040492 0.018666 1.000 2 length{all}[9] 0.017531 0.000114 0.000031 0.037309 0.015892 1.000 2 length{all}[10] 0.007915 0.000038 0.000070 0.019071 0.006470 1.006 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.007773 Maximum standard deviation of split frequencies = 0.015075 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001 Maximum PSRF for parameter values = 1.006 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------ C2 (2) |-----------------------99----------------------+ | \------------------------ C3 (3) + | /------------------------ C4 (4) | /-----------86----------+ | | \------------------------ C5 (5) \-----------80----------+ \------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /-------- C1 (1) | | /------- C2 (2) |--+ | \- C3 (3) + | /------- C4 (4) | /---+ | | \--------- C5 (5) \--+ \--------------------------------------------------------------------- C6 (6) |---------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (8 trees sampled): 90 % credible set contains 4 trees 95 % credible set contains 5 trees 99 % credible set contains 6 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 6 ls = 1104 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 175 patterns at 368 / 368 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 170800 bytes for conP 23800 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 179 341600 bytes for conP, adjusted 0.055285 0.015468 0.052385 0.010586 0.012127 0.024926 0.049361 0.057841 0.298449 0.300000 1.300000 ntime & nrate & np: 9 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 11 lnL0 = -2638.551568 Iterating by ming2 Initial: fx= 2638.551568 x= 0.05529 0.01547 0.05238 0.01059 0.01213 0.02493 0.04936 0.05784 0.29845 0.30000 1.30000 1 h-m-p 0.0000 0.0004 357.3631 ++YCYCCC 2623.601774 5 0.0003 26 | 0/11 2 h-m-p 0.0001 0.0006 977.4555 +YYCCC 2593.138548 4 0.0003 47 | 0/11 3 h-m-p 0.0001 0.0006 1359.8575 +CCCCC 2535.934785 4 0.0005 70 | 0/11 4 h-m-p 0.0000 0.0001 1047.6489 +YYYYYC 2523.238432 5 0.0001 90 | 0/11 5 h-m-p 0.0000 0.0000 639.6990 +CYCC 2520.501029 3 0.0000 110 | 0/11 6 h-m-p 0.0000 0.0001 3416.3489 ++ 2489.695183 m 0.0001 124 | 0/11 7 h-m-p 0.0001 0.0005 1038.9305 ++ 2389.175274 m 0.0005 138 | 0/11 8 h-m-p 0.0000 0.0000 6408.7507 h-m-p: 3.98152137e-22 1.99076069e-21 6.40875071e+03 2389.175274 .. | 0/11 9 h-m-p 0.0000 0.0003 17161.3104 YCYYYYC 2370.387916 6 0.0000 170 | 0/11 10 h-m-p 0.0000 0.0003 694.2150 ++ 2269.103955 m 0.0003 184 | 0/11 11 h-m-p 0.0000 0.0001 774.7664 +CCYC 2254.280921 3 0.0001 204 | 0/11 12 h-m-p 0.0000 0.0001 925.7490 YCYCCC 2242.222800 5 0.0001 226 | 0/11 13 h-m-p 0.0001 0.0003 444.6391 YCYCCC 2234.248715 5 0.0001 248 | 0/11 14 h-m-p 0.0001 0.0003 255.3740 CCCCC 2232.455475 4 0.0001 270 | 0/11 15 h-m-p 0.0003 0.0020 78.3950 CYC 2231.570507 2 0.0003 287 | 0/11 16 h-m-p 0.0001 0.0005 218.3678 YCCCC 2229.517896 4 0.0002 308 | 0/11 17 h-m-p 0.0002 0.0008 95.4227 CC 2228.991124 1 0.0002 324 | 0/11 18 h-m-p 0.0005 0.0027 17.5694 YCC 2228.897996 2 0.0003 341 | 0/11 19 h-m-p 0.0002 0.0103 24.8828 ++CCC 2227.299818 2 0.0026 361 | 0/11 20 h-m-p 0.0300 5.8622 2.1720 +CCC 2226.994987 2 0.1122 380 | 0/11 21 h-m-p 1.6000 8.0000 0.0201 CCCC 2225.481592 3 2.5642 400 | 0/11 22 h-m-p 1.6000 8.0000 0.0102 YCCC 2223.256512 3 3.3706 430 | 0/11 23 h-m-p 1.3536 6.7678 0.0222 YCYCCC 2220.714473 5 3.5055 463 | 0/11 24 h-m-p 1.6000 8.0000 0.0167 YCCC 2219.229407 3 2.9459 493 | 0/11 25 h-m-p 1.6000 8.0000 0.0161 CCC 2218.707349 2 1.9745 522 | 0/11 26 h-m-p 1.6000 8.0000 0.0086 YCCC 2218.516687 3 2.4666 552 | 0/11 27 h-m-p 1.6000 8.0000 0.0033 YCC 2218.483776 2 1.3186 580 | 0/11 28 h-m-p 1.6000 8.0000 0.0006 C 2218.481153 0 1.6065 605 | 0/11 29 h-m-p 1.6000 8.0000 0.0002 ++ 2218.469207 m 8.0000 630 | 0/11 30 h-m-p 1.0852 8.0000 0.0014 CCC 2218.449806 2 1.2763 659 | 0/11 31 h-m-p 0.8165 8.0000 0.0022 YC 2218.446032 1 1.7370 685 | 0/11 32 h-m-p 1.6000 8.0000 0.0002 C 2218.445960 0 1.3088 710 | 0/11 33 h-m-p 1.6000 8.0000 0.0001 Y 2218.445959 0 1.0692 735 | 0/11 34 h-m-p 1.6000 8.0000 0.0000 Y 2218.445959 0 1.2788 760 | 0/11 35 h-m-p 1.6000 8.0000 0.0000 Y 2218.445959 0 2.6597 785 | 0/11 36 h-m-p 1.6000 8.0000 0.0000 -C 2218.445959 0 0.1385 811 | 0/11 37 h-m-p 0.1580 8.0000 0.0000 ------------Y 2218.445959 0 0.0000 848 Out.. lnL = -2218.445959 849 lfun, 849 eigenQcodon, 7641 P(t) Time used: 0:02 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 179 0.055285 0.015468 0.052385 0.010586 0.012127 0.024926 0.049361 0.057841 0.298449 1.949691 0.747245 0.296991 ntime & nrate & np: 9 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 7.556171 np = 12 lnL0 = -2380.562079 Iterating by ming2 Initial: fx= 2380.562079 x= 0.05529 0.01547 0.05238 0.01059 0.01213 0.02493 0.04936 0.05784 0.29845 1.94969 0.74724 0.29699 1 h-m-p 0.0000 0.0008 347.8371 ++++ 2338.224668 m 0.0008 19 | 0/12 2 h-m-p 0.0000 0.0000 5212.2786 ++ 2282.790630 m 0.0000 34 | 0/12 3 h-m-p 0.0000 0.0001 135.2798 ++ 2281.164283 m 0.0001 49 | 0/12 4 h-m-p 0.0000 0.0000 571.1708 h-m-p: 2.58708425e-22 1.29354213e-21 5.71170828e+02 2281.164283 .. | 0/12 5 h-m-p 0.0000 0.0003 361.6390 +++ 2260.778989 m 0.0003 77 | 0/12 6 h-m-p 0.0000 0.0002 710.9426 YCYCCC 2252.226920 5 0.0001 100 | 0/12 7 h-m-p 0.0000 0.0000 2488.6265 ++ 2240.490555 m 0.0000 115 | 1/12 8 h-m-p 0.0000 0.0001 478.8749 +YYCCCC 2229.309072 5 0.0001 139 | 1/12 9 h-m-p 0.0000 0.0001 287.8457 YCYCCC 2225.930592 5 0.0001 162 | 0/12 10 h-m-p 0.0000 0.0000 3211.2525 +YCCCC 2224.240667 4 0.0000 185 | 0/12 11 h-m-p 0.0000 0.0000 145.3877 CYCCC 2224.075119 4 0.0000 207 | 0/12 12 h-m-p 0.0001 0.0017 27.5885 YC 2224.000688 1 0.0002 223 | 0/12 13 h-m-p 0.0001 0.0067 59.9488 +YCC 2223.827522 2 0.0003 242 | 0/12 14 h-m-p 0.0003 0.0016 58.0241 YCC 2223.723424 2 0.0002 260 | 0/12 15 h-m-p 0.0003 0.0015 23.0049 C 2223.711630 0 0.0001 275 | 0/12 16 h-m-p 0.0011 0.0490 1.6258 CC 2223.697160 1 0.0013 292 | 0/12 17 h-m-p 0.0002 0.0871 9.8630 +++YC 2219.633326 1 0.0332 311 | 0/12 18 h-m-p 0.1549 1.0818 2.1161 CCCCC 2218.626159 4 0.2107 334 | 0/12 19 h-m-p 1.6000 8.0000 0.1511 YCCCC 2216.974081 4 1.0352 356 | 0/12 20 h-m-p 1.5841 7.9203 0.0310 CCC 2216.508290 2 1.5508 387 | 0/12 21 h-m-p 1.6000 8.0000 0.0085 CYC 2216.490609 2 1.4563 417 | 0/12 22 h-m-p 1.6000 8.0000 0.0047 YC 2216.486780 1 2.7795 445 | 0/12 23 h-m-p 1.6000 8.0000 0.0032 YC 2216.480607 1 2.9051 473 | 0/12 24 h-m-p 1.6000 8.0000 0.0012 C 2216.479524 0 1.4869 500 | 0/12 25 h-m-p 1.6000 8.0000 0.0003 C 2216.479328 0 1.7827 527 | 0/12 26 h-m-p 1.6000 8.0000 0.0001 C 2216.479302 0 1.6351 554 | 0/12 27 h-m-p 1.6000 8.0000 0.0000 C 2216.479301 0 1.3085 581 | 0/12 28 h-m-p 1.6000 8.0000 0.0000 C 2216.479301 0 1.4370 608 | 0/12 29 h-m-p 1.6000 8.0000 0.0000 Y 2216.479301 0 1.1850 635 | 0/12 30 h-m-p 1.6000 8.0000 0.0000 C 2216.479301 0 1.9207 662 | 0/12 31 h-m-p 1.6000 8.0000 0.0000 C 2216.479301 0 0.5777 689 | 0/12 32 h-m-p 1.0132 8.0000 0.0000 -C 2216.479301 0 0.0888 717 Out.. lnL = -2216.479301 718 lfun, 2154 eigenQcodon, 12924 P(t) Time used: 0:07 Model 2: PositiveSelection TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 179 initial w for M2:NSpselection reset. 0.055285 0.015468 0.052385 0.010586 0.012127 0.024926 0.049361 0.057841 0.298449 1.956722 0.896732 0.199894 0.157918 2.073080 ntime & nrate & np: 9 3 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.283605 np = 14 lnL0 = -2423.378145 Iterating by ming2 Initial: fx= 2423.378145 x= 0.05529 0.01547 0.05238 0.01059 0.01213 0.02493 0.04936 0.05784 0.29845 1.95672 0.89673 0.19989 0.15792 2.07308 1 h-m-p 0.0000 0.0011 381.1439 ++YCCCCC 2416.392904 5 0.0002 30 | 0/14 2 h-m-p 0.0001 0.0006 293.5158 ++ 2380.517204 m 0.0006 47 | 1/14 3 h-m-p 0.0001 0.0013 1050.2742 +CCCCC 2359.454702 4 0.0005 73 | 1/14 4 h-m-p 0.0002 0.0008 332.6273 +CYCCC 2347.354748 4 0.0007 98 | 1/14 5 h-m-p 0.0001 0.0004 186.3362 ++ 2344.173213 m 0.0004 115 | 1/14 6 h-m-p -0.0000 -0.0000 121.6558 h-m-p: -1.70105684e-19 -8.50528422e-19 1.21655821e+02 2344.173213 .. | 1/14 7 h-m-p 0.0000 0.0021 263.4806 +++CYCCC 2335.965203 4 0.0005 156 | 1/14 8 h-m-p 0.0002 0.0011 238.2192 +YCCCCC 2313.044184 5 0.0009 183 | 1/14 9 h-m-p 0.0001 0.0004 821.5484 YCCCCC 2303.382699 5 0.0002 209 | 1/14 10 h-m-p 0.0002 0.0009 259.3078 CCCCC 2299.658691 4 0.0003 234 | 1/14 11 h-m-p 0.0003 0.0014 170.1366 +YCCCC 2293.335195 4 0.0008 259 | 1/14 12 h-m-p 0.0004 0.0029 357.9242 ++ 2261.555594 m 0.0029 276 | 2/14 13 h-m-p 0.0002 0.0011 593.7642 YCCCCC 2252.854760 5 0.0005 302 | 2/14 14 h-m-p 0.0001 0.0006 540.3172 CCCC 2250.124672 3 0.0002 325 | 2/14 15 h-m-p 0.0010 0.0048 56.5626 YYC 2249.303532 2 0.0008 344 | 1/14 16 h-m-p 0.0001 0.0005 520.4933 -YCCCC 2249.126281 4 0.0000 369 | 1/14 17 h-m-p 0.0000 0.0115 64.4408 +++YCCCCC 2245.751459 5 0.0032 398 | 0/14 18 h-m-p 0.0002 0.0012 489.6467 CYC 2244.908893 2 0.0001 418 | 0/14 19 h-m-p 0.0016 0.2930 24.1833 ++CYCCC 2238.933188 4 0.0315 444 | 0/14 20 h-m-p 0.1079 0.5397 2.9558 +CCYCC 2228.221137 4 0.4460 469 | 0/14 21 h-m-p 0.1510 0.7550 3.5225 YCCCCC 2224.800078 5 0.3192 495 | 0/14 22 h-m-p 0.0623 0.3115 5.5474 YCCCC 2222.315458 4 0.1554 519 | 0/14 23 h-m-p 0.1792 0.8958 0.6715 YCCCC 2221.182791 4 0.3982 543 | 0/14 24 h-m-p 0.4445 2.6637 0.6015 CCC 2219.915797 2 0.5084 578 | 0/14 25 h-m-p 0.5507 8.0000 0.5552 YCCC 2218.614613 3 1.2568 614 | 0/14 26 h-m-p 1.2518 6.6115 0.5574 YCCC 2217.929418 3 0.8132 650 | 0/14 27 h-m-p 0.6557 7.0426 0.6913 CCCC 2217.542066 3 0.9939 687 | 0/14 28 h-m-p 0.9131 8.0000 0.7525 YCCC 2217.051330 3 1.6940 723 | 0/14 29 h-m-p 1.6000 8.0000 0.5981 CYC 2216.771456 2 1.6499 757 | 0/14 30 h-m-p 1.4125 8.0000 0.6986 CCC 2216.646017 2 1.5301 792 | 0/14 31 h-m-p 1.2927 8.0000 0.8269 CCC 2216.573510 2 1.1108 827 | 0/14 32 h-m-p 1.5432 8.0000 0.5952 CCC 2216.535280 2 1.3413 862 | 0/14 33 h-m-p 1.2160 8.0000 0.6565 CC 2216.510083 1 1.8229 895 | 0/14 34 h-m-p 1.6000 8.0000 0.5571 YCC 2216.493302 2 2.4394 929 | 0/14 35 h-m-p 1.6000 8.0000 0.4827 YC 2216.486078 1 2.8379 961 | 0/14 36 h-m-p 1.6000 8.0000 0.5812 CC 2216.481891 1 2.3379 994 | 0/14 37 h-m-p 1.6000 8.0000 0.5559 C 2216.480747 0 1.8505 1025 | 0/14 38 h-m-p 1.6000 8.0000 0.5258 YC 2216.480028 1 2.4790 1057 | 0/14 39 h-m-p 1.6000 8.0000 0.6455 CC 2216.479563 1 2.4110 1090 | 0/14 40 h-m-p 1.6000 8.0000 0.5965 C 2216.479420 0 2.5524 1121 | 0/14 41 h-m-p 1.6000 8.0000 0.5493 C 2216.479349 0 2.5582 1152 | 0/14 42 h-m-p 1.6000 8.0000 0.6049 Y 2216.479320 0 2.6799 1183 | 0/14 43 h-m-p 1.6000 8.0000 0.5760 C 2216.479309 0 2.4399 1214 | 0/14 44 h-m-p 1.6000 8.0000 0.5951 Y 2216.479304 0 2.7614 1245 | 0/14 45 h-m-p 1.6000 8.0000 0.5940 C 2216.479302 0 2.4000 1276 | 0/14 46 h-m-p 1.6000 8.0000 0.5910 Y 2216.479301 0 2.7095 1307 | 0/14 47 h-m-p 1.6000 8.0000 0.6289 C 2216.479301 0 2.5567 1338 | 0/14 48 h-m-p 1.6000 8.0000 0.6239 C 2216.479301 0 2.5176 1369 | 0/14 49 h-m-p 1.6000 8.0000 0.7489 Y 2216.479301 0 3.1336 1400 | 0/14 50 h-m-p 1.6000 8.0000 1.0226 C 2216.479301 0 2.2411 1431 | 0/14 51 h-m-p 1.0015 8.0000 2.2884 ------------C 2216.479301 0 0.0000 1460 | 0/14 52 h-m-p 0.0160 8.0000 0.0012 ++C 2216.479301 0 0.3616 1479 | 0/14 53 h-m-p 1.6000 8.0000 0.0001 --Y 2216.479301 0 0.0250 1512 | 0/14 54 h-m-p 0.0160 8.0000 0.0004 ----C 2216.479301 0 0.0000 1547 Out.. lnL = -2216.479301 1548 lfun, 6192 eigenQcodon, 41796 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2268.373461 S = -2230.874468 -29.233429 Calculating f(w|X), posterior probabilities of site classes. did 10 / 175 patterns 0:21 did 20 / 175 patterns 0:21 did 30 / 175 patterns 0:21 did 40 / 175 patterns 0:21 did 50 / 175 patterns 0:21 did 60 / 175 patterns 0:21 did 70 / 175 patterns 0:21 did 80 / 175 patterns 0:21 did 90 / 175 patterns 0:21 did 100 / 175 patterns 0:21 did 110 / 175 patterns 0:21 did 120 / 175 patterns 0:21 did 130 / 175 patterns 0:21 did 140 / 175 patterns 0:21 did 150 / 175 patterns 0:21 did 160 / 175 patterns 0:21 did 170 / 175 patterns 0:21 did 175 / 175 patterns 0:21 Time used: 0:21 Model 3: discrete TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 179 0.055285 0.015468 0.052385 0.010586 0.012127 0.024926 0.049361 0.057841 0.298449 1.956711 0.215184 0.509770 0.003764 0.009428 0.013663 ntime & nrate & np: 9 4 15 Bounds (np=15): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 20.721891 np = 15 lnL0 = -2219.179407 Iterating by ming2 Initial: fx= 2219.179407 x= 0.05529 0.01547 0.05238 0.01059 0.01213 0.02493 0.04936 0.05784 0.29845 1.95671 0.21518 0.50977 0.00376 0.00943 0.01366 1 h-m-p 0.0000 0.0000 182.7936 ++ 2218.256221 m 0.0000 20 | 1/15 2 h-m-p 0.0001 0.0005 95.1800 CCC 2217.988303 2 0.0001 42 | 1/15 3 h-m-p 0.0000 0.0002 93.4659 ++ 2217.375548 m 0.0002 60 | 2/15 4 h-m-p 0.0003 0.0017 45.8379 YC 2217.361356 1 0.0000 79 | 2/15 5 h-m-p 0.0003 0.0091 5.6176 C 2217.360141 0 0.0001 97 | 2/15 6 h-m-p 0.0001 0.0149 3.2529 YC 2217.359678 1 0.0001 116 | 2/15 7 h-m-p 0.0001 0.0717 3.1378 +C 2217.358215 0 0.0005 135 | 2/15 8 h-m-p 0.0003 0.0413 4.7650 YC 2217.357206 1 0.0003 154 | 2/15 9 h-m-p 0.0022 0.2913 0.5882 YC 2217.356695 1 0.0015 173 | 2/15 10 h-m-p 0.0006 0.3187 4.9796 ++YC 2217.299933 1 0.0186 207 | 2/15 11 h-m-p 0.0002 0.0066 436.3169 +CCC 2217.039557 2 0.0010 230 | 2/15 12 h-m-p 0.0012 0.0062 201.5461 YC 2217.016367 1 0.0002 249 | 2/15 13 h-m-p 0.0564 8.0000 0.6811 ++YC 2216.897260 1 0.6688 270 | 2/15 14 h-m-p 0.1852 6.2460 2.4597 CCCC 2216.714692 3 0.2821 307 | 1/15 15 h-m-p 0.0009 0.0186 788.4415 -C 2216.713861 0 0.0001 326 | 1/15 16 h-m-p 0.0310 0.1549 0.3431 ++ 2216.681761 m 0.1549 344 | 1/15 17 h-m-p 0.0000 0.0015 2074.8223 CC 2216.667939 1 0.0000 378 | 1/15 18 h-m-p 0.0218 0.1088 0.6676 ++ 2216.618468 m 0.1088 396 | 2/15 19 h-m-p 0.0034 0.3291 21.4838 +YC 2216.584046 1 0.0089 430 | 2/15 20 h-m-p 0.3435 8.0000 0.5562 +CCCCC 2216.346347 4 1.6085 457 | 2/15 21 h-m-p 1.6000 8.0000 0.0848 YCCC 2216.158786 3 3.5922 493 | 2/15 22 h-m-p 1.3436 8.0000 0.2267 CCC 2216.089577 2 1.4470 528 | 1/15 23 h-m-p 0.0035 0.0851 94.7882 --Y 2216.089566 0 0.0000 561 | 1/15 24 h-m-p 0.0027 0.0137 0.3331 ++ 2216.087721 m 0.0137 579 | 2/15 25 h-m-p 0.0160 8.0000 1.2090 +YC 2216.054418 1 0.1409 613 | 2/15 26 h-m-p 0.5354 8.0000 0.3181 +YCCC 2215.965527 3 1.4333 637 | 2/15 27 h-m-p 1.6000 8.0000 0.0341 C 2215.943046 0 1.7432 668 | 2/15 28 h-m-p 0.8479 8.0000 0.0700 CC 2215.940786 1 1.0776 701 | 2/15 29 h-m-p 1.6000 8.0000 0.0094 YC 2215.939428 1 2.9439 733 | 2/15 30 h-m-p 1.6000 8.0000 0.0035 Y 2215.939342 0 1.1861 764 | 2/15 31 h-m-p 1.6000 8.0000 0.0005 Y 2215.939341 0 1.1161 795 | 2/15 32 h-m-p 1.6000 8.0000 0.0001 Y 2215.939341 0 1.2566 826 | 2/15 33 h-m-p 1.6000 8.0000 0.0000 Y 2215.939341 0 0.9725 857 | 2/15 34 h-m-p 1.6000 8.0000 0.0000 -Y 2215.939341 0 0.0625 889 Out.. lnL = -2215.939341 890 lfun, 3560 eigenQcodon, 24030 P(t) Time used: 0:29 Model 7: beta TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 179 0.055285 0.015468 0.052385 0.010586 0.012127 0.024926 0.049361 0.057841 0.298449 1.951490 0.603915 1.022819 ntime & nrate & np: 9 1 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 8.804599 np = 12 lnL0 = -2350.149174 Iterating by ming2 Initial: fx= 2350.149174 x= 0.05529 0.01547 0.05238 0.01059 0.01213 0.02493 0.04936 0.05784 0.29845 1.95149 0.60392 1.02282 1 h-m-p 0.0000 0.0017 273.9006 ++YCCCC 2347.285118 4 0.0001 26 | 0/12 2 h-m-p 0.0001 0.0006 210.3653 +YYYYYC 2338.003717 5 0.0004 47 | 0/12 3 h-m-p 0.0000 0.0000 2776.8874 ++ 2328.671118 m 0.0000 62 | 0/12 4 h-m-p -0.0000 -0.0000 18070.2197 h-m-p: -2.90812448e-22 -1.45406224e-21 1.80702197e+04 2328.671118 .. | 0/12 5 h-m-p 0.0000 0.0007 1037.2127 +YCYCCC 2323.129470 5 0.0000 98 | 0/12 6 h-m-p 0.0001 0.0004 234.4689 +YYYCCC 2313.419977 5 0.0003 121 | 0/12 7 h-m-p 0.0001 0.0003 678.5748 +YYCYCCC 2294.395674 6 0.0002 146 | 0/12 8 h-m-p 0.0000 0.0001 2525.5611 +YYCYYYYYCC 2250.866301 10 0.0001 174 | 0/12 9 h-m-p 0.0000 0.0000 7062.2145 YCCCCC 2250.162500 5 0.0000 198 | 0/12 10 h-m-p 0.0001 0.0078 56.9368 ++YCYCCC 2243.627311 5 0.0044 223 | 0/12 11 h-m-p 0.0001 0.0003 2571.5185 YYCCC 2238.762290 4 0.0001 244 | 0/12 12 h-m-p 0.0000 0.0002 508.6921 YCYCCC 2237.307993 5 0.0001 267 | 0/12 13 h-m-p 0.0004 0.0020 111.4541 YCCC 2236.839445 3 0.0002 287 | 0/12 14 h-m-p 0.0001 0.0021 264.9255 +CCC 2234.987934 2 0.0004 307 | 0/12 15 h-m-p 0.0003 0.0020 309.2425 CYCCCC 2232.085092 5 0.0005 331 | 0/12 16 h-m-p 0.1552 0.7759 0.8634 YCCCC 2222.993153 4 0.3411 353 | 0/12 17 h-m-p 0.4108 3.1632 0.7168 CCCCC 2221.409775 4 0.6138 388 | 0/12 18 h-m-p 0.2535 1.6793 1.7353 CYCC 2219.493751 3 0.2650 420 | 0/12 19 h-m-p 0.9283 4.6413 0.3498 YCC 2217.097925 2 1.4752 438 | 0/12 20 h-m-p 1.3082 6.5410 0.1703 YYC 2216.631494 2 1.0651 467 | 0/12 21 h-m-p 1.6000 8.0000 0.0801 YCC 2216.521847 2 1.0906 497 | 0/12 22 h-m-p 1.6000 8.0000 0.0314 CY 2216.486995 1 1.5220 526 | 0/12 23 h-m-p 1.6000 8.0000 0.0045 C 2216.479518 0 1.6476 553 | 0/12 24 h-m-p 0.7674 8.0000 0.0097 +YC 2216.475865 1 2.2157 582 | 0/12 25 h-m-p 1.6000 8.0000 0.0005 CC 2216.474944 1 2.2410 611 | 0/12 26 h-m-p 0.9060 8.0000 0.0012 +YC 2216.474637 1 2.3009 640 | 0/12 27 h-m-p 1.1408 8.0000 0.0024 +YC 2216.474354 1 3.1496 669 | 0/12 28 h-m-p 1.6000 8.0000 0.0028 ++ 2216.473593 m 8.0000 696 | 0/12 29 h-m-p 0.4654 8.0000 0.0484 +YC 2216.469341 1 4.5070 725 | 0/12 30 h-m-p 1.6000 8.0000 0.1237 ++ 2216.430241 m 8.0000 752 | 0/12 31 h-m-p 0.2017 1.0087 2.1215 YYYYCCYCC 2216.412153 8 0.3149 790 | 0/12 32 h-m-p 0.2595 1.2977 1.1343 YYYYYCCYC 2216.396385 8 0.3973 815 | 0/12 33 h-m-p 0.3771 1.8855 0.4940 YC 2216.384473 1 0.1938 831 | 0/12 34 h-m-p 0.2610 2.5232 0.3669 CYYC 2216.376212 3 0.5627 863 | 0/12 35 h-m-p 1.6000 8.0000 0.0402 YC 2216.370451 1 1.1007 891 | 0/12 36 h-m-p 0.2866 4.3773 0.1542 Y 2216.370102 0 0.2866 918 | 0/12 37 h-m-p 1.6000 8.0000 0.0015 C 2216.369717 0 1.7634 945 | 0/12 38 h-m-p 0.0866 8.0000 0.0308 ++YY 2216.369404 1 1.3851 975 | 0/12 39 h-m-p 1.6000 8.0000 0.0162 C 2216.369251 0 1.6205 1002 | 0/12 40 h-m-p 1.6000 8.0000 0.0037 C 2216.369181 0 1.6690 1029 | 0/12 41 h-m-p 0.1761 8.0000 0.0347 +C 2216.369056 0 0.7043 1057 | 0/12 42 h-m-p 0.3789 8.0000 0.0645 Y 2216.368971 0 0.3789 1084 | 0/12 43 h-m-p 1.6000 8.0000 0.0103 C 2216.368842 0 2.0519 1111 | 0/12 44 h-m-p 1.6000 8.0000 0.0048 Y 2216.368775 0 2.7360 1138 | 0/12 45 h-m-p 0.9901 8.0000 0.0133 C 2216.368741 0 0.9901 1165 | 0/12 46 h-m-p 0.8911 8.0000 0.0148 C 2216.368700 0 0.8882 1192 | 0/12 47 h-m-p 1.1108 8.0000 0.0118 Y 2216.368661 0 1.1108 1219 | 0/12 48 h-m-p 1.6000 8.0000 0.0043 C 2216.368657 0 0.4411 1246 | 0/12 49 h-m-p 0.3804 8.0000 0.0050 +++ 2216.368590 m 8.0000 1274 | 0/12 50 h-m-p 1.6000 8.0000 0.0222 -Y 2216.368587 0 0.1676 1302 | 0/12 51 h-m-p 0.7962 8.0000 0.0047 Y 2216.368586 0 0.4139 1329 | 0/12 52 h-m-p 0.4551 8.0000 0.0043 ----------Y 2216.368586 0 0.0000 1366 | 0/12 53 h-m-p 0.0160 8.0000 0.0002 ++C 2216.368583 0 0.4034 1395 | 0/12 54 h-m-p 1.6000 8.0000 0.0000 C 2216.368583 0 1.6549 1422 | 0/12 55 h-m-p 1.6000 8.0000 0.0000 Y 2216.368583 0 1.0925 1449 | 0/12 56 h-m-p 0.7765 8.0000 0.0000 ++ 2216.368583 m 8.0000 1476 | 0/12 57 h-m-p 0.8541 8.0000 0.0001 -------N 2216.368583 0 0.0000 1510 Out.. lnL = -2216.368583 1511 lfun, 16621 eigenQcodon, 135990 P(t) Time used: 1:19 Model 8: beta&w>1 TREE # 1 (1, (2, 3), ((4, 5), 6)); MP score: 179 initial w for M8:NSbetaw>1 reset. 0.055285 0.015468 0.052385 0.010586 0.012127 0.024926 0.049361 0.057841 0.298449 1.950488 0.900000 0.523761 1.873198 2.941449 ntime & nrate & np: 9 2 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 7.416016 np = 14 lnL0 = -2347.862778 Iterating by ming2 Initial: fx= 2347.862778 x= 0.05529 0.01547 0.05238 0.01059 0.01213 0.02493 0.04936 0.05784 0.29845 1.95049 0.90000 0.52376 1.87320 2.94145 1 h-m-p 0.0000 0.0002 664.4549 ++CCCC 2311.981356 3 0.0002 27 | 0/14 2 h-m-p 0.0000 0.0000 395.4967 ++ 2306.443585 m 0.0000 44 | 1/14 3 h-m-p 0.0000 0.0000 2563.4352 +YYYYYC 2297.663510 5 0.0000 67 | 1/14 4 h-m-p 0.0000 0.0002 440.9446 +YCYCCC 2292.485304 5 0.0001 93 | 1/14 5 h-m-p 0.0000 0.0001 554.5674 +YCYCCC 2288.323480 5 0.0001 119 | 1/14 6 h-m-p 0.0000 0.0001 1014.4966 ++ 2281.745689 m 0.0001 136 | 1/14 7 h-m-p 0.0000 0.0000 3960.1105 h-m-p: 2.53357311e-21 1.26678655e-20 3.96011055e+03 2281.745689 .. | 1/14 8 h-m-p 0.0000 0.0010 1377.6667 YCYCCC 2274.700212 5 0.0000 175 | 1/14 9 h-m-p 0.0001 0.0005 250.6938 +YYCCC 2265.864581 4 0.0003 199 | 1/14 10 h-m-p 0.0001 0.0003 491.5568 +YYCCC 2252.261606 4 0.0002 223 | 1/14 11 h-m-p 0.0000 0.0001 1696.9107 +YYYYCCC 2236.306131 6 0.0001 249 | 1/14 12 h-m-p 0.0000 0.0000 1717.2295 CYCCCC 2235.057733 5 0.0000 275 | 1/14 13 h-m-p 0.0003 0.0022 41.2650 YC 2234.934404 1 0.0002 293 | 1/14 14 h-m-p 0.0000 0.0028 125.6463 +YCCC 2234.155427 3 0.0003 316 | 1/14 15 h-m-p 0.0002 0.0012 88.5586 YCCC 2233.985131 3 0.0001 338 | 1/14 16 h-m-p 0.0004 0.0037 31.9021 YCCC 2233.784779 3 0.0006 360 | 1/14 17 h-m-p 0.0002 0.0053 107.9977 +YCCCC 2232.022204 4 0.0016 385 | 1/14 18 h-m-p 0.0001 0.0007 1488.3888 +YYYYC 2225.269602 4 0.0005 407 | 1/14 19 h-m-p 0.1814 0.9072 1.3576 YCCCC 2220.102872 4 0.4224 431 | 1/14 20 h-m-p 0.2857 5.9375 2.0070 CYCCC 2219.087752 4 0.2069 455 | 1/14 21 h-m-p 0.6821 3.9798 0.6088 YCCC 2218.097523 3 0.5118 477 | 1/14 22 h-m-p 0.8392 4.1962 0.3076 CCCC 2216.838943 3 1.3161 513 | 1/14 23 h-m-p 1.3776 6.8882 0.0872 CC 2216.582883 1 1.3653 545 | 1/14 24 h-m-p 1.6000 8.0000 0.0470 CC 2216.533909 1 1.7449 577 | 1/14 25 h-m-p 1.6000 8.0000 0.0112 YC 2216.511791 1 2.8236 608 | 1/14 26 h-m-p 1.6000 8.0000 0.0042 CC 2216.508996 1 1.3703 640 | 1/14 27 h-m-p 0.8107 8.0000 0.0071 +YC 2216.508253 1 2.4739 672 | 1/14 28 h-m-p 1.2948 8.0000 0.0136 ++ 2216.505156 m 8.0000 702 | 1/14 29 h-m-p 1.1645 8.0000 0.0935 ++ 2216.490252 m 8.0000 732 | 1/14 30 h-m-p 1.5750 7.8749 0.4087 YYCYCYC 2216.423450 6 3.2036 771 | 1/14 31 h-m-p 0.2503 1.2516 1.5262 YYYC 2216.416156 3 0.2068 804 | 1/14 32 h-m-p 0.5026 2.5490 0.6280 YYCYC 2216.382999 4 0.7960 826 | 1/14 33 h-m-p 1.0155 5.0777 0.2163 YYYYY 2216.376418 4 1.0155 860 | 1/14 34 h-m-p 1.2642 6.3209 0.0673 -CC 2216.374406 1 0.1159 893 | 1/14 35 h-m-p 0.0638 7.1394 0.1222 ++YYYY 2216.372861 3 1.0205 928 | 1/14 36 h-m-p 1.0409 6.2557 0.1198 YC 2216.372304 1 0.5238 959 | 1/14 37 h-m-p 0.9052 8.0000 0.0693 C 2216.371427 0 1.1626 989 | 1/14 38 h-m-p 0.7063 5.3497 0.1141 CYC 2216.371184 2 0.3065 1022 | 1/14 39 h-m-p 1.6000 8.0000 0.0199 Y 2216.370908 0 1.1303 1052 | 1/14 40 h-m-p 1.6000 8.0000 0.0041 Y 2216.370841 0 1.0635 1082 | 1/14 41 h-m-p 0.0976 8.0000 0.0446 +YC 2216.370692 1 0.8556 1114 | 1/14 42 h-m-p 1.5402 8.0000 0.0248 Y 2216.370590 0 1.5402 1144 | 1/14 43 h-m-p 1.6000 8.0000 0.0083 C 2216.370515 0 0.5585 1174 | 1/14 44 h-m-p 0.2752 8.0000 0.0167 +YC 2216.370397 1 2.2094 1206 | 1/14 45 h-m-p 1.6000 8.0000 0.0141 +Y 2216.370250 0 4.2827 1237 | 1/14 46 h-m-p 1.6000 8.0000 0.0067 C 2216.370239 0 0.3348 1267 | 1/14 47 h-m-p 0.0368 8.0000 0.0612 ++Y 2216.370167 0 0.5888 1299 | 1/14 48 h-m-p 1.6000 8.0000 0.0098 C 2216.370159 0 0.5467 1329 | 1/14 49 h-m-p 0.3596 8.0000 0.0149 +Y 2216.370104 0 2.5327 1360 | 1/14 50 h-m-p 1.6000 8.0000 0.0084 C 2216.370051 0 2.4308 1390 | 1/14 51 h-m-p 0.6213 8.0000 0.0330 C 2216.370003 0 0.7859 1420 | 1/14 52 h-m-p 0.7268 8.0000 0.0357 +Y 2216.369889 0 2.9073 1451 | 1/14 53 h-m-p 1.6000 8.0000 0.0307 C 2216.369872 0 0.3369 1481 | 1/14 54 h-m-p 0.4733 8.0000 0.0219 C 2216.369782 0 0.6684 1511 | 1/14 55 h-m-p 0.2547 8.0000 0.0574 +YC 2216.369562 1 2.1790 1543 | 1/14 56 h-m-p 1.2080 7.5160 0.1036 CYC 2216.369258 2 1.9510 1576 | 1/14 57 h-m-p 0.5013 2.5067 0.2284 YC 2216.369135 1 0.2616 1607 | 1/14 58 h-m-p 0.3825 3.2962 0.1563 +Y 2216.368826 0 1.5299 1638 | 1/14 59 h-m-p 1.6000 8.0000 0.1035 C 2216.368745 0 0.4000 1668 | 1/14 60 h-m-p 0.4886 3.7311 0.0848 ++ 2216.368267 m 3.7311 1698 | 1/14 61 h-m-p 0.0000 0.0000 1205.4916 h-m-p: 0.00000000e+00 0.00000000e+00 1.20549157e+03 2216.368267 .. | 1/14 62 h-m-p 0.0000 0.0248 44.4677 --YC 2216.366911 1 0.0000 1745 | 1/14 63 h-m-p 0.0000 0.0002 119.3506 YC QuantileBeta(0.05, 0.00776, 0.24329) = 1.564417e-161 2000 rounds CC 2216.315514 3 0.0000 1767 | 1/14 64 h-m-p 0.0015 0.0103 1.5832 -YC 2216.315443 1 0.0001 1786 | 1/14 65 h-m-p 0.0002 0.1114 0.9189 Y 2216.315397 0 0.0001 1803 | 1/14 66 h-m-p 0.0010 0.4765 0.5766 C 2216.315372 0 0.0002 1833 | 1/14 67 h-m-p 0.0003 0.1657 0.8904 C 2216.315311 0 0.0004 1863 | 1/14 68 h-m-p 0.0007 0.2462 0.5282 Y 2216.315304 0 0.0001 1893 | 1/14 69 h-m-p 0.0004 0.1986 0.2110 Y 2216.315301 0 0.0002 1923 | 1/14 70 h-m-p 0.0059 2.9663 0.1281 C 2216.315273 0 0.0051 1953 | 1/14 71 h-m-p 0.0026 1.3187 3.3779 C 2216.314918 0 0.0022 1983 | 1/14 72 h-m-p 0.0054 0.1630 1.3981 -Y 2216.314906 0 0.0002 2001 | 1/14 73 h-m-p 0.0401 8.0000 0.0066 --Y 2216.314906 0 0.0011 2020 | 1/14 74 h-m-p 0.0160 8.0000 0.0208 Y 2216.314890 0 0.0280 2050 | 1/14 75 h-m-p 0.0241 8.0000 0.0241 C 2216.314837 0 0.0361 2080 | 1/14 76 h-m-p 0.1590 8.0000 0.0055 C 2216.314829 0 0.2232 2110 | 1/14 77 h-m-p 1.6000 8.0000 0.0001 Y 2216.314827 0 1.0339 2140 | 1/14 78 h-m-p 1.6000 8.0000 0.0000 C 2216.314827 0 1.9696 2170 | 1/14 79 h-m-p 1.6000 8.0000 0.0000 Y 2216.314827 0 1.2113 2200 | 1/14 80 h-m-p 1.6000 8.0000 0.0000 C 2216.314827 0 0.4000 2230 | 1/14 81 h-m-p 0.0160 8.0000 0.0004 -------------.. | 1/14 82 h-m-p 0.0007 0.3626 0.0109 --Y 2216.314827 0 0.0000 2303 | 1/14 83 h-m-p 0.0004 0.2061 0.0161 Y 2216.314827 0 0.0001 2333 | 1/14 84 h-m-p 0.0160 8.0000 0.0039 ----C 2216.314827 0 0.0000 2367 | 1/14 85 h-m-p 0.0160 8.0000 0.0020 -------C 2216.314827 0 0.0000 2404 | 1/14 86 h-m-p 0.0160 8.0000 0.0040 --Y 2216.314827 0 0.0005 2436 | 1/14 87 h-m-p 0.0160 8.0000 0.1276 -----------N 2216.314827 0 0.0000 2477 | 1/14 88 h-m-p 0.0160 8.0000 0.0086 ---Y 2216.314827 0 0.0000 2510 | 1/14 89 h-m-p 0.0160 8.0000 0.0015 ------Y 2216.314827 0 0.0000 2546 | 1/14 90 h-m-p 0.0160 8.0000 0.0011 -------C 2216.314827 0 0.0000 2583 | 1/14 91 h-m-p 0.0160 8.0000 0.0102 --Y 2216.314827 0 0.0001 2615 | 1/14 92 h-m-p 0.0160 8.0000 0.0246 ----C 2216.314827 0 0.0000 2649 | 1/14 93 h-m-p 0.0160 8.0000 0.0033 --Y 2216.314827 0 0.0002 2681 | 1/14 94 h-m-p 0.0160 8.0000 0.0026 -----Y 2216.314827 0 0.0000 2716 | 1/14 95 h-m-p 0.0160 8.0000 0.0001 -C 2216.314827 0 0.0010 2747 | 1/14 96 h-m-p 0.0160 8.0000 0.0001 -----Y 2216.314827 0 0.0000 2782 Out.. lnL = -2216.314827 2783 lfun, 33396 eigenQcodon, 275517 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2282.273534 S = -2230.999444 -42.764659 Calculating f(w|X), posterior probabilities of site classes. did 10 / 175 patterns 2:59 did 20 / 175 patterns 2:59 did 30 / 175 patterns 2:59 did 40 / 175 patterns 2:59 did 50 / 175 patterns 2:59 did 60 / 175 patterns 3:00 did 70 / 175 patterns 3:00 did 80 / 175 patterns 3:00 did 90 / 175 patterns 3:00 did 100 / 175 patterns 3:00 did 110 / 175 patterns 3:00 did 120 / 175 patterns 3:01 did 130 / 175 patterns 3:01 did 140 / 175 patterns 3:01 did 150 / 175 patterns 3:01 did 160 / 175 patterns 3:01 did 170 / 175 patterns 3:02 did 175 / 175 patterns 3:02 Time used: 3:02 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=368 D_melanogaster_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG D_sechellia_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG D_simulans_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG D_yakuba_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG D_erecta_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG D_ficusphila_128up-PA MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG ********:***************************************** D_melanogaster_128up-PA GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT D_sechellia_128up-PA GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT D_simulans_128up-PA GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT D_yakuba_128up-PA GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT D_erecta_128up-PA GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT D_ficusphila_128up-PA GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT ************************************************** D_melanogaster_128up-PA TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD D_sechellia_128up-PA TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD D_simulans_128up-PA TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD D_yakuba_128up-PA TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD D_erecta_128up-PA TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD D_ficusphila_128up-PA TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD ************************************************** D_melanogaster_128up-PA CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL D_sechellia_128up-PA CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL D_simulans_128up-PA CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL D_yakuba_128up-PA CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL D_erecta_128up-PA CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL D_ficusphila_128up-PA CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL ******************************************.******* D_melanogaster_128up-PA DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI D_sechellia_128up-PA DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI D_simulans_128up-PA DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI D_yakuba_128up-PA DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI D_erecta_128up-PA DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI D_ficusphila_128up-PA DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI *:************************************************ D_melanogaster_128up-PA DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG D_sechellia_128up-PA DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG D_simulans_128up-PA DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG D_yakuba_128up-PA DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG D_erecta_128up-PA DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG D_ficusphila_128up-PA DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG ************************:************************* D_melanogaster_128up-PA QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV D_sechellia_128up-PA QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV D_simulans_128up-PA QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV D_yakuba_128up-PA QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV D_erecta_128up-PA QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV D_ficusphila_128up-PA QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV ************************************************** D_melanogaster_128up-PA GIEHVLNDEDVVQIVKKV D_sechellia_128up-PA GIDHVLNDEDVVQIVKKV D_simulans_128up-PA GIDHVLNDEDVVQIVKKV D_yakuba_128up-PA GIEHVLNDEDVVQIVKKV D_erecta_128up-PA GIEHVLNDEDVVQIVKKV D_ficusphila_128up-PA GIEHVLNDEDVVQIVKKV **:***************
>D_melanogaster_128up-PA ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAAAAGAACAAGGCCACCTCGGCCCATTTGGGTCTACTGAAGGCGA AGCTGGCTAAGCTGCGACGCGAACTGATTTCCCCCAAAGGAGGCGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACTGGAGATGCCCGGGT GGGATTCGTAGGGTTTCCTTCTGTGGGTAAATCCACACTGCTCTCCAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC ACTGTGCCGGGATGCATTAAGTACAAGGGCGCTAAGATCCAGCTGCTGGA CTTGCCCGGTATCATTGAGGGCGCTAAGGATGGCAAGGGTCGAGGTCGTC AGGTGATTGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCCGAGTTG GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTCATTGACGTTA TCGAGGGCAACCGCATCTACATACCCTGCATATATCTGCTGAACAAGATC GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC TGATGTGGGAATACCTGCGACTGCAGCGCATCTACACCAAGCCCAAGGGC CAGCTGCCCGATTACAACTCGCCCGTGGTACTCCACAACGAGCGCACCAG CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCACAGAAGGTG GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA GGTT >D_sechellia_128up-PA ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAGGGAGGCGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTCCTGGA TTTGCCCGGTATCATTGAGGGCGCTAAGGACGGCAAGGGTCGAGGTCGTC AGGTGATAGCTGTCGCTCGCACCTGCAACCTCATTTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAAAAACTCCTCGAGCATGAATTGGAGGG CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA TTGAGGGCAACCGCATCTATATACCTTGCATCTATCTGCTAAACAAGATC GATCAGATCTCCATTGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG TGTGCCCATCTCGGCCCATCACAACTGGAACTTTGACGATCTTCTGGAGC TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGT CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGTACTAG CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA GGTT >D_simulans_128up-PA ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGGGGTCGTC AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG CTTCGGCATCCGGCTAAACAAGAAACCACCAAATATCTACTACAAGCGGA AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGC CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG CATTGAAGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCTCAGAAGGTG GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA GGTT >D_yakuba_128up-PA ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCGA AGCTGGCCAAGCTGCGGCGCGAGCTGATTTCCCCCAAAGGAGGTGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACGGGAGATGCCCGTGT GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCAAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC ACTGTACCAGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA TCTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC AGGTGATAGCTGTTGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAGAAACTCCTGGAGCATGAATTGGAGGG CTTCGGCATCCGTCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCTGAGTTG GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC GGACATCACCCTAAGATACGACGCCACTAGTGACGATCTGATCGACGTTA TTGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC GATCAGATCTCCATCGAGGAACTGGACGTCATCTACAAGATCCCGCATTG CGTGCCCATTTCGGCCCATCATCACTGGAACTTCGACGATCTGCTGGAGC TGATGTGGGAGTACCTGCGGCTACAGCGCATCTACACCAAGCCCAAGGGC CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCGCAGAAGGTG GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA GGTT >D_erecta_128up-PA ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCAA AGCTGGCCAAGCTGCGACGCGAGCTGATTTCTCCCAAAGGAGGCGGCGGC GGAACCGGCGAAGCTGGCTTCGAGGTGGCGAAGACAGGAGATGCCCGTGT GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCTAACT TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC ACTGTGCCAGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATCTTCATGGTGCTGGAT TGCCTGAAACCGCTTGGCCACAAGAAACTGCTCGAGCATGAATTGGAGGG CTTCGGCATTCGGCTTAACAAGAAACCACCAAATATTTACTACAAGCGGA AAGACAAGGGTGGCATCAATCTTAACTGCATGGTTCCGCAGTCGGAGTTG GACACGGATCTGGTGAAGACCATTCTGTCCGAGTACAAGATCCACAATGC GGACATCACCCTGAGATACGACGCCACTAGTGACGATCTGATCGACGTTA TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCACATTG CGTGCCCATCTCAGCCCATCACCACTGGAACTTTGACGATCTTCTTGAGC TGATGTGGGAGTACCTGCGGTTACAGCGCATCTACACCAAGCCCAAGGGT CAGTTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA GGTT >D_ficusphila_128up-PA ATGAGCACAATTTTGGAGAAAATCGCGGCCATCGAGTCGGAGATGGCCCG CACCCAGAAGAATAAGGCCACCTCGGCGCATTTGGGTCTCCTGAAGGCTA AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC GGAACCGGCGAGGCTGGCTTTGAGGTGGCCAAGACAGGAGATGCCCGGGT GGGCTTTGTGGGTTTCCCATCCGTGGGTAAATCCACTTTACTGTCCAATT TAGCTGGAGTTTATTCCGAGGTGGCGGCCTACGAGTTCACAACGTTGACA ACTGTGCCGGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTCGA TTTGCCCGGAATCATTGAGGGCGCCAAGGATGGCAAAGGTCGTGGTCGTC AGGTGATCGCCGTCGCACGAACCTGTAACCTAATCTTCATGGTGCTGGAT TGCCTGAAACCGCTGGGTCACAAAAAACTGCTGGAGCACGAGTTGGAGGG CTTTGGCATCCGGCTTAACAAGAAACCGCCAAATATCTACTACAAGCGGA AGGACAAGGGCGGCATCAACCTGAACTGCATGGTTCCGCAATCCGAATTG GACGCGGATCTGGTGAAAACGATTTTATCGGAGTACAAGATCCACAATGC CGACATTACGCTGAGATACGATGCCACTAGTGACGACCTAATCGACGTGA TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAATAAGATC GATCAGATCTCCATTGAGGAGCTGGACGTAATCTACAAGATCCCGCACTG CGTGCCCATTTCGGCGCACCACCACTGGAACTTTGACGATCTGCTGGAGC TGATGTGGGAATACCTGCGGCTGCAGCGAATCTACACGAAGCCCAAGGGC CAGCTGCCCGACTACAATTCACCCGTGGTGCTCCACAACGAGCGCACCAG CATTGAGGACTTTTGCAACAAGTTGCATCGCTCCATCGCAAAGGAGTTTA AATATGCGCTGGTCTGGGGTTCATCCGTGAAGCATCAACCCCAGAAAGTG GGCATCGAGCATGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA GGTT
>D_melanogaster_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >D_sechellia_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >D_simulans_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIDHVLNDEDVVQIVKKV >D_yakuba_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >D_erecta_128up-PA MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV >D_ficusphila_128up-PA MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV GIEHVLNDEDVVQIVKKV
#NEXUS [ID: 6759784829] begin taxa; dimensions ntax=6; taxlabels D_melanogaster_128up-PA D_sechellia_128up-PA D_simulans_128up-PA D_yakuba_128up-PA D_erecta_128up-PA D_ficusphila_128up-PA ; end; begin trees; translate 1 D_melanogaster_128up-PA, 2 D_sechellia_128up-PA, 3 D_simulans_128up-PA, 4 D_yakuba_128up-PA, 5 D_erecta_128up-PA, 6 D_ficusphila_128up-PA ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.03821144,(2:0.0368987,3:0.007152138)0.986:0.01424071,((4:0.03356722,5:0.04354723)0.857:0.01866594,6:0.3354583)0.802:0.01589231); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.03821144,(2:0.0368987,3:0.007152138):0.01424071,((4:0.03356722,5:0.04354723):0.01866594,6:0.3354583):0.01589231); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2413.83 -2426.99 2 -2414.07 -2424.97 -------------------------------------- TOTAL -2413.94 -2426.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.556558 0.006634 0.406277 0.719295 0.548050 1258.52 1293.27 1.000 r(A<->C){all} 0.061721 0.000568 0.019533 0.110070 0.059674 1049.15 1060.80 1.000 r(A<->G){all} 0.304211 0.003060 0.196530 0.407952 0.300783 754.02 768.11 1.001 r(A<->T){all} 0.119967 0.001740 0.044598 0.202388 0.116152 583.49 722.17 1.000 r(C<->G){all} 0.042319 0.000240 0.011324 0.071546 0.041246 972.06 1001.90 1.000 r(C<->T){all} 0.407791 0.003086 0.304153 0.521389 0.406057 803.92 887.04 1.002 r(G<->T){all} 0.063992 0.000557 0.020788 0.109547 0.061420 1023.83 1048.07 1.001 pi(A){all} 0.240638 0.000161 0.214939 0.264442 0.240394 1434.12 1449.86 1.000 pi(C){all} 0.272588 0.000169 0.245651 0.295977 0.272551 1293.71 1316.92 1.000 pi(G){all} 0.279551 0.000174 0.251590 0.303451 0.279558 1208.59 1232.19 1.000 pi(T){all} 0.207223 0.000133 0.184975 0.229367 0.207113 1170.67 1181.94 1.000 alpha{1,2} 0.033798 0.000457 0.000229 0.071049 0.031841 1399.63 1410.21 1.000 alpha{3} 3.286184 0.908698 1.588927 5.169913 3.155399 1501.00 1501.00 1.000 pinvar{all} 0.590164 0.001292 0.512907 0.653991 0.591793 1382.59 1441.79 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/128up-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 368 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 4 6 | Ser TCT 2 1 1 3 4 0 | Tyr TAT 2 3 2 2 2 3 | Cys TGT 1 1 1 1 1 1 TTC 6 6 6 6 5 3 | TCC 8 8 8 6 5 9 | TAC 12 11 12 12 12 11 | TGC 5 5 5 5 6 6 Leu TTA 0 0 0 0 1 3 | TCA 1 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 7 6 6 6 8 7 | TCG 5 5 5 5 5 4 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 3 1 2 5 1 | Pro CCT 1 3 3 1 1 0 | His CAT 6 6 6 7 6 4 | Arg CGT 1 2 1 3 2 2 CTC 7 7 6 5 5 4 | CCC 7 7 7 7 8 8 | CAC 6 5 6 5 6 8 | CGC 6 5 6 6 6 5 CTA 2 2 2 3 0 2 | CCA 3 2 2 3 4 2 | Gln CAA 1 0 0 0 0 2 | CGA 4 3 2 2 3 3 CTG 23 23 26 25 22 24 | CCG 4 3 3 4 2 5 | CAG 9 10 10 10 10 8 | CGG 3 4 5 3 3 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 10 9 7 10 10 10 | Thr ACT 3 4 3 2 2 3 | Asn AAT 3 3 3 3 3 6 | Ser AGT 1 1 1 1 1 1 ATC 19 20 22 20 20 21 | ACC 9 8 9 9 9 5 | AAC 12 13 12 12 12 9 | AGC 3 3 3 3 2 2 ATA 3 3 3 2 2 1 | ACA 3 3 3 3 4 4 | Lys AAA 7 7 7 7 8 11 | Arg AGA 1 1 1 1 1 1 Met ATG 5 5 5 5 5 5 | ACG 2 2 2 3 2 4 | AAG 28 28 28 28 27 24 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 6 6 6 7 6 4 | Ala GCT 7 6 5 4 4 3 | Asp GAT 9 8 9 10 10 9 | Gly GGT 6 6 5 7 7 7 GTC 3 4 4 3 4 4 | GCC 9 10 12 12 11 12 | GAC 11 13 12 10 10 11 | GGC 17 17 18 16 16 16 GTA 2 1 1 2 1 1 | GCA 1 1 0 0 1 2 | Glu GAA 7 4 5 5 4 2 | GGA 5 6 6 6 6 6 GTG 14 14 14 13 14 16 | GCG 4 4 4 5 5 6 | GAG 17 19 18 19 20 22 | GGG 1 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_128up-PA position 1: T:0.14946 C:0.23098 A:0.29620 G:0.32337 position 2: T:0.30435 C:0.18750 A:0.35326 G:0.15489 position 3: T:0.17120 C:0.38043 A:0.10870 G:0.33967 Average T:0.20833 C:0.26630 A:0.25272 G:0.27264 #2: D_sechellia_128up-PA position 1: T:0.14674 C:0.23098 A:0.29891 G:0.32337 position 2: T:0.30435 C:0.18750 A:0.35326 G:0.15489 position 3: T:0.17663 C:0.38587 A:0.09511 G:0.34239 Average T:0.20924 C:0.26812 A:0.24909 G:0.27355 #3: D_simulans_128up-PA position 1: T:0.14674 C:0.23370 A:0.29620 G:0.32337 position 2: T:0.30435 C:0.18750 A:0.35326 G:0.15489 position 3: T:0.15489 C:0.40217 A:0.09239 G:0.35054 Average T:0.20199 C:0.27446 A:0.24728 G:0.27627 #4: D_yakuba_128up-PA position 1: T:0.14674 C:0.23370 A:0.29620 G:0.32337 position 2: T:0.30435 C:0.18750 A:0.35326 G:0.15489 position 3: T:0.17935 C:0.37228 A:0.09783 G:0.35054 Average T:0.21014 C:0.26449 A:0.24909 G:0.27627 #5: D_erecta_128up-PA position 1: T:0.15761 C:0.22554 A:0.29348 G:0.32337 position 2: T:0.30435 C:0.18750 A:0.35326 G:0.15489 position 3: T:0.18478 C:0.37228 A:0.10054 G:0.34239 Average T:0.21558 C:0.26178 A:0.24909 G:0.27355 #6: D_ficusphila_128up-PA position 1: T:0.15761 C:0.22283 A:0.29076 G:0.32880 position 2: T:0.30435 C:0.18750 A:0.35326 G:0.15489 position 3: T:0.16304 C:0.36413 A:0.11413 G:0.35870 Average T:0.20833 C:0.25815 A:0.25272 G:0.28080 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 22 | Ser S TCT 11 | Tyr Y TAT 14 | Cys C TGT 6 TTC 32 | TCC 44 | TAC 70 | TGC 32 Leu L TTA 4 | TCA 11 | *** * TAA 0 | *** * TGA 0 TTG 40 | TCG 29 | TAG 0 | Trp W TGG 18 ------------------------------------------------------------------------------ Leu L CTT 14 | Pro P CCT 9 | His H CAT 35 | Arg R CGT 11 CTC 34 | CCC 44 | CAC 36 | CGC 34 CTA 11 | CCA 16 | Gln Q CAA 3 | CGA 17 CTG 143 | CCG 21 | CAG 57 | CGG 22 ------------------------------------------------------------------------------ Ile I ATT 56 | Thr T ACT 17 | Asn N AAT 21 | Ser S AGT 6 ATC 122 | ACC 49 | AAC 70 | AGC 16 ATA 14 | ACA 20 | Lys K AAA 47 | Arg R AGA 6 Met M ATG 30 | ACG 15 | AAG 163 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 35 | Ala A GCT 29 | Asp D GAT 55 | Gly G GGT 38 GTC 22 | GCC 66 | GAC 67 | GGC 100 GTA 8 | GCA 5 | Glu E GAA 27 | GGA 35 GTG 85 | GCG 28 | GAG 115 | GGG 1 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.15082 C:0.22962 A:0.29529 G:0.32428 position 2: T:0.30435 C:0.18750 A:0.35326 G:0.15489 position 3: T:0.17165 C:0.37953 A:0.10145 G:0.34737 Average T:0.20894 C:0.26555 A:0.25000 G:0.27551 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_128up-PA D_sechellia_128up-PA 0.0153 (0.0024 0.1565) D_simulans_128up-PA 0.0107 (0.0012 0.1119) 0.0146 (0.0012 0.0822) D_yakuba_128up-PA -1.0000 (0.0000 0.1892) 0.0118 (0.0024 0.2035) 0.0082 (0.0012 0.1469) D_erecta_128up-PA 0.0058 (0.0012 0.2046) 0.0172 (0.0036 0.2094) 0.0144 (0.0024 0.1660) 0.0084 (0.0012 0.1433) D_ficusphila_128up-PA 0.0073 (0.0036 0.4921) 0.0119 (0.0060 0.5062) 0.0110 (0.0048 0.4354) 0.0071 (0.0036 0.5057) 0.0047 (0.0024 0.5088) Model 0: one-ratio TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 179 lnL(ntime: 9 np: 11): -2218.445959 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.050949 0.022664 0.050715 0.011849 0.019437 0.017676 0.049421 0.059030 0.301602 1.949691 0.007528 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58334 (1: 0.050949, (2: 0.050715, 3: 0.011849): 0.022664, ((4: 0.049421, 5: 0.059030): 0.017676, 6: 0.301602): 0.019437); (D_melanogaster_128up-PA: 0.050949, (D_sechellia_128up-PA: 0.050715, D_simulans_128up-PA: 0.011849): 0.022664, ((D_yakuba_128up-PA: 0.049421, D_erecta_128up-PA: 0.059030): 0.017676, D_ficusphila_128up-PA: 0.301602): 0.019437); Detailed output identifying parameters kappa (ts/tv) = 1.94969 omega (dN/dS) = 0.00753 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.051 877.8 226.2 0.0075 0.0006 0.0805 0.5 18.2 7..8 0.023 877.8 226.2 0.0075 0.0003 0.0358 0.2 8.1 8..2 0.051 877.8 226.2 0.0075 0.0006 0.0802 0.5 18.1 8..3 0.012 877.8 226.2 0.0075 0.0001 0.0187 0.1 4.2 7..9 0.019 877.8 226.2 0.0075 0.0002 0.0307 0.2 6.9 9..10 0.018 877.8 226.2 0.0075 0.0002 0.0279 0.2 6.3 10..4 0.049 877.8 226.2 0.0075 0.0006 0.0781 0.5 17.7 10..5 0.059 877.8 226.2 0.0075 0.0007 0.0933 0.6 21.1 9..6 0.302 877.8 226.2 0.0075 0.0036 0.4767 3.1 107.8 tree length for dN: 0.0069 tree length for dS: 0.9220 Time used: 0:02 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 179 lnL(ntime: 9 np: 12): -2216.479301 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.050943 0.022614 0.050642 0.011850 0.019490 0.017677 0.049484 0.059188 0.303035 1.956722 0.994766 0.004339 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58492 (1: 0.050943, (2: 0.050642, 3: 0.011850): 0.022614, ((4: 0.049484, 5: 0.059188): 0.017677, 6: 0.303035): 0.019490); (D_melanogaster_128up-PA: 0.050943, (D_sechellia_128up-PA: 0.050642, D_simulans_128up-PA: 0.011850): 0.022614, ((D_yakuba_128up-PA: 0.049484, D_erecta_128up-PA: 0.059188): 0.017677, D_ficusphila_128up-PA: 0.303035): 0.019490); Detailed output identifying parameters kappa (ts/tv) = 1.95672 dN/dS (w) for site classes (K=2) p: 0.99477 0.00523 w: 0.00434 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.051 877.6 226.4 0.0096 0.0008 0.0799 0.7 18.1 7..8 0.023 877.6 226.4 0.0096 0.0003 0.0354 0.3 8.0 8..2 0.051 877.6 226.4 0.0096 0.0008 0.0794 0.7 18.0 8..3 0.012 877.6 226.4 0.0096 0.0002 0.0186 0.2 4.2 7..9 0.019 877.6 226.4 0.0096 0.0003 0.0306 0.3 6.9 9..10 0.018 877.6 226.4 0.0096 0.0003 0.0277 0.2 6.3 10..4 0.049 877.6 226.4 0.0096 0.0007 0.0776 0.7 17.6 10..5 0.059 877.6 226.4 0.0096 0.0009 0.0928 0.8 21.0 9..6 0.303 877.6 226.4 0.0096 0.0045 0.4750 4.0 107.5 Time used: 0:07 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 179 lnL(ntime: 9 np: 14): -2216.479301 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.050942 0.022614 0.050642 0.011850 0.019490 0.017677 0.049483 0.059188 0.303034 1.956711 0.994766 0.005234 0.004339 23.584476 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58492 (1: 0.050942, (2: 0.050642, 3: 0.011850): 0.022614, ((4: 0.049483, 5: 0.059188): 0.017677, 6: 0.303034): 0.019490); (D_melanogaster_128up-PA: 0.050942, (D_sechellia_128up-PA: 0.050642, D_simulans_128up-PA: 0.011850): 0.022614, ((D_yakuba_128up-PA: 0.049483, D_erecta_128up-PA: 0.059188): 0.017677, D_ficusphila_128up-PA: 0.303034): 0.019490); Detailed output identifying parameters kappa (ts/tv) = 1.95671 dN/dS (w) for site classes (K=3) p: 0.99477 0.00523 0.00000 w: 0.00434 1.00000 23.58448 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.051 877.6 226.4 0.0095 0.0008 0.0799 0.7 18.1 7..8 0.023 877.6 226.4 0.0095 0.0003 0.0354 0.3 8.0 8..2 0.051 877.6 226.4 0.0095 0.0008 0.0794 0.7 18.0 8..3 0.012 877.6 226.4 0.0095 0.0002 0.0186 0.2 4.2 7..9 0.019 877.6 226.4 0.0095 0.0003 0.0306 0.3 6.9 9..10 0.018 877.6 226.4 0.0095 0.0003 0.0277 0.2 6.3 10..4 0.049 877.6 226.4 0.0095 0.0007 0.0776 0.7 17.6 10..5 0.059 877.6 226.4 0.0095 0.0009 0.0928 0.8 21.0 9..6 0.303 877.6 226.4 0.0095 0.0045 0.4750 4.0 107.5 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_128up-PA) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.389 0.122 0.079 0.066 0.060 0.058 0.057 0.057 0.056 0.056 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 0:21 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 179 lnL(ntime: 9 np: 15): -2215.939341 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.051037 0.022641 0.050725 0.011864 0.019495 0.017695 0.049507 0.059161 0.302525 1.951490 0.656006 0.306032 0.000001 0.000001 0.212912 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58465 (1: 0.051037, (2: 0.050725, 3: 0.011864): 0.022641, ((4: 0.049507, 5: 0.059161): 0.017695, 6: 0.302525): 0.019495); (D_melanogaster_128up-PA: 0.051037, (D_sechellia_128up-PA: 0.050725, D_simulans_128up-PA: 0.011864): 0.022641, ((D_yakuba_128up-PA: 0.049507, D_erecta_128up-PA: 0.059161): 0.017695, D_ficusphila_128up-PA: 0.302525): 0.019495); Detailed output identifying parameters kappa (ts/tv) = 1.95149 dN/dS (w) for site classes (K=3) p: 0.65601 0.30603 0.03796 w: 0.00000 0.00000 0.21291 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.051 877.7 226.3 0.0081 0.0007 0.0805 0.6 18.2 7..8 0.023 877.7 226.3 0.0081 0.0003 0.0357 0.3 8.1 8..2 0.051 877.7 226.3 0.0081 0.0006 0.0800 0.6 18.1 8..3 0.012 877.7 226.3 0.0081 0.0002 0.0187 0.1 4.2 7..9 0.019 877.7 226.3 0.0081 0.0002 0.0307 0.2 7.0 9..10 0.018 877.7 226.3 0.0081 0.0002 0.0279 0.2 6.3 10..4 0.050 877.7 226.3 0.0081 0.0006 0.0781 0.6 17.7 10..5 0.059 877.7 226.3 0.0081 0.0008 0.0933 0.7 21.1 9..6 0.303 877.7 226.3 0.0081 0.0039 0.4771 3.4 107.9 Naive Empirical Bayes (NEB) analysis Time used: 0:29 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 179 lnL(ntime: 9 np: 12): -2216.368583 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.051012 0.022669 0.050750 0.011862 0.019470 0.017694 0.049483 0.059113 0.302108 1.950488 0.011633 0.404938 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58416 (1: 0.051012, (2: 0.050750, 3: 0.011862): 0.022669, ((4: 0.049483, 5: 0.059113): 0.017694, 6: 0.302108): 0.019470); (D_melanogaster_128up-PA: 0.051012, (D_sechellia_128up-PA: 0.050750, D_simulans_128up-PA: 0.011862): 0.022669, ((D_yakuba_128up-PA: 0.049483, D_erecta_128up-PA: 0.059113): 0.017694, D_ficusphila_128up-PA: 0.302108): 0.019470); Detailed output identifying parameters kappa (ts/tv) = 1.95049 Parameters in M7 (beta): p = 0.01163 q = 0.40494 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.07888 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.051 877.8 226.2 0.0079 0.0006 0.0805 0.6 18.2 7..8 0.023 877.8 226.2 0.0079 0.0003 0.0358 0.2 8.1 8..2 0.051 877.8 226.2 0.0079 0.0006 0.0801 0.6 18.1 8..3 0.012 877.8 226.2 0.0079 0.0001 0.0187 0.1 4.2 7..9 0.019 877.8 226.2 0.0079 0.0002 0.0307 0.2 7.0 9..10 0.018 877.8 226.2 0.0079 0.0002 0.0279 0.2 6.3 10..4 0.049 877.8 226.2 0.0079 0.0006 0.0781 0.5 17.7 10..5 0.059 877.8 226.2 0.0079 0.0007 0.0933 0.6 21.1 9..6 0.302 877.8 226.2 0.0079 0.0038 0.4768 3.3 107.9 Time used: 1:19 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), ((4, 5), 6)); MP score: 179 lnL(ntime: 9 np: 14): -2216.314827 +0.000000 7..1 7..8 8..2 8..3 7..9 9..10 10..4 10..5 9..6 0.050973 0.022639 0.050690 0.011854 0.019480 0.017683 0.049479 0.059148 0.302574 1.953370 0.997466 0.008126 0.251395 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.58452 (1: 0.050973, (2: 0.050690, 3: 0.011854): 0.022639, ((4: 0.049479, 5: 0.059148): 0.017683, 6: 0.302574): 0.019480); (D_melanogaster_128up-PA: 0.050973, (D_sechellia_128up-PA: 0.050690, D_simulans_128up-PA: 0.011854): 0.022639, ((D_yakuba_128up-PA: 0.049479, D_erecta_128up-PA: 0.059148): 0.017683, D_ficusphila_128up-PA: 0.302574): 0.019480); Detailed output identifying parameters kappa (ts/tv) = 1.95337 Parameters in M8 (beta&w>1): p0 = 0.99747 p = 0.00813 q = 0.25139 (p1 = 0.00253) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.09975 0.09975 0.09975 0.09975 0.09975 0.09975 0.09975 0.09975 0.09975 0.09975 0.00253 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.06120 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.051 877.7 226.3 0.0086 0.0007 0.0802 0.6 18.1 7..8 0.023 877.7 226.3 0.0086 0.0003 0.0356 0.3 8.1 8..2 0.051 877.7 226.3 0.0086 0.0007 0.0798 0.6 18.0 8..3 0.012 877.7 226.3 0.0086 0.0002 0.0187 0.1 4.2 7..9 0.019 877.7 226.3 0.0086 0.0003 0.0306 0.2 6.9 9..10 0.018 877.7 226.3 0.0086 0.0002 0.0278 0.2 6.3 10..4 0.049 877.7 226.3 0.0086 0.0007 0.0779 0.6 17.6 10..5 0.059 877.7 226.3 0.0086 0.0008 0.0931 0.7 21.1 9..6 0.303 877.7 226.3 0.0086 0.0041 0.4761 3.6 107.7 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_128up-PA) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.104 0.888 ws: 0.558 0.107 0.059 0.046 0.041 0.039 0.038 0.038 0.037 0.037 Time used: 3:02
Model 1: NearlyNeutral -2216.479301 Model 2: PositiveSelection -2216.479301 Model 0: one-ratio -2218.445959 Model 3: discrete -2215.939341 Model 7: beta -2216.368583 Model 8: beta&w>1 -2216.314827 Model 0 vs 1 3.933316000000559 Model 2 vs 1 0.0 Model 8 vs 7 0.10751199999958772