--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 12:55:20 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/128up-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2413.83         -2426.99
2      -2414.07         -2424.97
--------------------------------------
TOTAL    -2413.94         -2426.42
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.556558    0.006634    0.406277    0.719295    0.548050   1258.52   1293.27    1.000
r(A<->C){all}   0.061721    0.000568    0.019533    0.110070    0.059674   1049.15   1060.80    1.000
r(A<->G){all}   0.304211    0.003060    0.196530    0.407952    0.300783    754.02    768.11    1.001
r(A<->T){all}   0.119967    0.001740    0.044598    0.202388    0.116152    583.49    722.17    1.000
r(C<->G){all}   0.042319    0.000240    0.011324    0.071546    0.041246    972.06   1001.90    1.000
r(C<->T){all}   0.407791    0.003086    0.304153    0.521389    0.406057    803.92    887.04    1.002
r(G<->T){all}   0.063992    0.000557    0.020788    0.109547    0.061420   1023.83   1048.07    1.001
pi(A){all}      0.240638    0.000161    0.214939    0.264442    0.240394   1434.12   1449.86    1.000
pi(C){all}      0.272588    0.000169    0.245651    0.295977    0.272551   1293.71   1316.92    1.000
pi(G){all}      0.279551    0.000174    0.251590    0.303451    0.279558   1208.59   1232.19    1.000
pi(T){all}      0.207223    0.000133    0.184975    0.229367    0.207113   1170.67   1181.94    1.000
alpha{1,2}      0.033798    0.000457    0.000229    0.071049    0.031841   1399.63   1410.21    1.000
alpha{3}        3.286184    0.908698    1.588927    5.169913    3.155399   1501.00   1501.00    1.000
pinvar{all}     0.590164    0.001292    0.512907    0.653991    0.591793   1382.59   1441.79    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2216.479301
Model 2: PositiveSelection	-2216.479301
Model 0: one-ratio	-2218.445959
Model 3: discrete	-2215.939341
Model 7: beta	-2216.368583
Model 8: beta&w>1	-2216.314827


Model 0 vs 1	3.933316000000559

Model 2 vs 1	0.0

Model 8 vs 7	0.10751199999958772
>C1
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C2
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIDHVLNDEDVVQIVKKV
>C3
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIDHVLNDEDVVQIVKKV
>C4
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C5
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C6
MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=368 

C1              MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
C2              MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
C3              MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
C4              MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
C5              MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
C6              MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
                ********:*****************************************

C1              GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
C2              GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
C3              GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
C4              GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
C5              GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
C6              GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
                **************************************************

C1              TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
C2              TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
C3              TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
C4              TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
C5              TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
C6              TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
                **************************************************

C1              CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
C2              CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
C3              CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
C4              CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
C5              CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
C6              CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
                ******************************************.*******

C1              DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
C2              DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
C3              DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
C4              DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
C5              DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
C6              DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
                *:************************************************

C1              DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
C2              DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG
C3              DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
C4              DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
C5              DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
C6              DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
                ************************:*************************

C1              QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
C2              QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
C3              QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
C4              QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
C5              QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
C6              QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
                **************************************************

C1              GIEHVLNDEDVVQIVKKV
C2              GIDHVLNDEDVVQIVKKV
C3              GIDHVLNDEDVVQIVKKV
C4              GIEHVLNDEDVVQIVKKV
C5              GIEHVLNDEDVVQIVKKV
C6              GIEHVLNDEDVVQIVKKV
                **:***************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  368 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  368 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11040]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [11040]--->[11040]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/128up-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.370 Mb, Max= 30.796 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C2
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIDHVLNDEDVVQIVKKV
>C3
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIDHVLNDEDVVQIVKKV
>C4
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C5
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C6
MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV

FORMAT of file /tmp/tmp2525620386054257507aln Not Supported[FATAL:T-COFFEE]
>C1
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C2
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIDHVLNDEDVVQIVKKV
>C3
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIDHVLNDEDVVQIVKKV
>C4
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C5
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C6
MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:368 S:100 BS:368
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.46 C1	 C2	 99.46
TOP	    1    0	 99.46 C2	 C1	 99.46
BOT	    0    2	 99.73 C1	 C3	 99.73
TOP	    2    0	 99.73 C3	 C1	 99.73
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 99.73 C1	 C5	 99.73
TOP	    4    0	 99.73 C5	 C1	 99.73
BOT	    0    5	 99.18 C1	 C6	 99.18
TOP	    5    0	 99.18 C6	 C1	 99.18
BOT	    1    2	 99.73 C2	 C3	 99.73
TOP	    2    1	 99.73 C3	 C2	 99.73
BOT	    1    3	 99.46 C2	 C4	 99.46
TOP	    3    1	 99.46 C4	 C2	 99.46
BOT	    1    4	 99.18 C2	 C5	 99.18
TOP	    4    1	 99.18 C5	 C2	 99.18
BOT	    1    5	 98.64 C2	 C6	 98.64
TOP	    5    1	 98.64 C6	 C2	 98.64
BOT	    2    3	 99.73 C3	 C4	 99.73
TOP	    3    2	 99.73 C4	 C3	 99.73
BOT	    2    4	 99.46 C3	 C5	 99.46
TOP	    4    2	 99.46 C5	 C3	 99.46
BOT	    2    5	 98.91 C3	 C6	 98.91
TOP	    5    2	 98.91 C6	 C3	 98.91
BOT	    3    4	 99.73 C4	 C5	 99.73
TOP	    4    3	 99.73 C5	 C4	 99.73
BOT	    3    5	 99.18 C4	 C6	 99.18
TOP	    5    3	 99.18 C6	 C4	 99.18
BOT	    4    5	 99.46 C5	 C6	 99.46
TOP	    5    4	 99.46 C6	 C5	 99.46
AVG	 0	 C1	  *	 99.62
AVG	 1	 C2	  *	 99.29
AVG	 2	 C3	  *	 99.51
AVG	 3	 C4	  *	 99.62
AVG	 4	 C5	  *	 99.51
AVG	 5	 C6	  *	 99.08
TOT	 TOT	  *	 99.44
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
C2              ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
C3              ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
C4              ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
C5              ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
C6              ATGAGCACAATTTTGGAGAAAATCGCGGCCATCGAGTCGGAGATGGCCCG
                ***********:************ *************************

C1              AACCCAAAAGAACAAGGCCACCTCGGCCCATTTGGGTCTACTGAAGGCGA
C2              AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA
C3              AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA
C4              AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCGA
C5              AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCAA
C6              CACCCAGAAGAATAAGGCCACCTCGGCGCATTTGGGTCTCCTGAAGGCTA
                .*****.***** ************** *********** ******** *

C1              AGCTGGCTAAGCTGCGACGCGAACTGATTTCCCCCAAAGGAGGCGGCGGC
C2              AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAGGGAGGCGGCGGC
C3              AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC
C4              AGCTGGCCAAGCTGCGGCGCGAGCTGATTTCCCCCAAAGGAGGTGGCGGC
C5              AGCTGGCCAAGCTGCGACGCGAGCTGATTTCTCCCAAAGGAGGCGGCGGC
C6              AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC
                ******* ********.*****.******** *****.***** ******

C1              GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACTGGAGATGCCCGGGT
C2              GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT
C3              GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT
C4              GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACGGGAGATGCCCGTGT
C5              GGAACCGGCGAAGCTGGCTTCGAGGTGGCGAAGACAGGAGATGCCCGTGT
C6              GGAACCGGCGAGGCTGGCTTTGAGGTGGCCAAGACAGGAGATGCCCGGGT
                ***********.******** ******** ***** *********** **

C1              GGGATTCGTAGGGTTTCCTTCTGTGGGTAAATCCACACTGCTCTCCAACT
C2              GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT
C3              GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT
C4              GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCAAACT
C5              GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCTAACT
C6              GGGCTTTGTGGGTTTCCCATCCGTGGGTAAATCCACTTTACTGTCCAATT
                ***.** ** ** ** **:** **.***********: *.** ** ** *

C1              TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC
C2              TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC
C3              TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC
C4              TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC
C5              TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC
C6              TAGCTGGAGTTTATTCCGAGGTGGCGGCCTACGAGTTCACAACGTTGACA
                *.*****.***** **************.*****.**************.

C1              ACTGTGCCGGGATGCATTAAGTACAAGGGCGCTAAGATCCAGCTGCTGGA
C2              ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTCCTGGA
C3              ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA
C4              ACTGTACCAGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA
C5              ACTGTGCCAGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA
C6              ACTGTGCCGGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTCGA
                *****.**.******** ************** *********** ** **

C1              CTTGCCCGGTATCATTGAGGGCGCTAAGGATGGCAAGGGTCGAGGTCGTC
C2              TTTGCCCGGTATCATTGAGGGCGCTAAGGACGGCAAGGGTCGAGGTCGTC
C3              TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGGGGTCGTC
C4              TCTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC
C5              TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC
C6              TTTGCCCGGAATCATTGAGGGCGCCAAGGATGGCAAAGGTCGTGGTCGTC
                  *******:************** ***** *****.***** *******

C1              AGGTGATTGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT
C2              AGGTGATAGCTGTCGCTCGCACCTGCAACCTCATTTTCATGGTGCTGGAT
C3              AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT
C4              AGGTGATAGCTGTTGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT
C5              AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATCTTCATGGTGCTGGAT
C6              AGGTGATCGCCGTCGCACGAACCTGTAACCTAATCTTCATGGTGCTGGAT
                ******* ** ** **:**.***** *****.** ***************

C1              TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG
C2              TGCCTGAAACCGCTTGGCCACAAAAAACTCCTCGAGCATGAATTGGAGGG
C3              TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG
C4              TGCCTGAAACCGCTTGGCCACAAGAAACTCCTGGAGCATGAATTGGAGGG
C5              TGCCTGAAACCGCTTGGCCACAAGAAACTGCTCGAGCATGAATTGGAGGG
C6              TGCCTGAAACCGCTGGGTCACAAAAAACTGCTGGAGCACGAGTTGGAGGG
                ************** ** *****.***** ** ***** **.********

C1              CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA
C2              CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA
C3              CTTCGGCATCCGGCTAAACAAGAAACCACCAAATATCTACTACAAGCGGA
C4              CTTCGGCATCCGTCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA
C5              CTTCGGCATTCGGCTTAACAAGAAACCACCAAATATTTACTACAAGCGGA
C6              CTTTGGCATCCGGCTTAACAAGAAACCGCCAAATATCTACTACAAGCGGA
                *** ***** ** **:***********.******** *************

C1              AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCCGAGTTG
C2              AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG
C3              AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG
C4              AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCTGAGTTG
C5              AAGACAAGGGTGGCATCAATCTTAACTGCATGGTTCCGCAGTCGGAGTTG
C6              AGGACAAGGGCGGCATCAACCTGAACTGCATGGTTCCGCAATCCGAATTG
                *.******** ******** ** ***:********** **.** **. **

C1              GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC
C2              GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC
C3              GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC
C4              GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC
C5              GACACGGATCTGGTGAAGACCATTCTGTCCGAGTACAAGATCCACAATGC
C6              GACGCGGATCTGGTGAAAACGATTTTATCGGAGTACAAGATCCACAATGC
                ***.*************.** *** *.** ********************

C1              GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTCATTGACGTTA
C2              GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA
C3              GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA
C4              GGACATCACCCTAAGATACGACGCCACTAGTGACGATCTGATCGACGTTA
C5              GGACATCACCCTGAGATACGACGCCACTAGTGACGATCTGATCGACGTTA
C6              CGACATTACGCTGAGATACGATGCCACTAGTGACGACCTAATCGACGTGA
                 ***** ** **.******** ************** ** ** ***** *

C1              TCGAGGGCAACCGCATCTACATACCCTGCATATATCTGCTGAACAAGATC
C2              TTGAGGGCAACCGCATCTATATACCTTGCATCTATCTGCTAAACAAGATC
C3              TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC
C4              TTGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC
C5              TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC
C6              TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAATAAGATC
                * ***************** ***** *****.********.** ******

C1              GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG
C2              GATCAGATCTCCATTGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG
C3              GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG
C4              GATCAGATCTCCATCGAGGAACTGGACGTCATCTACAAGATCCCGCATTG
C5              GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCACATTG
C6              GATCAGATCTCCATTGAGGAGCTGGACGTAATCTACAAGATCCCGCACTG
                ************** *****.********.**************.** **

C1              CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC
C2              TGTGCCCATCTCGGCCCATCACAACTGGAACTTTGACGATCTTCTGGAGC
C3              CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC
C4              CGTGCCCATTTCGGCCCATCATCACTGGAACTTCGACGATCTGCTGGAGC
C5              CGTGCCCATCTCAGCCCATCACCACTGGAACTTTGACGATCTTCTTGAGC
C6              CGTGCCCATTTCGGCGCACCACCACTGGAACTTTGACGATCTGCTGGAGC
                 ******** **.** ** ** .********** ******** ** ****

C1              TGATGTGGGAATACCTGCGACTGCAGCGCATCTACACCAAGCCCAAGGGC
C2              TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGT
C3              TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGC
C4              TGATGTGGGAGTACCTGCGGCTACAGCGCATCTACACCAAGCCCAAGGGC
C5              TGATGTGGGAGTACCTGCGGTTACAGCGCATCTACACCAAGCCCAAGGGT
C6              TGATGTGGGAATACCTGCGGCTGCAGCGAATCTACACGAAGCCCAAGGGC
                **********.********. *.*****.******** *********** 

C1              CAGCTGCCCGATTACAACTCGCCCGTGGTACTCCACAACGAGCGCACCAG
C2              CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGTACTAG
C3              CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG
C4              CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG
C5              CAGTTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG
C6              CAGCTGCCCGACTACAATTCACCCGTGGTGCTCCACAACGAGCGCACCAG
                *** ******* ***** **.********.************** ** **

C1              CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA
C2              CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA
C3              CATTGAAGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA
C4              CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA
C5              CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA
C6              CATTGAGGACTTTTGCAACAAGTTGCATCGCTCCATCGCAAAGGAGTTTA
                ******.** ** ********* ************* **.*****.****

C1              AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCACAGAAGGTG
C2              AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG
C3              AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCTCAGAAGGTG
C4              AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCGCAGAAGGTG
C5              AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG
C6              AATATGCGCTGGTCTGGGGTTCATCCGTGAAGCATCAACCCCAGAAAGTG
                ************* ***** ***** ***********.** *****.***

C1              GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA
C2              GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA
C3              GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA
C4              GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA
C5              GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA
C6              GGCATCGAGCATGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA
                ******** ** ******************** *****************

C1              GGTT
C2              GGTT
C3              GGTT
C4              GGTT
C5              GGTT
C6              GGTT
                ****



>C1
ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
AACCCAAAAGAACAAGGCCACCTCGGCCCATTTGGGTCTACTGAAGGCGA
AGCTGGCTAAGCTGCGACGCGAACTGATTTCCCCCAAAGGAGGCGGCGGC
GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACTGGAGATGCCCGGGT
GGGATTCGTAGGGTTTCCTTCTGTGGGTAAATCCACACTGCTCTCCAACT
TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC
ACTGTGCCGGGATGCATTAAGTACAAGGGCGCTAAGATCCAGCTGCTGGA
CTTGCCCGGTATCATTGAGGGCGCTAAGGATGGCAAGGGTCGAGGTCGTC
AGGTGATTGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT
TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG
CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA
AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCCGAGTTG
GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC
GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTCATTGACGTTA
TCGAGGGCAACCGCATCTACATACCCTGCATATATCTGCTGAACAAGATC
GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG
CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC
TGATGTGGGAATACCTGCGACTGCAGCGCATCTACACCAAGCCCAAGGGC
CAGCTGCCCGATTACAACTCGCCCGTGGTACTCCACAACGAGCGCACCAG
CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA
AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCACAGAAGGTG
GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA
GGTT
>C2
ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA
AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAGGGAGGCGGCGGC
GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT
GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT
TGGCTGGCGTTTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACC
ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTCCTGGA
TTTGCCCGGTATCATTGAGGGCGCTAAGGACGGCAAGGGTCGAGGTCGTC
AGGTGATAGCTGTCGCTCGCACCTGCAACCTCATTTTCATGGTGCTGGAT
TGCCTGAAACCGCTTGGCCACAAAAAACTCCTCGAGCATGAATTGGAGGG
CTTCGGCATCCGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA
AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG
GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC
GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA
TTGAGGGCAACCGCATCTATATACCTTGCATCTATCTGCTAAACAAGATC
GATCAGATCTCCATTGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG
TGTGCCCATCTCGGCCCATCACAACTGGAACTTTGACGATCTTCTGGAGC
TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGT
CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGTACTAG
CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA
AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG
GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA
GGTT
>C3
ATGAGCACAATATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
AACCCAGAAGAACAAGGCCACCTCGGCCCATTTGGGTCTGCTGAAGGCGA
AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC
GGAACCGGCGAAGCTGGCTTCGAGGTGGCTAAGACTGGAGATGCCCGGGT
GGGATTCGTAGGATTTCCTTCAGTGGGTAAATCCACACTGCTCTCCAACT
TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC
ACTGTGCCGGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA
TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGGGGTCGTC
AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT
TGCCTGAAACCGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGG
CTTCGGCATCCGGCTAAACAAGAAACCACCAAATATCTACTACAAGCGGA
AGGACAAGGGCGGCATCAATCTGAACAGCATGGTTCCTCAGTCCGAGCTG
GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC
GGACATCACCCTGAGATACGACGCCACTAGTGACGACCTGATCGACGTTA
TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC
GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTG
CGTGCCCATCTCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGC
TGATGTGGGAGTACCTGCGGCTGCAGCGCATCTACACCAAGCCCAAGGGC
CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG
CATTGAAGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTA
AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCTCAGAAGGTG
GGCATCGACCACGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA
GGTT
>C4
ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCGA
AGCTGGCCAAGCTGCGGCGCGAGCTGATTTCCCCCAAAGGAGGTGGCGGC
GGAACCGGCGAAGCTGGCTTCGAGGTGGCCAAGACGGGAGATGCCCGTGT
GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCAAACT
TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC
ACTGTACCAGGATGCATCAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA
TCTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC
AGGTGATAGCTGTTGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGAT
TGCCTGAAACCGCTTGGCCACAAGAAACTCCTGGAGCATGAATTGGAGGG
CTTCGGCATCCGTCTTAACAAGAAACCACCAAATATCTACTACAAGCGGA
AGGACAAGGGTGGCATCAATCTGAACAGCATGGTTCCGCAGTCTGAGTTG
GACACGGATCTGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGC
GGACATCACCCTAAGATACGACGCCACTAGTGACGATCTGATCGACGTTA
TTGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC
GATCAGATCTCCATCGAGGAACTGGACGTCATCTACAAGATCCCGCATTG
CGTGCCCATTTCGGCCCATCATCACTGGAACTTCGACGATCTGCTGGAGC
TGATGTGGGAGTACCTGCGGCTACAGCGCATCTACACCAAGCCCAAGGGC
CAGCTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG
CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA
AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCGCAGAAGGTG
GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA
GGTT
>C5
ATGAGCACAATTTTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCG
AACCCAGAAGAACAAGGCCACCTCGGCGCATTTGGGTCTGCTGAAGGCAA
AGCTGGCCAAGCTGCGACGCGAGCTGATTTCTCCCAAAGGAGGCGGCGGC
GGAACCGGCGAAGCTGGCTTCGAGGTGGCGAAGACAGGAGATGCCCGTGT
GGGATTTGTCGGATTTCCTTCTGTAGGTAAATCCACACTGCTCTCTAACT
TGGCTGGCGTTTACTCCGAGGTGGCGGCCTACGAATTCACAACGTTGACC
ACTGTGCCAGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTGGA
TTTGCCCGGTATCATTGAGGGCGCCAAGGATGGCAAGGGTCGAGGTCGTC
AGGTGATAGCTGTCGCTCGCACCTGTAACCTCATCTTCATGGTGCTGGAT
TGCCTGAAACCGCTTGGCCACAAGAAACTGCTCGAGCATGAATTGGAGGG
CTTCGGCATTCGGCTTAACAAGAAACCACCAAATATTTACTACAAGCGGA
AAGACAAGGGTGGCATCAATCTTAACTGCATGGTTCCGCAGTCGGAGTTG
GACACGGATCTGGTGAAGACCATTCTGTCCGAGTACAAGATCCACAATGC
GGACATCACCCTGAGATACGACGCCACTAGTGACGATCTGATCGACGTTA
TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAACAAGATC
GATCAGATCTCCATCGAGGAGCTGGACGTCATCTACAAGATCCCACATTG
CGTGCCCATCTCAGCCCATCACCACTGGAACTTTGACGATCTTCTTGAGC
TGATGTGGGAGTACCTGCGGTTACAGCGCATCTACACCAAGCCCAAGGGT
CAGTTGCCCGACTACAACTCGCCCGTGGTGCTCCACAACGAGCGCACCAG
CATTGAGGATTTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAGTTTA
AATATGCGCTGGTTTGGGGCTCATCTGTGAAGCATCAGCCCCAGAAGGTG
GGCATCGAACACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAA
GGTT
>C6
ATGAGCACAATTTTGGAGAAAATCGCGGCCATCGAGTCGGAGATGGCCCG
CACCCAGAAGAATAAGGCCACCTCGGCGCATTTGGGTCTCCTGAAGGCTA
AGCTGGCCAAGCTGCGACGCGAGCTGATTTCCCCCAAAGGAGGCGGCGGC
GGAACCGGCGAGGCTGGCTTTGAGGTGGCCAAGACAGGAGATGCCCGGGT
GGGCTTTGTGGGTTTCCCATCCGTGGGTAAATCCACTTTACTGTCCAATT
TAGCTGGAGTTTATTCCGAGGTGGCGGCCTACGAGTTCACAACGTTGACA
ACTGTGCCGGGATGCATTAAGTACAAGGGCGCCAAGATCCAGCTGCTCGA
TTTGCCCGGAATCATTGAGGGCGCCAAGGATGGCAAAGGTCGTGGTCGTC
AGGTGATCGCCGTCGCACGAACCTGTAACCTAATCTTCATGGTGCTGGAT
TGCCTGAAACCGCTGGGTCACAAAAAACTGCTGGAGCACGAGTTGGAGGG
CTTTGGCATCCGGCTTAACAAGAAACCGCCAAATATCTACTACAAGCGGA
AGGACAAGGGCGGCATCAACCTGAACTGCATGGTTCCGCAATCCGAATTG
GACGCGGATCTGGTGAAAACGATTTTATCGGAGTACAAGATCCACAATGC
CGACATTACGCTGAGATACGATGCCACTAGTGACGACCTAATCGACGTGA
TCGAGGGCAACCGCATCTACATACCCTGCATCTATCTGCTGAATAAGATC
GATCAGATCTCCATTGAGGAGCTGGACGTAATCTACAAGATCCCGCACTG
CGTGCCCATTTCGGCGCACCACCACTGGAACTTTGACGATCTGCTGGAGC
TGATGTGGGAATACCTGCGGCTGCAGCGAATCTACACGAAGCCCAAGGGC
CAGCTGCCCGACTACAATTCACCCGTGGTGCTCCACAACGAGCGCACCAG
CATTGAGGACTTTTGCAACAAGTTGCATCGCTCCATCGCAAAGGAGTTTA
AATATGCGCTGGTCTGGGGTTCATCCGTGAAGCATCAACCCCAGAAAGTG
GGCATCGAGCATGTTCTCAACGACGAGGATGTCGTCCAGATTGTGAAGAA
GGTT
>C1
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C2
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHNWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIDHVLNDEDVVQIVKKV
>C3
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIDHVLNDEDVVQIVKKV
>C4
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C5
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV
>C6
MSTILEKIAAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNCMVPQSEL
DADLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1104 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480078170
      Setting output file names to "/opt/ADOPS/1/128up-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 897583322
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 6759784829
      Seed = 733388387
      Swapseed = 1480078170
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 12 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 72 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3131.063190 -- -24.965149
         Chain 2 -- -3129.710594 -- -24.965149
         Chain 3 -- -3131.721927 -- -24.965149
         Chain 4 -- -3119.752517 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3102.951460 -- -24.965149
         Chain 2 -- -3082.437147 -- -24.965149
         Chain 3 -- -3132.285207 -- -24.965149
         Chain 4 -- -3081.745827 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3131.063] (-3129.711) (-3131.722) (-3119.753) * [-3102.951] (-3082.437) (-3132.285) (-3081.746) 
        500 -- (-2524.573) [-2517.053] (-2517.953) (-2505.594) * [-2524.119] (-2529.149) (-2522.786) (-2510.379) -- 0:00:00
       1000 -- (-2506.347) [-2509.613] (-2521.759) (-2493.834) * [-2486.282] (-2525.676) (-2518.903) (-2486.170) -- 0:00:00
       1500 -- (-2495.562) [-2460.776] (-2500.489) (-2482.596) * [-2453.989] (-2510.880) (-2515.108) (-2472.824) -- 0:00:00
       2000 -- (-2476.917) [-2435.027] (-2473.383) (-2478.948) * [-2437.771] (-2505.264) (-2500.626) (-2450.773) -- 0:00:00
       2500 -- (-2466.933) (-2418.575) [-2429.086] (-2442.688) * (-2427.300) (-2474.258) (-2470.835) [-2438.315] -- 0:00:00
       3000 -- (-2450.468) [-2419.114] (-2420.540) (-2415.990) * (-2422.085) (-2427.952) (-2456.754) [-2429.379] -- 0:05:32
       3500 -- (-2430.009) [-2413.729] (-2419.674) (-2420.268) * (-2417.762) (-2429.474) [-2420.607] (-2430.279) -- 0:04:44
       4000 -- [-2420.295] (-2421.720) (-2410.838) (-2417.122) * (-2419.713) (-2429.415) [-2416.717] (-2427.728) -- 0:04:09
       4500 -- [-2422.139] (-2417.477) (-2423.837) (-2421.708) * (-2422.253) [-2418.213] (-2421.441) (-2427.044) -- 0:03:41
       5000 -- (-2421.859) (-2417.598) (-2417.833) [-2421.361] * [-2413.448] (-2415.933) (-2420.408) (-2425.552) -- 0:03:19

      Average standard deviation of split frequencies: 0.098209

       5500 -- [-2415.191] (-2416.406) (-2422.952) (-2423.712) * (-2418.614) (-2422.204) [-2420.015] (-2424.880) -- 0:03:00
       6000 -- [-2417.759] (-2425.499) (-2418.796) (-2419.677) * [-2415.128] (-2418.438) (-2426.314) (-2423.050) -- 0:02:45
       6500 -- (-2417.895) (-2419.653) [-2414.924] (-2419.454) * (-2414.523) (-2428.582) (-2415.113) [-2431.423] -- 0:02:32
       7000 -- (-2416.688) (-2424.278) [-2429.968] (-2420.735) * (-2424.599) (-2423.723) [-2419.019] (-2427.192) -- 0:02:21
       7500 -- (-2416.102) [-2415.932] (-2424.963) (-2412.321) * (-2424.155) (-2416.251) [-2416.852] (-2422.466) -- 0:02:12
       8000 -- (-2417.604) [-2421.436] (-2421.722) (-2419.495) * (-2426.967) [-2414.721] (-2413.899) (-2424.450) -- 0:02:04
       8500 -- (-2423.147) [-2413.256] (-2420.402) (-2417.961) * (-2415.905) [-2415.643] (-2415.889) (-2422.097) -- 0:01:56
       9000 -- (-2424.778) (-2415.710) [-2422.691] (-2415.321) * (-2430.900) (-2418.905) [-2422.344] (-2413.197) -- 0:03:40
       9500 -- [-2419.191] (-2416.521) (-2415.086) (-2426.721) * [-2423.505] (-2417.965) (-2420.951) (-2417.352) -- 0:03:28
      10000 -- (-2417.251) [-2421.456] (-2417.706) (-2415.490) * (-2414.687) [-2415.419] (-2420.039) (-2418.372) -- 0:03:18

      Average standard deviation of split frequencies: 0.138896

      10500 -- (-2419.727) (-2420.887) [-2420.427] (-2415.951) * (-2425.701) (-2424.604) (-2416.077) [-2415.664] -- 0:03:08
      11000 -- [-2423.183] (-2413.783) (-2415.905) (-2424.226) * (-2424.332) (-2429.440) (-2419.761) [-2415.485] -- 0:02:59
      11500 -- [-2422.519] (-2411.194) (-2422.060) (-2419.143) * (-2424.147) (-2424.816) (-2426.080) [-2416.807] -- 0:02:51
      12000 -- [-2418.583] (-2411.724) (-2424.023) (-2423.157) * (-2417.742) (-2419.338) [-2418.710] (-2417.752) -- 0:02:44
      12500 -- (-2421.135) [-2418.300] (-2421.183) (-2425.131) * (-2417.915) [-2417.500] (-2421.763) (-2417.386) -- 0:02:38
      13000 -- (-2430.137) [-2415.505] (-2418.388) (-2418.863) * (-2422.909) [-2410.453] (-2418.941) (-2417.051) -- 0:02:31
      13500 -- (-2423.281) (-2429.155) [-2417.632] (-2420.175) * (-2421.248) [-2413.769] (-2422.265) (-2416.651) -- 0:02:26
      14000 -- [-2412.011] (-2434.451) (-2420.729) (-2415.885) * (-2423.011) (-2415.414) [-2421.849] (-2417.670) -- 0:02:20
      14500 -- (-2417.853) [-2425.365] (-2419.818) (-2415.993) * (-2419.723) (-2418.917) [-2416.932] (-2416.946) -- 0:02:15
      15000 -- (-2415.246) (-2424.812) (-2422.742) [-2420.780] * (-2418.581) (-2422.096) [-2414.581] (-2416.985) -- 0:03:17

      Average standard deviation of split frequencies: 0.123744

      15500 -- [-2418.244] (-2429.135) (-2417.183) (-2417.283) * (-2418.541) (-2417.304) (-2416.508) [-2412.074] -- 0:03:10
      16000 -- (-2425.590) (-2418.860) (-2416.171) [-2417.650] * (-2419.675) (-2418.983) (-2414.187) [-2416.600] -- 0:03:04
      16500 -- (-2415.985) (-2421.638) [-2419.128] (-2419.681) * (-2411.672) [-2417.102] (-2414.213) (-2416.584) -- 0:02:58
      17000 -- (-2421.573) (-2422.538) (-2417.068) [-2419.533] * [-2414.006] (-2417.759) (-2416.198) (-2419.511) -- 0:02:53
      17500 -- (-2422.374) (-2422.369) (-2425.102) [-2415.666] * (-2419.344) (-2419.964) [-2415.077] (-2418.097) -- 0:02:48
      18000 -- [-2426.004] (-2417.896) (-2420.418) (-2430.010) * [-2418.023] (-2414.442) (-2420.263) (-2418.112) -- 0:02:43
      18500 -- [-2420.296] (-2418.433) (-2425.156) (-2420.212) * [-2414.692] (-2415.912) (-2424.939) (-2421.995) -- 0:02:39
      19000 -- (-2418.024) [-2423.169] (-2419.683) (-2427.546) * (-2415.599) (-2429.238) (-2425.218) [-2421.204] -- 0:02:34
      19500 -- [-2420.938] (-2421.066) (-2424.790) (-2415.736) * (-2419.905) [-2423.826] (-2419.716) (-2421.575) -- 0:02:30
      20000 -- (-2418.305) (-2428.111) (-2422.773) [-2415.642] * (-2418.021) (-2414.542) (-2414.913) [-2418.158] -- 0:02:27

      Average standard deviation of split frequencies: 0.087438

      20500 -- (-2422.203) [-2416.647] (-2423.481) (-2419.751) * (-2416.933) (-2415.610) (-2417.997) [-2420.408] -- 0:02:23
      21000 -- (-2418.740) (-2418.018) [-2423.469] (-2417.483) * [-2414.753] (-2422.346) (-2416.773) (-2415.154) -- 0:03:06
      21500 -- (-2424.080) [-2417.731] (-2421.045) (-2424.707) * (-2413.351) (-2421.272) (-2423.192) [-2416.508] -- 0:03:02
      22000 -- (-2423.537) [-2414.759] (-2416.827) (-2412.971) * (-2418.050) [-2412.799] (-2422.552) (-2419.262) -- 0:02:57
      22500 -- (-2425.257) (-2413.714) (-2423.668) [-2418.948] * (-2422.545) (-2420.329) [-2422.725] (-2430.061) -- 0:02:53
      23000 -- (-2426.815) [-2413.011] (-2415.395) (-2422.613) * (-2420.783) [-2413.969] (-2427.029) (-2420.405) -- 0:02:49
      23500 -- [-2420.571] (-2415.033) (-2419.976) (-2418.222) * (-2421.746) (-2423.336) (-2429.230) [-2415.213] -- 0:02:46
      24000 -- (-2429.848) [-2416.132] (-2423.999) (-2417.318) * (-2417.203) (-2420.664) (-2425.774) [-2415.903] -- 0:02:42
      24500 -- (-2419.244) [-2414.346] (-2429.458) (-2424.062) * (-2418.401) [-2424.859] (-2415.281) (-2416.266) -- 0:02:39
      25000 -- (-2420.036) (-2416.140) [-2424.695] (-2419.682) * (-2417.081) [-2419.581] (-2418.713) (-2417.379) -- 0:02:36

      Average standard deviation of split frequencies: 0.072524

      25500 -- (-2429.407) [-2421.093] (-2419.806) (-2415.276) * (-2417.199) (-2425.931) (-2415.875) [-2417.111] -- 0:02:32
      26000 -- (-2421.196) [-2415.831] (-2426.026) (-2418.806) * [-2415.193] (-2419.284) (-2413.363) (-2418.328) -- 0:02:29
      26500 -- [-2420.490] (-2421.504) (-2421.816) (-2429.310) * [-2415.859] (-2416.556) (-2424.226) (-2421.934) -- 0:02:26
      27000 -- [-2419.390] (-2424.007) (-2426.125) (-2423.296) * (-2418.010) (-2415.388) [-2425.049] (-2418.306) -- 0:03:00
      27500 -- [-2412.746] (-2415.267) (-2418.506) (-2422.013) * [-2418.976] (-2413.592) (-2417.591) (-2420.580) -- 0:02:56
      28000 -- [-2414.662] (-2414.173) (-2421.310) (-2416.102) * [-2421.059] (-2422.960) (-2427.601) (-2416.671) -- 0:02:53
      28500 -- (-2416.240) [-2421.876] (-2415.380) (-2411.976) * (-2420.460) (-2424.769) [-2420.894] (-2418.036) -- 0:02:50
      29000 -- (-2414.118) (-2421.082) (-2413.236) [-2416.146] * (-2412.295) (-2420.700) (-2421.506) [-2419.648] -- 0:02:47
      29500 -- (-2415.011) [-2415.675] (-2421.150) (-2423.350) * [-2420.105] (-2420.843) (-2423.682) (-2425.188) -- 0:02:44
      30000 -- (-2415.974) (-2414.430) (-2416.743) [-2413.598] * [-2415.965] (-2425.023) (-2423.416) (-2418.850) -- 0:02:41

      Average standard deviation of split frequencies: 0.066612

      30500 -- (-2422.570) (-2423.122) (-2422.417) [-2418.255] * (-2417.285) (-2416.888) [-2419.078] (-2417.473) -- 0:02:38
      31000 -- (-2420.946) (-2415.460) (-2418.847) [-2414.212] * (-2422.678) (-2415.437) (-2418.543) [-2416.286] -- 0:02:36
      31500 -- (-2412.220) (-2417.426) [-2416.999] (-2420.528) * (-2416.840) (-2421.440) (-2416.507) [-2413.125] -- 0:02:33
      32000 -- (-2417.603) [-2416.497] (-2418.863) (-2426.243) * (-2417.609) (-2421.220) [-2417.944] (-2426.160) -- 0:02:31
      32500 -- [-2417.220] (-2418.785) (-2413.938) (-2422.414) * (-2420.448) (-2422.264) [-2418.387] (-2410.889) -- 0:02:28
      33000 -- (-2411.821) (-2422.408) (-2418.501) [-2410.900] * (-2419.402) (-2418.374) [-2413.691] (-2420.949) -- 0:02:55
      33500 -- (-2412.959) [-2416.409] (-2417.653) (-2417.744) * (-2421.950) [-2413.171] (-2413.253) (-2415.726) -- 0:02:53
      34000 -- (-2415.912) [-2423.824] (-2416.563) (-2420.729) * [-2419.023] (-2410.740) (-2417.104) (-2414.346) -- 0:02:50
      34500 -- (-2417.451) [-2414.328] (-2422.161) (-2418.149) * [-2419.610] (-2417.613) (-2432.546) (-2424.816) -- 0:02:47
      35000 -- (-2425.563) (-2413.719) (-2412.239) [-2416.815] * (-2425.798) (-2418.492) (-2421.200) [-2418.002] -- 0:02:45

      Average standard deviation of split frequencies: 0.069838

      35500 -- [-2421.904] (-2420.344) (-2416.178) (-2411.544) * (-2415.528) (-2419.000) (-2412.410) [-2414.065] -- 0:02:43
      36000 -- [-2415.025] (-2416.761) (-2427.238) (-2422.718) * [-2419.330] (-2420.221) (-2421.827) (-2415.644) -- 0:02:40
      36500 -- (-2417.107) [-2418.056] (-2421.857) (-2414.381) * [-2416.485] (-2414.403) (-2418.175) (-2416.357) -- 0:02:38
      37000 -- (-2419.198) (-2421.381) [-2420.761] (-2413.966) * [-2415.858] (-2421.272) (-2420.300) (-2419.689) -- 0:02:36
      37500 -- (-2421.197) (-2418.590) [-2414.844] (-2426.165) * (-2415.682) [-2417.006] (-2419.887) (-2424.719) -- 0:02:34
      38000 -- (-2417.647) [-2422.663] (-2417.979) (-2417.234) * (-2417.241) (-2416.872) (-2422.469) [-2422.334] -- 0:02:31
      38500 -- (-2420.836) [-2416.316] (-2425.466) (-2415.168) * (-2418.738) (-2426.436) (-2423.395) [-2414.733] -- 0:02:29
      39000 -- (-2428.305) (-2425.539) (-2418.210) [-2421.293] * (-2423.630) (-2422.973) (-2419.821) [-2416.237] -- 0:02:52
      39500 -- (-2418.286) (-2425.862) [-2418.055] (-2420.576) * (-2419.372) (-2421.579) (-2426.790) [-2420.595] -- 0:02:50
      40000 -- (-2423.565) (-2419.619) (-2415.996) [-2419.001] * (-2419.031) (-2425.289) (-2415.159) [-2416.994] -- 0:02:48

      Average standard deviation of split frequencies: 0.061824

      40500 -- (-2420.753) (-2420.133) (-2414.145) [-2409.639] * (-2417.781) (-2422.948) [-2419.079] (-2421.889) -- 0:02:45
      41000 -- (-2414.882) (-2427.054) (-2420.735) [-2417.845] * (-2420.659) [-2421.579] (-2417.112) (-2419.653) -- 0:02:43
      41500 -- [-2420.225] (-2418.847) (-2415.615) (-2433.736) * (-2415.570) (-2422.670) (-2419.957) [-2413.285] -- 0:02:41
      42000 -- (-2424.561) (-2421.770) [-2415.877] (-2419.830) * (-2421.789) (-2423.242) [-2417.493] (-2424.795) -- 0:02:39
      42500 -- (-2417.039) [-2429.868] (-2418.214) (-2424.167) * (-2421.687) (-2422.181) [-2421.224] (-2414.330) -- 0:02:37
      43000 -- (-2420.140) [-2421.792] (-2418.743) (-2418.703) * (-2422.465) [-2414.304] (-2415.379) (-2426.821) -- 0:02:35
      43500 -- (-2417.609) (-2417.973) (-2419.874) [-2423.903] * (-2429.917) (-2415.705) [-2418.669] (-2410.185) -- 0:02:33
      44000 -- (-2415.086) (-2419.039) [-2417.814] (-2416.592) * (-2422.124) [-2414.636] (-2418.157) (-2422.531) -- 0:02:32
      44500 -- (-2414.494) (-2425.441) (-2417.937) [-2416.297] * (-2417.399) (-2419.688) (-2419.506) [-2416.628] -- 0:02:30
      45000 -- (-2412.838) (-2416.261) (-2414.162) [-2417.523] * (-2422.021) (-2423.531) (-2421.667) [-2413.760] -- 0:02:49

      Average standard deviation of split frequencies: 0.053289

      45500 -- (-2414.941) [-2414.619] (-2414.061) (-2424.247) * (-2419.835) (-2417.115) [-2417.807] (-2416.828) -- 0:02:47
      46000 -- (-2417.457) (-2424.870) (-2416.969) [-2419.299] * (-2414.010) [-2424.115] (-2422.344) (-2410.284) -- 0:02:45
      46500 -- (-2422.800) (-2429.341) [-2412.545] (-2422.680) * (-2417.163) (-2434.479) (-2420.793) [-2410.668] -- 0:02:44
      47000 -- [-2413.707] (-2415.505) (-2414.693) (-2425.811) * (-2417.156) (-2421.430) [-2417.459] (-2418.902) -- 0:02:42
      47500 -- (-2414.412) (-2425.219) [-2414.416] (-2417.024) * (-2416.257) [-2414.436] (-2418.861) (-2418.300) -- 0:02:40
      48000 -- (-2412.887) [-2426.015] (-2416.110) (-2428.826) * (-2420.192) [-2416.690] (-2420.490) (-2425.196) -- 0:02:38
      48500 -- (-2423.719) [-2415.421] (-2417.445) (-2424.513) * [-2420.364] (-2425.200) (-2417.954) (-2422.532) -- 0:02:36
      49000 -- (-2422.115) (-2417.509) (-2416.922) [-2420.123] * (-2421.310) (-2424.992) [-2413.239] (-2420.626) -- 0:02:35
      49500 -- (-2425.907) (-2420.821) [-2416.069] (-2419.918) * [-2413.145] (-2418.205) (-2412.626) (-2422.040) -- 0:02:33
      50000 -- (-2434.169) [-2415.435] (-2414.179) (-2419.105) * [-2413.704] (-2419.945) (-2423.561) (-2422.939) -- 0:02:32

      Average standard deviation of split frequencies: 0.046520

      50500 -- (-2431.564) (-2423.063) [-2415.969] (-2418.639) * (-2421.718) (-2424.128) [-2418.541] (-2414.626) -- 0:02:30
      51000 -- (-2431.143) (-2420.182) [-2413.401] (-2418.462) * (-2420.999) [-2414.962] (-2418.282) (-2421.204) -- 0:02:47
      51500 -- (-2437.682) (-2416.144) [-2414.881] (-2419.179) * (-2425.190) (-2416.013) [-2413.957] (-2419.128) -- 0:02:45
      52000 -- (-2425.617) (-2416.228) (-2411.698) [-2421.599] * (-2426.735) (-2421.091) (-2416.613) [-2421.126] -- 0:02:44
      52500 -- (-2418.162) (-2414.493) [-2418.477] (-2419.044) * [-2419.112] (-2416.986) (-2427.818) (-2420.861) -- 0:02:42
      53000 -- [-2420.740] (-2418.302) (-2418.647) (-2429.527) * (-2415.128) (-2416.990) [-2420.050] (-2420.740) -- 0:02:40
      53500 -- (-2420.660) (-2422.299) [-2416.337] (-2421.052) * (-2416.270) [-2418.282] (-2421.671) (-2423.460) -- 0:02:39
      54000 -- [-2420.281] (-2419.421) (-2425.641) (-2421.023) * [-2416.651] (-2422.967) (-2422.217) (-2419.443) -- 0:02:37
      54500 -- (-2426.708) (-2419.733) [-2414.142] (-2422.771) * (-2416.766) (-2412.313) [-2420.235] (-2425.127) -- 0:02:36
      55000 -- [-2419.367] (-2418.961) (-2414.866) (-2418.207) * (-2423.663) (-2417.258) (-2422.417) [-2417.500] -- 0:02:34

      Average standard deviation of split frequencies: 0.042090

      55500 -- (-2415.806) (-2418.791) (-2419.428) [-2420.221] * (-2419.334) (-2414.774) [-2421.906] (-2417.454) -- 0:02:33
      56000 -- (-2418.286) [-2420.046] (-2419.904) (-2415.495) * (-2416.056) (-2418.608) (-2417.614) [-2413.625] -- 0:02:31
      56500 -- (-2419.607) (-2420.525) [-2416.730] (-2416.892) * [-2422.347] (-2419.292) (-2426.728) (-2424.808) -- 0:02:30
      57000 -- (-2422.296) [-2413.299] (-2426.850) (-2419.461) * (-2417.289) (-2416.401) [-2420.961] (-2419.554) -- 0:02:45
      57500 -- [-2415.294] (-2419.582) (-2416.067) (-2422.472) * (-2424.904) (-2418.362) (-2425.762) [-2412.637] -- 0:02:43
      58000 -- (-2414.143) [-2425.625] (-2414.030) (-2421.090) * (-2415.503) (-2414.609) (-2420.738) [-2416.379] -- 0:02:42
      58500 -- (-2418.474) [-2417.334] (-2417.315) (-2419.924) * (-2413.954) (-2421.303) [-2418.286] (-2414.591) -- 0:02:40
      59000 -- (-2418.786) (-2418.623) (-2416.943) [-2416.895] * [-2418.936] (-2427.804) (-2417.776) (-2420.979) -- 0:02:39
      59500 -- (-2415.986) (-2421.452) (-2423.206) [-2423.761] * (-2418.224) (-2421.812) [-2419.969] (-2423.176) -- 0:02:38
      60000 -- (-2418.599) (-2424.124) [-2419.351] (-2420.500) * (-2421.076) (-2424.140) (-2426.638) [-2416.850] -- 0:02:36

      Average standard deviation of split frequencies: 0.040406

      60500 -- [-2413.554] (-2422.149) (-2421.181) (-2422.307) * (-2416.176) (-2419.643) (-2423.015) [-2413.340] -- 0:02:35
      61000 -- (-2417.199) (-2425.306) [-2417.692] (-2424.156) * (-2415.735) [-2417.569] (-2418.301) (-2420.188) -- 0:02:33
      61500 -- (-2419.169) (-2426.346) (-2413.240) [-2415.896] * (-2416.350) (-2419.057) (-2418.511) [-2417.664] -- 0:02:32
      62000 -- (-2414.479) (-2422.964) (-2421.029) [-2420.668] * (-2413.704) (-2422.245) [-2420.787] (-2420.847) -- 0:02:31
      62500 -- (-2420.441) (-2417.481) (-2416.580) [-2421.865] * [-2418.736] (-2417.861) (-2419.385) (-2413.623) -- 0:02:45
      63000 -- (-2418.493) (-2418.002) [-2419.335] (-2420.410) * [-2414.845] (-2424.876) (-2414.827) (-2420.320) -- 0:02:43
      63500 -- (-2415.645) [-2410.748] (-2417.802) (-2416.054) * (-2412.477) [-2419.303] (-2424.772) (-2419.128) -- 0:02:42
      64000 -- (-2424.436) [-2418.074] (-2418.509) (-2421.305) * (-2424.522) [-2420.862] (-2421.426) (-2416.092) -- 0:02:40
      64500 -- [-2413.628] (-2415.439) (-2411.540) (-2414.094) * [-2415.755] (-2416.714) (-2413.723) (-2416.281) -- 0:02:39
      65000 -- [-2416.441] (-2416.758) (-2415.527) (-2422.471) * (-2419.016) (-2414.261) (-2420.593) [-2419.224] -- 0:02:38

      Average standard deviation of split frequencies: 0.038569

      65500 -- (-2435.346) [-2421.835] (-2417.941) (-2418.959) * (-2414.740) (-2422.833) (-2417.223) [-2416.780] -- 0:02:36
      66000 -- (-2420.217) (-2418.037) [-2418.917] (-2416.711) * (-2420.709) (-2413.997) (-2427.236) [-2418.771] -- 0:02:35
      66500 -- (-2416.154) (-2424.189) (-2416.406) [-2411.486] * [-2413.104] (-2426.026) (-2416.773) (-2427.141) -- 0:02:34
      67000 -- (-2420.104) (-2424.067) (-2421.980) [-2416.694] * (-2414.581) (-2420.345) [-2418.438] (-2429.737) -- 0:02:33
      67500 -- (-2429.129) [-2418.916] (-2415.908) (-2414.737) * (-2420.413) [-2416.677] (-2415.009) (-2423.401) -- 0:02:31
      68000 -- (-2427.528) (-2412.917) [-2417.084] (-2416.658) * (-2424.038) [-2415.455] (-2418.180) (-2423.401) -- 0:02:44
      68500 -- (-2436.137) [-2416.494] (-2423.921) (-2419.563) * [-2416.808] (-2423.992) (-2420.991) (-2420.750) -- 0:02:43
      69000 -- (-2428.213) (-2422.781) [-2426.506] (-2412.606) * [-2418.753] (-2412.870) (-2413.993) (-2427.218) -- 0:02:41
      69500 -- (-2424.185) (-2412.624) (-2418.133) [-2415.531] * (-2414.837) (-2414.124) [-2417.267] (-2421.154) -- 0:02:40
      70000 -- (-2423.463) (-2419.783) [-2417.986] (-2421.518) * (-2416.877) [-2417.105] (-2413.560) (-2417.377) -- 0:02:39

      Average standard deviation of split frequencies: 0.035578

      70500 -- (-2421.607) [-2417.230] (-2420.752) (-2422.777) * [-2417.049] (-2419.462) (-2419.317) (-2418.295) -- 0:02:38
      71000 -- [-2421.375] (-2420.951) (-2421.404) (-2420.142) * (-2413.106) (-2420.505) [-2420.546] (-2416.478) -- 0:02:37
      71500 -- (-2421.922) [-2421.725] (-2423.289) (-2414.425) * (-2419.932) [-2410.813] (-2420.647) (-2420.141) -- 0:02:35
      72000 -- [-2421.226] (-2414.088) (-2415.684) (-2420.845) * (-2419.266) [-2418.619] (-2429.812) (-2412.919) -- 0:02:34
      72500 -- (-2418.207) (-2416.130) (-2425.143) [-2416.142] * (-2416.466) [-2413.627] (-2412.284) (-2413.427) -- 0:02:33
      73000 -- (-2427.198) (-2427.081) [-2420.745] (-2420.508) * (-2416.529) (-2422.106) (-2419.235) [-2418.387] -- 0:02:32
      73500 -- (-2419.580) (-2418.956) (-2416.389) [-2416.383] * (-2414.861) (-2422.680) [-2416.352] (-2418.512) -- 0:02:43
      74000 -- (-2417.103) [-2412.932] (-2421.162) (-2426.127) * [-2413.819] (-2424.969) (-2416.328) (-2424.057) -- 0:02:42
      74500 -- (-2415.960) (-2416.199) [-2412.642] (-2418.482) * (-2414.115) [-2415.071] (-2415.591) (-2417.481) -- 0:02:41
      75000 -- (-2416.978) (-2415.090) [-2421.016] (-2422.248) * [-2413.551] (-2416.171) (-2422.543) (-2418.245) -- 0:02:40

      Average standard deviation of split frequencies: 0.034115

      75500 -- (-2421.425) (-2424.833) (-2418.454) [-2414.819] * [-2415.447] (-2419.417) (-2420.735) (-2422.956) -- 0:02:39
      76000 -- (-2422.988) [-2422.738] (-2414.068) (-2414.079) * (-2413.801) (-2422.614) [-2419.272] (-2421.594) -- 0:02:38
      76500 -- [-2421.380] (-2421.683) (-2417.321) (-2418.619) * [-2415.671] (-2430.305) (-2413.614) (-2412.544) -- 0:02:36
      77000 -- (-2425.224) (-2421.484) [-2414.638] (-2419.241) * (-2417.145) (-2425.191) [-2415.353] (-2419.674) -- 0:02:35
      77500 -- (-2419.900) [-2431.752] (-2408.849) (-2412.500) * [-2418.489] (-2423.544) (-2419.095) (-2418.765) -- 0:02:34
      78000 -- (-2423.831) (-2420.890) (-2412.385) [-2417.829] * (-2415.919) (-2424.709) (-2419.580) [-2420.919] -- 0:02:33
      78500 -- (-2422.524) (-2415.271) (-2417.246) [-2420.226] * (-2417.398) (-2422.710) [-2418.529] (-2427.471) -- 0:02:32
      79000 -- (-2417.658) (-2415.624) (-2419.472) [-2417.374] * (-2417.407) [-2417.146] (-2415.722) (-2415.414) -- 0:02:31
      79500 -- (-2416.632) [-2421.237] (-2415.386) (-2421.560) * (-2419.836) (-2418.271) (-2422.375) [-2415.110] -- 0:02:42
      80000 -- (-2429.422) [-2415.363] (-2419.999) (-2421.151) * (-2424.184) (-2419.785) (-2414.818) [-2416.515] -- 0:02:41

      Average standard deviation of split frequencies: 0.028051

      80500 -- [-2417.334] (-2432.355) (-2426.935) (-2421.982) * (-2417.125) [-2420.287] (-2424.733) (-2418.788) -- 0:02:39
      81000 -- (-2418.241) (-2415.303) [-2423.603] (-2416.896) * (-2416.496) (-2418.179) [-2419.780] (-2419.075) -- 0:02:38
      81500 -- [-2423.886] (-2420.361) (-2429.749) (-2431.332) * (-2423.208) (-2419.602) (-2417.629) [-2418.302] -- 0:02:37
      82000 -- (-2419.619) (-2417.806) [-2415.292] (-2420.769) * [-2419.213] (-2429.279) (-2420.490) (-2416.017) -- 0:02:36
      82500 -- (-2418.570) (-2418.816) [-2415.254] (-2414.993) * (-2422.725) [-2418.424] (-2419.234) (-2422.405) -- 0:02:35
      83000 -- (-2421.782) [-2418.875] (-2421.006) (-2413.797) * [-2416.707] (-2411.511) (-2414.603) (-2424.387) -- 0:02:34
      83500 -- (-2422.786) (-2420.564) (-2421.529) [-2414.708] * (-2419.603) (-2414.693) [-2420.028] (-2421.918) -- 0:02:33
      84000 -- (-2421.588) [-2414.366] (-2422.614) (-2423.848) * (-2420.081) [-2417.277] (-2426.885) (-2422.541) -- 0:02:32
      84500 -- (-2415.349) [-2415.654] (-2415.379) (-2425.581) * (-2420.799) (-2415.564) [-2419.766] (-2418.170) -- 0:02:31
      85000 -- (-2424.352) (-2417.839) (-2417.371) [-2414.463] * (-2416.305) (-2415.534) (-2422.608) [-2415.281] -- 0:02:30

      Average standard deviation of split frequencies: 0.024118

      85500 -- (-2416.638) (-2418.366) [-2416.929] (-2422.342) * (-2412.990) [-2422.904] (-2418.874) (-2426.215) -- 0:02:40
      86000 -- (-2421.273) (-2418.745) (-2422.485) [-2414.897] * [-2422.927] (-2414.338) (-2418.490) (-2418.539) -- 0:02:39
      86500 -- (-2426.760) (-2425.673) [-2418.454] (-2415.694) * [-2416.287] (-2414.515) (-2423.221) (-2418.797) -- 0:02:38
      87000 -- (-2415.460) [-2426.643] (-2427.738) (-2421.443) * [-2417.057] (-2421.880) (-2419.096) (-2420.926) -- 0:02:37
      87500 -- [-2421.615] (-2420.283) (-2422.029) (-2414.507) * [-2418.064] (-2425.148) (-2420.996) (-2416.056) -- 0:02:36
      88000 -- (-2417.019) [-2418.260] (-2428.614) (-2418.373) * [-2417.650] (-2417.064) (-2419.300) (-2423.763) -- 0:02:35
      88500 -- (-2418.375) (-2414.081) (-2423.304) [-2422.659] * [-2421.030] (-2418.188) (-2422.921) (-2413.599) -- 0:02:34
      89000 -- (-2423.204) (-2413.210) (-2421.531) [-2418.905] * (-2416.883) [-2416.912] (-2418.770) (-2421.806) -- 0:02:33
      89500 -- (-2415.646) [-2415.638] (-2420.466) (-2414.616) * (-2417.816) (-2424.605) [-2410.342] (-2419.760) -- 0:02:32
      90000 -- (-2415.424) (-2415.125) (-2414.408) [-2415.566] * (-2417.061) (-2423.034) (-2421.861) [-2416.415] -- 0:02:31

      Average standard deviation of split frequencies: 0.020797

      90500 -- (-2420.630) [-2415.678] (-2414.813) (-2414.200) * [-2423.275] (-2425.806) (-2415.269) (-2417.709) -- 0:02:30
      91000 -- (-2425.615) (-2416.381) [-2414.357] (-2423.809) * [-2423.723] (-2417.261) (-2427.038) (-2417.658) -- 0:02:29
      91500 -- (-2420.582) (-2414.869) (-2424.446) [-2416.684] * (-2422.059) (-2427.301) (-2430.592) [-2430.030] -- 0:02:38
      92000 -- (-2415.328) [-2418.674] (-2422.886) (-2423.619) * [-2422.286] (-2424.438) (-2415.177) (-2429.447) -- 0:02:37
      92500 -- (-2424.996) (-2419.256) (-2414.436) [-2413.688] * (-2419.960) (-2419.111) (-2417.869) [-2419.862] -- 0:02:36
      93000 -- (-2416.293) (-2418.534) [-2416.866] (-2415.993) * (-2419.180) (-2425.036) (-2417.756) [-2412.386] -- 0:02:36
      93500 -- [-2419.684] (-2419.691) (-2419.882) (-2416.807) * (-2424.183) [-2415.610] (-2423.586) (-2420.958) -- 0:02:35
      94000 -- (-2418.139) (-2421.075) (-2419.465) [-2415.091] * (-2419.393) (-2414.030) [-2419.473] (-2417.096) -- 0:02:34
      94500 -- (-2418.172) (-2422.333) (-2422.584) [-2412.251] * (-2420.186) (-2423.463) [-2424.856] (-2419.307) -- 0:02:33
      95000 -- [-2413.157] (-2421.380) (-2414.772) (-2420.795) * (-2419.988) (-2421.842) [-2413.973] (-2418.085) -- 0:02:32

      Average standard deviation of split frequencies: 0.022097

      95500 -- (-2422.941) (-2420.817) (-2418.805) [-2422.342] * (-2424.288) [-2415.448] (-2421.462) (-2419.923) -- 0:02:31
      96000 -- [-2417.272] (-2430.460) (-2419.657) (-2414.183) * (-2424.218) (-2415.904) [-2418.764] (-2417.317) -- 0:02:30
      96500 -- (-2419.805) (-2414.888) (-2421.834) [-2421.745] * (-2424.106) (-2418.549) (-2418.563) [-2420.832] -- 0:02:29
      97000 -- (-2418.856) [-2416.826] (-2416.149) (-2423.586) * (-2427.846) (-2419.146) [-2420.696] (-2418.257) -- 0:02:28
      97500 -- [-2419.954] (-2423.022) (-2418.349) (-2420.814) * (-2417.617) (-2432.247) [-2427.182] (-2421.214) -- 0:02:37
      98000 -- (-2432.447) [-2418.782] (-2420.474) (-2413.715) * (-2421.854) (-2419.750) [-2417.118] (-2418.200) -- 0:02:36
      98500 -- [-2423.620] (-2419.087) (-2420.302) (-2418.409) * (-2417.190) [-2417.555] (-2418.040) (-2417.865) -- 0:02:35
      99000 -- (-2417.841) (-2416.969) [-2414.236] (-2425.192) * [-2417.854] (-2414.359) (-2424.190) (-2427.304) -- 0:02:34
      99500 -- (-2415.458) (-2416.384) [-2416.379] (-2425.318) * [-2422.023] (-2419.138) (-2418.469) (-2424.774) -- 0:02:33
      100000 -- (-2420.306) [-2415.156] (-2419.456) (-2415.732) * [-2417.928] (-2419.266) (-2420.572) (-2422.602) -- 0:02:33

      Average standard deviation of split frequencies: 0.025756

      100500 -- (-2425.243) (-2419.642) [-2424.345] (-2418.664) * (-2415.782) (-2422.013) (-2417.170) [-2421.754] -- 0:02:32
      101000 -- (-2425.657) (-2425.679) (-2415.363) [-2417.136] * [-2416.445] (-2420.196) (-2416.140) (-2419.866) -- 0:02:31
      101500 -- (-2421.094) (-2427.353) (-2423.880) [-2417.141] * (-2419.768) (-2420.621) (-2415.078) [-2417.492] -- 0:02:30
      102000 -- (-2419.060) (-2412.101) (-2420.702) [-2421.866] * (-2431.311) (-2420.992) (-2420.985) [-2414.976] -- 0:02:29
      102500 -- (-2427.281) [-2414.998] (-2424.251) (-2425.440) * [-2416.333] (-2424.856) (-2420.955) (-2420.940) -- 0:02:28
      103000 -- [-2415.986] (-2415.167) (-2421.468) (-2427.059) * [-2414.760] (-2420.489) (-2415.709) (-2418.878) -- 0:02:28
      103500 -- [-2419.043] (-2418.321) (-2421.238) (-2421.738) * [-2421.909] (-2425.646) (-2415.749) (-2416.067) -- 0:02:35
      104000 -- (-2417.840) (-2416.483) [-2417.358] (-2422.944) * [-2420.187] (-2412.218) (-2420.547) (-2419.171) -- 0:02:35
      104500 -- [-2415.511] (-2418.955) (-2421.418) (-2419.432) * (-2420.691) (-2417.483) (-2422.219) [-2417.034] -- 0:02:34
      105000 -- (-2419.343) (-2418.018) [-2414.977] (-2416.489) * [-2420.018] (-2416.700) (-2422.974) (-2426.143) -- 0:02:33

      Average standard deviation of split frequencies: 0.021347

      105500 -- (-2414.576) (-2423.156) (-2419.871) [-2420.687] * [-2419.319] (-2417.586) (-2411.051) (-2418.673) -- 0:02:32
      106000 -- (-2412.435) (-2417.567) [-2417.269] (-2420.375) * [-2417.643] (-2420.747) (-2413.007) (-2423.931) -- 0:02:31
      106500 -- [-2414.737] (-2422.546) (-2414.131) (-2421.531) * (-2419.698) (-2422.068) [-2412.866] (-2425.470) -- 0:02:31
      107000 -- [-2412.365] (-2416.067) (-2412.789) (-2427.697) * (-2419.594) (-2430.115) (-2420.042) [-2419.185] -- 0:02:30
      107500 -- [-2418.043] (-2417.283) (-2414.545) (-2426.474) * (-2418.024) (-2424.667) (-2420.732) [-2415.332] -- 0:02:29
      108000 -- (-2415.014) (-2414.738) [-2419.260] (-2419.316) * (-2419.416) (-2429.149) [-2415.106] (-2417.392) -- 0:02:28
      108500 -- (-2416.228) [-2414.262] (-2421.860) (-2422.766) * [-2418.119] (-2429.595) (-2422.007) (-2424.979) -- 0:02:27
      109000 -- [-2416.335] (-2418.792) (-2419.249) (-2415.503) * (-2418.329) (-2418.919) [-2416.531] (-2416.294) -- 0:02:35
      109500 -- (-2422.875) (-2418.757) (-2422.103) [-2409.869] * (-2422.893) (-2417.781) (-2416.807) [-2423.079] -- 0:02:34
      110000 -- [-2425.874] (-2419.629) (-2422.764) (-2417.702) * (-2421.018) (-2420.757) (-2417.401) [-2416.963] -- 0:02:33

      Average standard deviation of split frequencies: 0.023002

      110500 -- (-2422.421) [-2418.464] (-2420.889) (-2417.400) * (-2423.019) [-2419.399] (-2415.683) (-2417.171) -- 0:02:32
      111000 -- [-2418.636] (-2417.511) (-2430.656) (-2416.239) * (-2423.954) (-2420.402) [-2415.208] (-2421.476) -- 0:02:32
      111500 -- (-2414.611) (-2421.014) (-2424.014) [-2412.088] * [-2420.223] (-2413.579) (-2423.649) (-2422.207) -- 0:02:31
      112000 -- [-2412.187] (-2414.976) (-2424.820) (-2416.720) * (-2420.787) (-2416.352) (-2421.989) [-2422.059] -- 0:02:30
      112500 -- [-2413.810] (-2419.631) (-2427.336) (-2421.623) * (-2430.158) [-2417.518] (-2421.962) (-2417.689) -- 0:02:29
      113000 -- [-2412.732] (-2418.348) (-2423.824) (-2414.910) * (-2424.076) (-2422.560) (-2417.402) [-2422.626] -- 0:02:29
      113500 -- (-2415.879) (-2416.809) (-2420.370) [-2415.153] * [-2420.340] (-2421.043) (-2421.660) (-2425.336) -- 0:02:28
      114000 -- (-2414.472) (-2419.328) (-2419.960) [-2424.736] * (-2419.135) (-2413.452) (-2413.815) [-2423.343] -- 0:02:27
      114500 -- (-2422.472) (-2423.261) (-2419.329) [-2419.310] * [-2416.372] (-2419.730) (-2423.339) (-2417.900) -- 0:02:26
      115000 -- (-2424.995) (-2427.869) (-2423.180) [-2411.173] * [-2414.651] (-2420.125) (-2422.803) (-2417.163) -- 0:02:33

      Average standard deviation of split frequencies: 0.020319

      115500 -- (-2429.851) [-2422.321] (-2423.657) (-2419.329) * [-2413.104] (-2415.697) (-2422.805) (-2421.870) -- 0:02:33
      116000 -- (-2416.529) (-2415.248) [-2427.141] (-2422.775) * [-2418.536] (-2416.428) (-2418.250) (-2424.013) -- 0:02:32
      116500 -- [-2419.672] (-2417.600) (-2418.906) (-2427.275) * (-2421.397) [-2417.446] (-2414.668) (-2413.671) -- 0:02:31
      117000 -- (-2412.319) [-2422.032] (-2426.870) (-2428.617) * (-2420.211) (-2418.563) [-2413.843] (-2418.010) -- 0:02:30
      117500 -- (-2419.571) [-2420.635] (-2414.388) (-2419.388) * (-2417.289) [-2418.836] (-2416.132) (-2422.494) -- 0:02:30
      118000 -- [-2417.329] (-2417.044) (-2423.636) (-2423.510) * (-2424.824) (-2430.126) [-2418.263] (-2419.381) -- 0:02:29
      118500 -- [-2417.981] (-2424.407) (-2421.966) (-2417.751) * (-2415.802) (-2427.128) [-2415.616] (-2419.374) -- 0:02:28
      119000 -- (-2422.603) [-2420.104] (-2420.493) (-2417.617) * (-2421.581) (-2421.264) [-2417.666] (-2426.086) -- 0:02:28
      119500 -- (-2423.770) [-2417.733] (-2425.355) (-2417.447) * (-2416.755) (-2418.773) [-2419.501] (-2417.661) -- 0:02:27
      120000 -- [-2416.507] (-2428.987) (-2416.105) (-2422.692) * (-2424.379) (-2420.490) (-2418.501) [-2419.065] -- 0:02:26

      Average standard deviation of split frequencies: 0.017580

      120500 -- [-2417.568] (-2424.924) (-2419.501) (-2415.137) * (-2423.625) (-2414.653) [-2416.116] (-2411.848) -- 0:02:25
      121000 -- (-2420.986) [-2420.392] (-2424.884) (-2416.595) * [-2416.679] (-2414.004) (-2418.608) (-2419.892) -- 0:02:25
      121500 -- (-2418.016) (-2422.582) (-2418.398) [-2417.366] * (-2416.346) (-2418.130) (-2424.770) [-2418.593] -- 0:02:31
      122000 -- (-2421.881) (-2410.935) (-2417.207) [-2426.614] * [-2427.364] (-2417.515) (-2424.391) (-2414.664) -- 0:02:31
      122500 -- (-2422.216) [-2413.128] (-2422.763) (-2416.874) * [-2418.072] (-2426.823) (-2419.989) (-2419.399) -- 0:02:30
      123000 -- (-2422.027) [-2421.291] (-2419.485) (-2418.297) * (-2415.955) (-2425.428) (-2417.315) [-2416.410] -- 0:02:29
      123500 -- (-2417.368) (-2423.856) (-2425.745) [-2415.087] * (-2420.074) [-2418.022] (-2415.747) (-2418.170) -- 0:02:29
      124000 -- (-2411.535) (-2430.045) (-2420.699) [-2422.871] * (-2419.773) (-2426.950) (-2424.991) [-2419.952] -- 0:02:28
      124500 -- (-2414.299) [-2415.213] (-2422.727) (-2425.538) * (-2415.483) [-2414.557] (-2420.213) (-2421.064) -- 0:02:27
      125000 -- (-2416.995) [-2418.531] (-2422.883) (-2419.368) * (-2413.354) [-2415.392] (-2422.894) (-2415.168) -- 0:02:27

      Average standard deviation of split frequencies: 0.014965

      125500 -- (-2420.424) (-2420.588) (-2423.267) [-2416.224] * (-2414.174) (-2427.637) (-2416.850) [-2413.745] -- 0:02:26
      126000 -- [-2413.957] (-2419.099) (-2414.877) (-2421.925) * (-2412.451) (-2419.675) (-2418.049) [-2419.719] -- 0:02:25
      126500 -- (-2418.304) (-2417.937) [-2414.908] (-2414.031) * [-2411.752] (-2420.630) (-2426.196) (-2419.733) -- 0:02:25
      127000 -- [-2417.317] (-2422.849) (-2420.134) (-2415.603) * (-2418.498) (-2418.659) (-2427.012) [-2415.729] -- 0:02:24
      127500 -- (-2420.855) (-2418.307) (-2425.871) [-2415.462] * [-2417.728] (-2422.324) (-2420.142) (-2416.258) -- 0:02:30
      128000 -- (-2422.395) [-2418.522] (-2420.759) (-2430.724) * (-2412.734) [-2425.309] (-2423.861) (-2429.995) -- 0:02:29
      128500 -- [-2419.077] (-2419.392) (-2421.083) (-2422.043) * (-2417.372) (-2417.686) [-2422.144] (-2419.822) -- 0:02:29
      129000 -- (-2421.818) (-2426.566) (-2428.404) [-2425.077] * [-2419.384] (-2417.310) (-2415.570) (-2419.494) -- 0:02:28
      129500 -- [-2422.798] (-2414.216) (-2422.205) (-2423.046) * (-2416.183) (-2419.539) [-2415.586] (-2420.160) -- 0:02:27
      130000 -- (-2423.005) (-2422.444) [-2418.567] (-2426.612) * (-2418.175) (-2426.927) [-2420.048] (-2425.407) -- 0:02:27

      Average standard deviation of split frequencies: 0.015333

      130500 -- (-2431.360) [-2420.906] (-2419.653) (-2419.820) * (-2418.602) (-2420.820) [-2423.566] (-2416.648) -- 0:02:26
      131000 -- (-2420.662) (-2418.329) (-2422.653) [-2414.858] * (-2416.288) (-2423.840) [-2417.394] (-2416.939) -- 0:02:25
      131500 -- (-2415.874) (-2413.810) (-2429.618) [-2418.360] * [-2415.747] (-2415.379) (-2417.206) (-2428.900) -- 0:02:25
      132000 -- (-2421.757) (-2417.620) (-2421.235) [-2417.037] * (-2421.612) [-2418.540] (-2415.298) (-2416.918) -- 0:02:24
      132500 -- (-2423.217) (-2431.117) [-2412.339] (-2416.958) * (-2423.705) [-2415.316] (-2427.537) (-2415.463) -- 0:02:24
      133000 -- [-2424.401] (-2417.380) (-2417.837) (-2422.385) * (-2422.113) (-2416.809) (-2414.977) [-2418.592] -- 0:02:23
      133500 -- (-2414.444) [-2412.341] (-2416.864) (-2415.972) * (-2422.477) (-2424.627) [-2419.730] (-2417.357) -- 0:02:29
      134000 -- (-2431.400) (-2420.732) [-2419.801] (-2420.295) * [-2414.164] (-2419.767) (-2416.362) (-2417.684) -- 0:02:28
      134500 -- (-2419.476) (-2424.189) (-2410.703) [-2418.384] * (-2422.942) (-2420.413) [-2419.223] (-2418.521) -- 0:02:28
      135000 -- (-2425.096) [-2417.809] (-2421.629) (-2415.779) * (-2417.070) [-2412.751] (-2418.692) (-2415.545) -- 0:02:27

      Average standard deviation of split frequencies: 0.018198

      135500 -- [-2421.299] (-2420.455) (-2418.736) (-2418.977) * (-2419.725) (-2415.619) (-2420.349) [-2417.034] -- 0:02:26
      136000 -- (-2420.449) [-2414.643] (-2417.615) (-2416.673) * [-2415.379] (-2426.682) (-2425.190) (-2419.352) -- 0:02:26
      136500 -- [-2417.881] (-2422.063) (-2413.981) (-2412.162) * (-2424.749) (-2428.902) (-2418.779) [-2421.181] -- 0:02:25
      137000 -- [-2414.762] (-2423.624) (-2423.102) (-2413.797) * (-2417.232) (-2419.382) (-2418.996) [-2423.708] -- 0:02:24
      137500 -- (-2420.954) (-2419.444) [-2420.096] (-2421.190) * [-2420.024] (-2418.319) (-2417.593) (-2415.524) -- 0:02:24
      138000 -- [-2416.187] (-2422.863) (-2418.112) (-2426.633) * (-2422.150) (-2423.195) (-2414.679) [-2420.945] -- 0:02:23
      138500 -- (-2421.560) (-2424.205) [-2413.960] (-2423.084) * [-2412.722] (-2421.723) (-2415.175) (-2418.751) -- 0:02:23
      139000 -- (-2422.607) [-2413.875] (-2421.522) (-2418.083) * (-2416.581) (-2428.209) [-2413.304] (-2419.954) -- 0:02:22
      139500 -- (-2413.453) [-2417.036] (-2418.062) (-2422.046) * (-2417.165) [-2414.901] (-2416.804) (-2418.824) -- 0:02:21
      140000 -- (-2420.889) (-2423.596) (-2413.398) [-2419.338] * [-2423.254] (-2419.634) (-2417.385) (-2412.791) -- 0:02:27

      Average standard deviation of split frequencies: 0.021783

      140500 -- (-2422.348) (-2423.975) (-2422.856) [-2420.101] * [-2419.269] (-2415.701) (-2416.512) (-2420.574) -- 0:02:26
      141000 -- (-2420.264) [-2423.053] (-2416.363) (-2420.778) * (-2420.924) [-2414.966] (-2421.752) (-2420.589) -- 0:02:26
      141500 -- (-2421.366) (-2419.970) (-2417.819) [-2417.119] * [-2414.885] (-2419.424) (-2415.621) (-2418.607) -- 0:02:25
      142000 -- (-2422.887) (-2423.227) [-2419.700] (-2420.744) * [-2415.917] (-2415.592) (-2413.797) (-2417.986) -- 0:02:25
      142500 -- [-2421.021] (-2424.380) (-2421.661) (-2426.467) * (-2416.054) [-2418.481] (-2417.735) (-2420.024) -- 0:02:24
      143000 -- (-2422.298) (-2425.615) [-2413.137] (-2415.758) * (-2422.718) (-2426.045) (-2424.812) [-2420.784] -- 0:02:23
      143500 -- (-2421.394) (-2418.904) [-2418.019] (-2416.257) * (-2417.529) [-2417.304] (-2421.956) (-2422.101) -- 0:02:23
      144000 -- (-2425.211) (-2418.052) [-2412.604] (-2415.980) * (-2422.749) (-2418.948) [-2417.462] (-2420.756) -- 0:02:22
      144500 -- (-2423.687) (-2418.315) [-2415.347] (-2419.369) * (-2418.358) (-2418.574) (-2414.193) [-2415.861] -- 0:02:22
      145000 -- (-2416.678) [-2419.649] (-2414.772) (-2426.310) * (-2420.832) (-2415.101) (-2413.312) [-2419.218] -- 0:02:21

      Average standard deviation of split frequencies: 0.016144

      145500 -- (-2418.773) (-2415.558) [-2414.060] (-2422.134) * (-2422.974) (-2418.221) (-2421.800) [-2416.088] -- 0:02:20
      146000 -- (-2423.254) (-2426.200) [-2417.140] (-2416.054) * (-2422.897) (-2423.348) (-2425.382) [-2415.309] -- 0:02:26
      146500 -- (-2418.766) [-2417.214] (-2418.022) (-2423.844) * (-2429.419) (-2421.598) [-2417.437] (-2416.528) -- 0:02:25
      147000 -- (-2423.256) [-2413.017] (-2414.952) (-2418.578) * (-2417.255) (-2414.367) [-2414.585] (-2415.997) -- 0:02:25
      147500 -- (-2424.514) (-2425.520) (-2421.669) [-2422.476] * (-2414.574) (-2415.590) [-2421.457] (-2415.551) -- 0:02:24
      148000 -- (-2415.475) (-2427.329) (-2423.802) [-2415.133] * (-2417.202) (-2418.926) [-2415.821] (-2413.912) -- 0:02:23
      148500 -- (-2420.119) (-2415.733) [-2421.896] (-2415.509) * (-2418.048) [-2419.999] (-2418.676) (-2417.825) -- 0:02:23
      149000 -- [-2412.658] (-2426.520) (-2418.622) (-2420.801) * [-2420.109] (-2421.946) (-2422.827) (-2425.561) -- 0:02:22
      149500 -- (-2421.930) (-2424.180) (-2415.494) [-2415.611] * [-2415.546] (-2423.734) (-2421.356) (-2417.762) -- 0:02:22
      150000 -- (-2415.501) (-2432.837) [-2420.400] (-2421.942) * (-2425.540) (-2411.235) [-2418.332] (-2421.021) -- 0:02:21

      Average standard deviation of split frequencies: 0.013297

      150500 -- (-2429.154) [-2417.332] (-2421.836) (-2418.869) * (-2419.389) (-2419.768) (-2422.445) [-2412.873] -- 0:02:21
      151000 -- (-2415.806) (-2431.379) (-2421.601) [-2420.875] * [-2415.655] (-2420.864) (-2429.868) (-2418.889) -- 0:02:20
      151500 -- [-2416.016] (-2419.182) (-2425.091) (-2416.866) * (-2421.076) (-2423.326) (-2415.445) [-2421.278] -- 0:02:20
      152000 -- (-2417.773) (-2421.306) (-2426.102) [-2412.167] * (-2417.654) (-2420.737) (-2413.543) [-2417.637] -- 0:02:25
      152500 -- (-2427.239) (-2414.877) (-2417.731) [-2417.139] * (-2424.423) (-2415.693) [-2416.244] (-2414.630) -- 0:02:24
      153000 -- (-2424.070) (-2416.628) [-2419.812] (-2420.564) * (-2416.045) (-2421.179) [-2420.619] (-2417.999) -- 0:02:23
      153500 -- (-2418.701) (-2421.496) [-2426.968] (-2422.471) * (-2413.346) (-2419.800) [-2414.903] (-2418.789) -- 0:02:23
      154000 -- [-2417.836] (-2422.215) (-2424.916) (-2414.517) * (-2420.609) [-2416.227] (-2416.670) (-2425.956) -- 0:02:22
      154500 -- (-2426.063) (-2417.090) (-2415.235) [-2422.883] * (-2420.999) (-2413.971) [-2416.019] (-2412.994) -- 0:02:22
      155000 -- (-2421.545) (-2423.093) (-2411.389) [-2411.692] * (-2416.763) (-2424.373) [-2416.551] (-2418.468) -- 0:02:21

      Average standard deviation of split frequencies: 0.013598

      155500 -- (-2419.902) (-2434.610) [-2416.386] (-2419.450) * (-2420.623) (-2423.661) (-2412.473) [-2421.926] -- 0:02:21
      156000 -- [-2423.034] (-2418.894) (-2417.862) (-2415.560) * (-2419.351) (-2426.598) (-2415.480) [-2418.912] -- 0:02:20
      156500 -- (-2423.628) [-2418.532] (-2420.016) (-2427.516) * (-2416.904) (-2420.218) [-2417.461] (-2415.201) -- 0:02:20
      157000 -- (-2422.929) [-2419.071] (-2418.999) (-2417.207) * (-2421.645) [-2423.571] (-2425.475) (-2413.819) -- 0:02:19
      157500 -- [-2419.762] (-2422.900) (-2422.696) (-2416.718) * (-2421.802) (-2415.246) [-2415.387] (-2417.812) -- 0:02:19
      158000 -- [-2421.449] (-2419.925) (-2417.246) (-2417.091) * (-2418.635) [-2414.741] (-2421.938) (-2419.420) -- 0:02:23
      158500 -- (-2427.082) (-2423.111) [-2415.275] (-2421.406) * (-2420.930) (-2418.367) (-2419.734) [-2414.698] -- 0:02:23
      159000 -- (-2420.365) [-2417.721] (-2418.807) (-2414.753) * (-2417.788) (-2428.090) (-2419.083) [-2415.762] -- 0:02:22
      159500 -- (-2419.393) [-2417.070] (-2425.706) (-2421.752) * (-2421.346) (-2419.973) (-2424.047) [-2416.676] -- 0:02:22
      160000 -- [-2415.720] (-2416.307) (-2420.596) (-2417.184) * (-2412.081) (-2423.082) [-2413.376] (-2417.848) -- 0:02:21

      Average standard deviation of split frequencies: 0.010269

      160500 -- (-2415.146) (-2421.968) [-2413.096] (-2418.818) * (-2413.839) (-2424.380) [-2420.086] (-2415.922) -- 0:02:21
      161000 -- (-2416.559) [-2417.465] (-2420.121) (-2418.074) * (-2426.223) (-2420.599) [-2416.733] (-2416.495) -- 0:02:20
      161500 -- (-2412.849) [-2415.072] (-2419.152) (-2417.322) * (-2421.622) [-2415.396] (-2413.431) (-2419.229) -- 0:02:20
      162000 -- (-2415.170) (-2426.718) [-2414.486] (-2426.686) * (-2417.543) [-2418.552] (-2426.071) (-2418.139) -- 0:02:19
      162500 -- [-2420.006] (-2427.934) (-2416.934) (-2421.282) * (-2424.084) [-2421.094] (-2414.233) (-2415.576) -- 0:02:19
      163000 -- (-2423.162) [-2418.164] (-2425.172) (-2424.707) * (-2420.273) [-2422.373] (-2420.892) (-2413.127) -- 0:02:18
      163500 -- (-2412.118) (-2424.548) [-2424.219] (-2419.630) * [-2424.589] (-2422.644) (-2421.883) (-2414.773) -- 0:02:18
      164000 -- (-2421.229) (-2421.126) [-2419.104] (-2420.966) * (-2418.179) [-2423.377] (-2416.722) (-2418.795) -- 0:02:22
      164500 -- (-2425.696) [-2418.961] (-2416.383) (-2415.703) * (-2419.039) (-2418.294) [-2414.518] (-2415.194) -- 0:02:22
      165000 -- [-2415.829] (-2421.301) (-2416.905) (-2416.532) * (-2420.097) [-2417.659] (-2422.609) (-2415.164) -- 0:02:21

      Average standard deviation of split frequencies: 0.014199

      165500 -- [-2411.788] (-2425.949) (-2414.347) (-2420.747) * [-2416.524] (-2420.058) (-2414.237) (-2416.311) -- 0:02:21
      166000 -- (-2413.292) (-2417.584) (-2415.528) [-2413.823] * (-2422.965) (-2424.052) (-2422.140) [-2418.508] -- 0:02:20
      166500 -- [-2415.488] (-2421.910) (-2416.448) (-2417.314) * (-2420.675) (-2411.232) [-2416.348] (-2415.020) -- 0:02:20
      167000 -- [-2420.170] (-2425.441) (-2418.946) (-2416.317) * (-2417.449) (-2420.171) (-2430.786) [-2415.393] -- 0:02:19
      167500 -- (-2422.040) (-2416.744) (-2425.765) [-2419.427] * (-2413.910) (-2415.939) (-2418.096) [-2418.700] -- 0:02:19
      168000 -- [-2420.221] (-2423.773) (-2418.341) (-2416.853) * (-2415.174) (-2418.567) [-2416.403] (-2418.662) -- 0:02:18
      168500 -- [-2416.554] (-2418.644) (-2421.109) (-2418.945) * (-2425.600) (-2421.463) [-2420.882] (-2414.916) -- 0:02:18
      169000 -- (-2420.988) (-2419.716) [-2422.917] (-2416.941) * (-2420.215) (-2414.846) [-2418.011] (-2416.824) -- 0:02:17
      169500 -- (-2411.217) (-2425.372) (-2420.902) [-2412.821] * (-2417.954) [-2418.833] (-2415.791) (-2412.769) -- 0:02:17
      170000 -- (-2416.392) (-2418.202) [-2419.673] (-2418.166) * (-2412.927) (-2420.428) (-2412.682) [-2424.323] -- 0:02:21

      Average standard deviation of split frequencies: 0.010496

      170500 -- (-2415.443) (-2418.632) [-2414.322] (-2420.538) * (-2423.958) (-2418.860) (-2422.404) [-2415.211] -- 0:02:21
      171000 -- (-2414.131) (-2415.810) [-2421.703] (-2414.558) * (-2421.771) (-2422.274) (-2423.260) [-2418.912] -- 0:02:20
      171500 -- (-2424.482) (-2414.237) [-2414.722] (-2418.158) * (-2417.408) (-2422.679) (-2424.326) [-2422.888] -- 0:02:20
      172000 -- (-2420.061) (-2419.505) [-2418.357] (-2420.540) * [-2420.965] (-2416.069) (-2416.943) (-2419.644) -- 0:02:19
      172500 -- (-2426.350) [-2421.335] (-2420.403) (-2417.617) * (-2422.788) (-2417.626) [-2416.821] (-2419.159) -- 0:02:19
      173000 -- (-2421.383) [-2414.123] (-2418.478) (-2415.444) * [-2415.438] (-2419.403) (-2423.484) (-2423.272) -- 0:02:18
      173500 -- [-2417.142] (-2417.857) (-2421.550) (-2422.483) * [-2411.520] (-2421.985) (-2426.774) (-2418.687) -- 0:02:18
      174000 -- (-2415.319) (-2420.824) (-2428.270) [-2414.153] * [-2412.887] (-2412.370) (-2422.896) (-2420.012) -- 0:02:17
      174500 -- (-2418.653) (-2423.689) [-2416.984] (-2418.061) * [-2413.871] (-2420.260) (-2415.766) (-2421.472) -- 0:02:17
      175000 -- (-2415.412) (-2422.440) [-2421.159] (-2423.616) * [-2412.910] (-2413.922) (-2423.828) (-2419.735) -- 0:02:16

      Average standard deviation of split frequencies: 0.008035

      175500 -- (-2418.887) (-2426.263) [-2425.533] (-2415.687) * [-2420.119] (-2414.698) (-2422.389) (-2417.578) -- 0:02:16
      176000 -- [-2417.603] (-2421.609) (-2428.252) (-2418.041) * [-2418.018] (-2422.221) (-2424.305) (-2424.334) -- 0:02:20
      176500 -- (-2414.533) [-2420.815] (-2417.392) (-2420.489) * [-2412.925] (-2417.660) (-2423.709) (-2417.571) -- 0:02:19
      177000 -- (-2421.972) (-2418.406) (-2423.777) [-2422.680] * (-2415.687) [-2416.404] (-2425.532) (-2427.005) -- 0:02:19
      177500 -- (-2423.422) (-2418.431) [-2421.128] (-2422.968) * [-2416.476] (-2419.293) (-2422.868) (-2418.047) -- 0:02:19
      178000 -- (-2421.282) (-2417.327) [-2421.871] (-2419.535) * (-2418.886) [-2417.779] (-2423.241) (-2415.844) -- 0:02:18
      178500 -- (-2415.955) (-2422.115) (-2419.568) [-2418.265] * (-2420.273) [-2419.972] (-2420.174) (-2421.492) -- 0:02:18
      179000 -- [-2411.793] (-2418.496) (-2426.064) (-2427.752) * (-2417.685) [-2420.625] (-2423.236) (-2413.887) -- 0:02:17
      179500 -- [-2413.625] (-2412.003) (-2413.798) (-2425.312) * (-2428.161) (-2420.125) (-2417.930) [-2414.998] -- 0:02:17
      180000 -- (-2419.133) [-2416.995] (-2421.892) (-2419.779) * (-2419.285) [-2412.834] (-2427.030) (-2415.856) -- 0:02:16

      Average standard deviation of split frequencies: 0.009132

      180500 -- (-2416.681) (-2409.770) (-2423.331) [-2423.093] * (-2424.107) (-2414.991) [-2419.476] (-2421.256) -- 0:02:16
      181000 -- (-2426.304) [-2418.606] (-2428.979) (-2423.027) * (-2419.479) [-2414.604] (-2421.373) (-2417.809) -- 0:02:15
      181500 -- (-2413.960) [-2418.037] (-2427.548) (-2426.830) * [-2414.939] (-2417.794) (-2421.154) (-2425.232) -- 0:02:15
      182000 -- (-2417.577) (-2419.983) [-2416.975] (-2421.036) * (-2421.491) (-2420.763) [-2416.856] (-2432.389) -- 0:02:19
      182500 -- [-2415.199] (-2419.924) (-2414.919) (-2419.538) * (-2415.648) (-2423.657) [-2422.085] (-2427.976) -- 0:02:18
      183000 -- [-2418.217] (-2428.045) (-2417.355) (-2415.027) * [-2414.427] (-2411.745) (-2420.584) (-2413.439) -- 0:02:18
      183500 -- (-2422.709) [-2415.463] (-2429.957) (-2416.496) * [-2420.884] (-2415.079) (-2430.875) (-2414.304) -- 0:02:17
      184000 -- (-2425.167) (-2428.123) (-2412.725) [-2416.976] * [-2418.336] (-2420.675) (-2416.807) (-2416.189) -- 0:02:17
      184500 -- [-2416.103] (-2422.970) (-2429.387) (-2413.882) * (-2424.318) [-2413.667] (-2424.117) (-2420.020) -- 0:02:17
      185000 -- (-2418.598) (-2421.306) (-2422.410) [-2411.387] * (-2421.843) (-2417.489) [-2417.831] (-2422.948) -- 0:02:16

      Average standard deviation of split frequencies: 0.014700

      185500 -- (-2415.167) (-2418.296) (-2413.234) [-2418.015] * [-2419.075] (-2417.692) (-2415.692) (-2422.731) -- 0:02:16
      186000 -- [-2419.729] (-2424.522) (-2419.197) (-2421.654) * [-2421.043] (-2422.255) (-2419.972) (-2414.630) -- 0:02:15
      186500 -- (-2420.293) (-2411.246) (-2427.809) [-2416.192] * (-2420.852) [-2420.140] (-2416.410) (-2420.711) -- 0:02:15
      187000 -- (-2419.269) (-2420.199) [-2419.996] (-2419.551) * (-2429.587) [-2415.502] (-2428.620) (-2418.813) -- 0:02:14
      187500 -- [-2424.645] (-2422.063) (-2424.608) (-2429.614) * (-2420.789) (-2415.253) (-2413.815) [-2420.114] -- 0:02:14
      188000 -- (-2418.600) (-2418.851) (-2427.135) [-2424.470] * (-2419.173) [-2416.563] (-2416.639) (-2418.981) -- 0:02:18
      188500 -- (-2419.390) (-2417.704) [-2417.672] (-2423.186) * (-2425.871) (-2415.152) (-2412.889) [-2423.085] -- 0:02:17
      189000 -- (-2418.605) (-2421.907) [-2418.852] (-2420.255) * (-2427.382) (-2423.199) (-2422.205) [-2424.521] -- 0:02:17
      189500 -- (-2420.114) [-2412.849] (-2420.847) (-2423.209) * [-2425.519] (-2418.463) (-2418.685) (-2427.853) -- 0:02:16
      190000 -- (-2424.653) (-2414.274) [-2424.138] (-2418.905) * (-2420.860) [-2418.558] (-2420.917) (-2431.850) -- 0:02:16

      Average standard deviation of split frequencies: 0.010384

      190500 -- [-2416.760] (-2416.015) (-2419.245) (-2419.593) * [-2417.376] (-2413.463) (-2416.240) (-2422.591) -- 0:02:15
      191000 -- (-2416.103) (-2412.611) [-2416.179] (-2418.553) * [-2423.163] (-2421.802) (-2416.448) (-2433.006) -- 0:02:15
      191500 -- (-2418.318) [-2417.463] (-2417.857) (-2423.088) * (-2431.177) [-2422.175] (-2418.964) (-2413.561) -- 0:02:15
      192000 -- (-2415.667) [-2412.659] (-2417.150) (-2423.451) * [-2422.420] (-2422.021) (-2423.860) (-2417.905) -- 0:02:14
      192500 -- (-2418.159) [-2413.386] (-2417.214) (-2425.145) * (-2424.922) (-2417.062) (-2417.562) [-2413.436] -- 0:02:14
      193000 -- (-2415.881) [-2418.002] (-2423.381) (-2427.801) * (-2429.109) (-2414.315) (-2426.514) [-2420.612] -- 0:02:13
      193500 -- (-2423.662) (-2421.284) [-2416.376] (-2421.633) * (-2433.010) (-2420.207) [-2420.129] (-2417.074) -- 0:02:13
      194000 -- (-2429.139) [-2420.911] (-2422.958) (-2428.249) * (-2431.529) [-2416.758] (-2416.746) (-2416.109) -- 0:02:12
      194500 -- (-2418.687) [-2421.853] (-2419.765) (-2427.401) * (-2422.213) (-2422.157) [-2416.580] (-2427.620) -- 0:02:16
      195000 -- (-2421.291) (-2418.407) [-2417.930] (-2419.097) * [-2416.118] (-2424.257) (-2422.693) (-2428.192) -- 0:02:16

      Average standard deviation of split frequencies: 0.006013

      195500 -- (-2420.105) [-2421.610] (-2415.164) (-2421.069) * (-2420.805) (-2416.045) [-2415.449] (-2418.911) -- 0:02:15
      196000 -- (-2417.694) (-2420.551) [-2414.346] (-2421.087) * (-2424.115) [-2420.511] (-2419.445) (-2417.418) -- 0:02:15
      196500 -- (-2421.706) (-2415.767) [-2421.740] (-2423.354) * (-2425.203) [-2424.947] (-2415.418) (-2421.065) -- 0:02:14
      197000 -- (-2416.063) (-2416.501) [-2414.373] (-2422.244) * (-2422.172) (-2421.036) (-2417.866) [-2419.906] -- 0:02:14
      197500 -- (-2422.675) (-2420.039) [-2415.917] (-2423.191) * [-2422.077] (-2425.452) (-2417.120) (-2411.333) -- 0:02:14
      198000 -- (-2418.613) [-2414.085] (-2424.115) (-2424.375) * (-2418.475) (-2424.508) (-2415.945) [-2416.701] -- 0:02:13
      198500 -- (-2433.310) (-2417.468) [-2416.823] (-2423.757) * (-2415.329) (-2416.725) [-2414.401] (-2419.898) -- 0:02:13
      199000 -- (-2426.493) (-2423.422) (-2418.901) [-2418.357] * (-2424.350) [-2412.686] (-2418.172) (-2425.091) -- 0:02:12
      199500 -- (-2419.930) [-2419.217] (-2419.898) (-2420.645) * (-2416.358) (-2418.916) (-2419.626) [-2415.892] -- 0:02:12
      200000 -- [-2416.305] (-2421.304) (-2418.472) (-2413.890) * [-2417.698] (-2414.268) (-2417.694) (-2423.669) -- 0:02:12

      Average standard deviation of split frequencies: 0.003524

      200500 -- (-2413.513) [-2419.861] (-2424.191) (-2424.370) * (-2422.881) (-2413.596) [-2419.265] (-2420.389) -- 0:02:15
      201000 -- (-2414.546) (-2421.759) (-2412.880) [-2417.519] * (-2416.381) [-2414.075] (-2421.455) (-2427.530) -- 0:02:15
      201500 -- (-2418.071) (-2420.473) (-2420.870) [-2421.819] * (-2419.249) [-2416.013] (-2419.906) (-2417.435) -- 0:02:14
      202000 -- (-2416.588) (-2417.050) (-2414.381) [-2420.867] * (-2417.161) [-2416.899] (-2419.475) (-2419.428) -- 0:02:14
      202500 -- (-2412.818) [-2425.816] (-2417.837) (-2424.017) * (-2421.811) (-2421.383) (-2419.274) [-2415.352] -- 0:02:13
      203000 -- [-2416.608] (-2420.715) (-2422.160) (-2415.632) * (-2426.468) (-2416.094) [-2414.532] (-2426.727) -- 0:02:13
      203500 -- [-2411.608] (-2422.572) (-2416.693) (-2417.801) * [-2417.881] (-2418.805) (-2417.939) (-2424.374) -- 0:02:13
      204000 -- (-2419.589) [-2422.011] (-2416.477) (-2422.979) * (-2412.479) (-2426.465) [-2417.600] (-2423.599) -- 0:02:12
      204500 -- (-2423.814) [-2421.937] (-2419.815) (-2423.610) * (-2420.889) (-2423.466) [-2414.376] (-2416.837) -- 0:02:12
      205000 -- [-2414.647] (-2420.809) (-2415.710) (-2414.578) * (-2419.189) (-2421.361) (-2424.124) [-2418.490] -- 0:02:11

      Average standard deviation of split frequencies: 0.005721

      205500 -- (-2419.429) [-2414.632] (-2416.253) (-2419.905) * (-2415.239) (-2417.805) [-2414.613] (-2410.570) -- 0:02:11
      206000 -- [-2423.084] (-2421.904) (-2420.273) (-2419.029) * (-2414.358) (-2418.418) [-2420.050] (-2419.368) -- 0:02:11
      206500 -- (-2421.276) [-2416.285] (-2409.517) (-2425.937) * (-2412.134) [-2416.851] (-2419.071) (-2419.811) -- 0:02:14
      207000 -- (-2417.958) (-2412.595) (-2417.931) [-2420.840] * (-2413.057) (-2425.400) (-2421.987) [-2419.190] -- 0:02:14
      207500 -- (-2422.185) (-2419.480) (-2414.121) [-2419.414] * [-2418.357] (-2422.652) (-2418.416) (-2424.156) -- 0:02:13
      208000 -- (-2422.378) (-2418.434) [-2426.660] (-2421.388) * [-2429.315] (-2426.617) (-2421.852) (-2421.450) -- 0:02:13
      208500 -- (-2426.634) [-2419.062] (-2421.488) (-2412.834) * (-2425.701) (-2428.903) [-2415.141] (-2420.318) -- 0:02:12
      209000 -- (-2424.132) (-2429.615) (-2422.381) [-2417.425] * (-2425.998) (-2424.236) [-2412.639] (-2420.198) -- 0:02:12
      209500 -- (-2427.014) (-2428.819) (-2421.329) [-2418.350] * [-2420.289] (-2417.690) (-2416.790) (-2423.650) -- 0:02:12
      210000 -- (-2429.100) (-2420.359) [-2416.353] (-2421.188) * (-2421.176) (-2429.245) (-2416.119) [-2416.454] -- 0:02:11

      Average standard deviation of split frequencies: 0.007161

      210500 -- (-2422.120) (-2412.508) (-2415.976) [-2417.383] * [-2415.408] (-2426.062) (-2415.319) (-2423.060) -- 0:02:11
      211000 -- [-2414.635] (-2415.327) (-2424.424) (-2421.817) * (-2418.149) (-2417.773) [-2414.884] (-2425.954) -- 0:02:10
      211500 -- (-2415.199) (-2419.326) [-2418.944] (-2419.799) * [-2417.764] (-2415.365) (-2421.943) (-2418.371) -- 0:02:10
      212000 -- (-2414.965) (-2428.169) [-2420.997] (-2420.357) * (-2426.848) (-2421.253) (-2419.798) [-2418.559] -- 0:02:10
      212500 -- [-2415.660] (-2423.374) (-2422.160) (-2415.933) * [-2415.091] (-2411.016) (-2419.456) (-2419.137) -- 0:02:13
      213000 -- (-2419.397) (-2430.947) (-2419.265) [-2420.872] * (-2421.440) (-2417.558) (-2420.813) [-2411.526] -- 0:02:13
      213500 -- (-2426.114) (-2424.640) (-2423.502) [-2422.845] * [-2415.612] (-2413.928) (-2417.912) (-2419.317) -- 0:02:12
      214000 -- [-2423.680] (-2430.430) (-2412.992) (-2422.583) * (-2424.077) [-2415.995] (-2424.412) (-2411.963) -- 0:02:12
      214500 -- (-2418.632) [-2420.899] (-2420.315) (-2421.626) * [-2418.217] (-2415.300) (-2419.549) (-2423.199) -- 0:02:11
      215000 -- (-2420.165) (-2422.208) (-2420.101) [-2417.292] * [-2413.485] (-2424.782) (-2419.602) (-2426.564) -- 0:02:11

      Average standard deviation of split frequencies: 0.008293

      215500 -- (-2421.262) (-2428.021) (-2424.403) [-2418.329] * (-2418.184) (-2417.343) [-2418.581] (-2421.913) -- 0:02:11
      216000 -- [-2421.025] (-2419.264) (-2422.187) (-2421.648) * (-2421.390) (-2420.043) (-2420.414) [-2419.463] -- 0:02:10
      216500 -- (-2415.949) (-2425.588) (-2417.921) [-2423.850] * (-2422.541) (-2424.658) [-2417.637] (-2416.393) -- 0:02:10
      217000 -- [-2415.638] (-2428.755) (-2422.174) (-2423.813) * [-2414.121] (-2428.036) (-2418.507) (-2415.110) -- 0:02:09
      217500 -- [-2419.291] (-2426.415) (-2418.033) (-2418.745) * (-2414.397) (-2418.258) [-2418.716] (-2417.875) -- 0:02:09
      218000 -- [-2416.633] (-2421.420) (-2428.828) (-2413.946) * (-2415.202) [-2419.884] (-2414.735) (-2419.183) -- 0:02:09
      218500 -- [-2424.536] (-2420.157) (-2423.076) (-2418.933) * (-2413.391) (-2421.350) (-2416.228) [-2419.270] -- 0:02:12
      219000 -- (-2422.437) (-2416.982) (-2426.725) [-2417.571] * [-2416.554] (-2417.107) (-2416.074) (-2422.249) -- 0:02:11
      219500 -- (-2415.193) (-2424.473) (-2424.249) [-2414.171] * (-2431.192) (-2417.525) [-2417.374] (-2428.076) -- 0:02:11
      220000 -- [-2418.546] (-2416.984) (-2420.624) (-2420.844) * (-2414.641) (-2422.876) [-2414.494] (-2430.929) -- 0:02:11

      Average standard deviation of split frequencies: 0.006836

      220500 -- (-2415.662) [-2423.119] (-2422.178) (-2421.358) * (-2422.362) [-2414.667] (-2415.334) (-2414.351) -- 0:02:10
      221000 -- (-2417.876) [-2419.130] (-2417.123) (-2422.853) * (-2415.890) (-2425.187) (-2419.588) [-2414.112] -- 0:02:10
      221500 -- (-2410.468) (-2422.702) [-2414.673] (-2415.740) * [-2410.124] (-2422.345) (-2417.827) (-2417.555) -- 0:02:10
      222000 -- [-2413.915] (-2416.959) (-2423.867) (-2416.469) * [-2414.875] (-2419.953) (-2418.127) (-2423.661) -- 0:02:09
      222500 -- (-2421.855) (-2412.820) [-2416.270] (-2422.585) * (-2415.427) (-2417.526) [-2415.492] (-2414.883) -- 0:02:09
      223000 -- [-2425.204] (-2414.479) (-2418.747) (-2419.284) * (-2421.310) (-2424.853) (-2420.052) [-2416.434] -- 0:02:08
      223500 -- (-2413.280) (-2421.605) [-2428.540] (-2418.235) * (-2423.194) (-2417.992) [-2417.056] (-2419.701) -- 0:02:08
      224000 -- [-2416.419] (-2428.652) (-2417.194) (-2425.211) * [-2421.920] (-2422.949) (-2419.401) (-2422.736) -- 0:02:11
      224500 -- [-2427.991] (-2423.401) (-2418.138) (-2424.126) * (-2422.839) (-2419.097) [-2420.047] (-2415.617) -- 0:02:11
      225000 -- (-2415.539) (-2421.615) [-2412.172] (-2417.425) * (-2421.926) (-2420.615) [-2414.599] (-2417.505) -- 0:02:10

      Average standard deviation of split frequencies: 0.005840

      225500 -- (-2415.804) (-2417.902) (-2416.449) [-2413.323] * [-2413.344] (-2425.966) (-2418.285) (-2419.380) -- 0:02:10
      226000 -- [-2418.398] (-2423.659) (-2422.694) (-2421.065) * [-2419.816] (-2426.171) (-2422.511) (-2420.581) -- 0:02:10
      226500 -- (-2416.055) (-2418.543) [-2418.070] (-2420.032) * (-2418.582) (-2416.513) [-2421.934] (-2430.576) -- 0:02:09
      227000 -- [-2416.506] (-2422.147) (-2417.624) (-2422.048) * [-2424.927] (-2420.850) (-2429.868) (-2425.597) -- 0:02:09
      227500 -- [-2409.975] (-2418.575) (-2413.705) (-2419.465) * [-2415.020] (-2419.786) (-2420.230) (-2414.556) -- 0:02:09
      228000 -- (-2421.112) [-2419.169] (-2427.195) (-2421.505) * (-2421.930) [-2417.029] (-2414.995) (-2423.834) -- 0:02:08
      228500 -- (-2420.052) (-2422.611) (-2419.703) [-2416.647] * (-2427.454) (-2422.553) [-2412.805] (-2417.363) -- 0:02:08
      229000 -- (-2414.913) [-2414.663] (-2420.455) (-2417.475) * (-2417.121) (-2425.474) (-2416.737) [-2416.398] -- 0:02:07
      229500 -- [-2418.168] (-2419.044) (-2417.770) (-2416.959) * [-2418.012] (-2423.478) (-2414.880) (-2420.293) -- 0:02:07
      230000 -- (-2418.430) (-2422.763) [-2413.023] (-2416.003) * (-2413.081) [-2416.861] (-2421.372) (-2424.806) -- 0:02:10

      Average standard deviation of split frequencies: 0.004087

      230500 -- [-2418.313] (-2423.019) (-2413.944) (-2420.693) * (-2418.502) (-2416.204) (-2418.587) [-2422.806] -- 0:02:10
      231000 -- (-2420.190) [-2422.402] (-2416.244) (-2420.655) * (-2416.765) (-2417.515) (-2420.936) [-2417.062] -- 0:02:09
      231500 -- (-2417.289) (-2420.040) (-2413.911) [-2417.749] * (-2421.035) (-2418.915) [-2418.182] (-2417.255) -- 0:02:09
      232000 -- (-2424.269) (-2422.667) [-2415.105] (-2421.463) * (-2419.778) [-2416.075] (-2424.458) (-2420.592) -- 0:02:09
      232500 -- (-2421.164) [-2417.774] (-2421.638) (-2420.594) * [-2415.047] (-2416.300) (-2420.808) (-2418.947) -- 0:02:08
      233000 -- (-2414.207) (-2420.993) [-2416.523] (-2420.932) * (-2421.529) (-2420.365) (-2420.684) [-2417.601] -- 0:02:08
      233500 -- (-2422.704) [-2417.370] (-2418.157) (-2419.810) * (-2420.833) [-2424.299] (-2417.293) (-2421.984) -- 0:02:08
      234000 -- (-2418.711) [-2415.383] (-2427.928) (-2425.700) * [-2415.435] (-2421.893) (-2424.136) (-2417.975) -- 0:02:07
      234500 -- (-2414.943) (-2414.667) [-2421.025] (-2421.377) * (-2425.406) (-2421.434) [-2415.497] (-2421.267) -- 0:02:07
      235000 -- [-2418.491] (-2417.666) (-2426.675) (-2424.294) * (-2419.486) (-2423.145) (-2422.685) [-2416.559] -- 0:02:06

      Average standard deviation of split frequencies: 0.005593

      235500 -- (-2419.202) [-2417.386] (-2425.103) (-2426.213) * (-2415.040) (-2423.061) (-2420.472) [-2413.674] -- 0:02:06
      236000 -- [-2414.198] (-2424.347) (-2416.838) (-2416.605) * (-2421.204) (-2424.470) (-2417.465) [-2410.258] -- 0:02:09
      236500 -- [-2418.682] (-2411.491) (-2423.249) (-2423.287) * (-2414.884) (-2418.636) (-2419.943) [-2415.753] -- 0:02:09
      237000 -- [-2411.566] (-2418.382) (-2413.693) (-2423.032) * (-2414.803) (-2423.609) [-2415.075] (-2420.932) -- 0:02:08
      237500 -- (-2414.304) (-2412.813) [-2419.148] (-2428.086) * (-2421.219) [-2429.428] (-2418.443) (-2421.190) -- 0:02:08
      238000 -- (-2419.870) (-2415.144) [-2419.546] (-2424.913) * (-2417.636) (-2426.631) [-2418.028] (-2419.669) -- 0:02:08
      238500 -- (-2419.492) [-2419.088] (-2420.273) (-2432.325) * (-2421.205) [-2415.244] (-2412.276) (-2424.925) -- 0:02:07
      239000 -- (-2418.792) [-2414.727] (-2415.977) (-2416.914) * (-2421.107) [-2424.521] (-2418.901) (-2422.741) -- 0:02:07
      239500 -- (-2422.139) [-2417.909] (-2414.193) (-2429.122) * (-2416.890) (-2421.863) (-2420.560) [-2410.958] -- 0:02:07
      240000 -- (-2423.093) [-2422.493] (-2416.629) (-2425.850) * [-2421.326] (-2423.498) (-2417.429) (-2417.478) -- 0:02:06

      Average standard deviation of split frequencies: 0.004701

      240500 -- [-2415.502] (-2414.519) (-2418.740) (-2426.249) * (-2424.655) (-2417.162) [-2424.268] (-2415.559) -- 0:02:06
      241000 -- (-2417.615) (-2418.705) (-2419.914) [-2425.993] * (-2420.864) [-2417.429] (-2417.493) (-2418.531) -- 0:02:05
      241500 -- [-2420.607] (-2415.849) (-2421.072) (-2422.832) * (-2423.581) (-2411.859) [-2416.466] (-2428.314) -- 0:02:05
      242000 -- (-2420.305) [-2413.334] (-2416.051) (-2426.306) * [-2420.126] (-2419.300) (-2423.291) (-2421.345) -- 0:02:08
      242500 -- (-2415.283) (-2422.046) (-2414.719) [-2420.000] * [-2420.665] (-2421.054) (-2422.539) (-2428.397) -- 0:02:08
      243000 -- (-2422.026) (-2420.492) [-2425.647] (-2424.948) * (-2419.939) (-2420.027) (-2419.441) [-2424.389] -- 0:02:07
      243500 -- (-2415.929) (-2421.085) (-2419.555) [-2421.660] * (-2423.621) (-2417.598) [-2421.261] (-2421.632) -- 0:02:07
      244000 -- (-2412.842) (-2419.493) [-2415.498] (-2416.697) * (-2420.321) [-2416.401] (-2417.912) (-2424.117) -- 0:02:07
      244500 -- [-2415.812] (-2424.643) (-2417.005) (-2429.542) * (-2421.439) (-2415.994) (-2420.253) [-2410.488] -- 0:02:06
      245000 -- [-2417.433] (-2425.208) (-2415.455) (-2418.687) * [-2416.391] (-2412.660) (-2416.105) (-2419.641) -- 0:02:06

      Average standard deviation of split frequencies: 0.005366

      245500 -- [-2416.923] (-2427.597) (-2423.502) (-2412.074) * [-2414.147] (-2419.215) (-2422.584) (-2414.651) -- 0:02:06
      246000 -- [-2417.019] (-2418.752) (-2419.629) (-2413.793) * [-2422.074] (-2416.876) (-2415.805) (-2422.992) -- 0:02:05
      246500 -- [-2423.206] (-2413.393) (-2419.335) (-2415.581) * (-2417.102) (-2419.521) [-2421.916] (-2422.004) -- 0:02:05
      247000 -- (-2417.576) (-2415.165) (-2423.139) [-2418.884] * (-2422.669) [-2415.763] (-2421.120) (-2421.466) -- 0:02:04
      247500 -- (-2420.775) (-2415.256) (-2417.127) [-2417.374] * (-2418.618) (-2427.520) (-2416.943) [-2415.646] -- 0:02:04
      248000 -- (-2416.665) [-2415.475] (-2414.447) (-2423.729) * (-2420.750) (-2417.135) (-2416.645) [-2420.077] -- 0:02:07
      248500 -- [-2413.685] (-2417.049) (-2417.448) (-2420.369) * (-2422.125) [-2422.350] (-2421.314) (-2427.439) -- 0:02:07
      249000 -- (-2416.194) [-2418.575] (-2417.583) (-2418.543) * (-2423.955) (-2421.066) [-2417.161] (-2420.796) -- 0:02:06
      249500 -- (-2421.982) (-2424.991) [-2423.766] (-2422.629) * [-2415.840] (-2424.795) (-2414.553) (-2418.141) -- 0:02:06
      250000 -- [-2421.905] (-2430.520) (-2421.386) (-2418.032) * (-2422.816) (-2425.352) (-2416.036) [-2418.185] -- 0:02:06

      Average standard deviation of split frequencies: 0.005642

      250500 -- (-2418.750) [-2415.457] (-2418.993) (-2422.725) * (-2418.965) (-2423.781) (-2420.063) [-2423.068] -- 0:02:05
      251000 -- (-2416.051) (-2421.198) (-2413.870) [-2420.813] * (-2418.987) (-2418.213) [-2419.801] (-2417.955) -- 0:02:05
      251500 -- (-2431.053) (-2424.825) (-2416.607) [-2412.201] * [-2413.548] (-2421.332) (-2420.709) (-2426.535) -- 0:02:04
      252000 -- (-2417.557) (-2414.805) (-2425.905) [-2417.721] * [-2413.315] (-2416.066) (-2422.377) (-2429.877) -- 0:02:04
      252500 -- (-2418.914) (-2423.612) (-2420.390) [-2410.758] * [-2418.015] (-2420.535) (-2420.926) (-2422.165) -- 0:02:04
      253000 -- [-2411.243] (-2418.643) (-2425.646) (-2413.631) * (-2419.443) (-2414.731) (-2420.018) [-2418.683] -- 0:02:04
      253500 -- [-2419.262] (-2430.185) (-2421.850) (-2420.268) * (-2420.125) (-2419.001) [-2418.727] (-2417.306) -- 0:02:03
      254000 -- (-2416.803) (-2422.682) (-2414.685) [-2418.970] * (-2419.858) [-2416.587] (-2421.295) (-2426.524) -- 0:02:06
      254500 -- (-2413.408) (-2421.925) (-2426.841) [-2413.881] * (-2423.535) (-2412.483) [-2423.072] (-2429.033) -- 0:02:05
      255000 -- (-2417.920) [-2415.791] (-2417.476) (-2421.821) * (-2422.876) (-2415.061) [-2418.769] (-2424.225) -- 0:02:05

      Average standard deviation of split frequencies: 0.005156

      255500 -- (-2421.735) [-2415.737] (-2418.766) (-2417.317) * (-2418.444) [-2417.741] (-2418.811) (-2417.591) -- 0:02:05
      256000 -- (-2420.494) [-2425.194] (-2418.015) (-2415.240) * [-2418.873] (-2419.573) (-2417.302) (-2420.414) -- 0:02:04
      256500 -- [-2423.304] (-2421.189) (-2421.277) (-2416.100) * (-2415.037) [-2423.264] (-2414.499) (-2416.381) -- 0:02:04
      257000 -- (-2417.863) [-2413.863] (-2414.976) (-2420.898) * [-2416.381] (-2420.596) (-2415.838) (-2424.211) -- 0:02:04
      257500 -- (-2426.413) (-2425.191) (-2418.953) [-2417.717] * (-2418.120) [-2416.140] (-2416.116) (-2432.123) -- 0:02:03
      258000 -- [-2416.950] (-2421.002) (-2415.649) (-2422.980) * (-2427.638) (-2417.081) [-2415.473] (-2428.846) -- 0:02:03
      258500 -- (-2419.138) (-2423.411) (-2414.905) [-2418.078] * (-2420.110) [-2411.309] (-2422.800) (-2414.360) -- 0:02:03
      259000 -- (-2422.258) (-2418.351) [-2419.098] (-2420.959) * (-2418.832) [-2416.734] (-2419.225) (-2423.107) -- 0:02:03
      259500 -- [-2420.013] (-2422.313) (-2414.355) (-2417.878) * [-2416.858] (-2422.989) (-2420.827) (-2417.659) -- 0:02:02
      260000 -- (-2414.051) (-2424.879) (-2417.101) [-2418.127] * [-2414.032] (-2425.958) (-2422.494) (-2416.278) -- 0:02:05

      Average standard deviation of split frequencies: 0.006149

      260500 -- (-2419.834) (-2418.597) (-2413.794) [-2424.980] * (-2415.468) (-2421.200) (-2426.806) [-2420.313] -- 0:02:04
      261000 -- (-2431.565) [-2412.653] (-2417.124) (-2414.184) * (-2420.146) (-2423.180) (-2425.659) [-2418.514] -- 0:02:04
      261500 -- (-2423.648) [-2412.453] (-2418.823) (-2426.928) * (-2427.753) (-2421.040) (-2416.441) [-2414.932] -- 0:02:04
      262000 -- (-2419.822) (-2418.520) (-2415.821) [-2419.339] * (-2423.494) (-2425.867) (-2425.835) [-2418.668] -- 0:02:03
      262500 -- [-2418.274] (-2417.516) (-2421.797) (-2416.370) * (-2427.236) [-2417.211] (-2415.957) (-2417.696) -- 0:02:03
      263000 -- (-2423.211) (-2421.478) [-2419.297] (-2418.802) * (-2429.114) [-2417.053] (-2420.215) (-2416.792) -- 0:02:03
      263500 -- (-2422.455) (-2422.804) (-2423.875) [-2411.900] * (-2419.898) (-2418.904) (-2423.454) [-2415.860] -- 0:02:02
      264000 -- (-2421.348) (-2418.867) [-2425.019] (-2421.442) * [-2419.958] (-2422.059) (-2412.189) (-2412.666) -- 0:02:02
      264500 -- [-2420.306] (-2413.015) (-2427.245) (-2417.371) * [-2418.749] (-2418.207) (-2414.083) (-2418.404) -- 0:02:02
      265000 -- (-2419.571) (-2425.672) [-2416.609] (-2418.897) * (-2415.408) (-2419.017) (-2411.540) [-2420.496] -- 0:02:02

      Average standard deviation of split frequencies: 0.006025

      265500 -- (-2426.943) (-2415.386) (-2419.043) [-2415.202] * (-2422.325) (-2414.038) [-2417.259] (-2424.911) -- 0:02:01
      266000 -- (-2417.962) [-2417.808] (-2419.597) (-2421.648) * (-2418.328) (-2419.020) (-2417.479) [-2423.707] -- 0:02:04
      266500 -- [-2417.486] (-2417.516) (-2415.549) (-2417.173) * [-2413.698] (-2416.755) (-2416.006) (-2412.201) -- 0:02:03
      267000 -- (-2424.190) [-2410.133] (-2417.704) (-2415.807) * (-2419.397) [-2417.404] (-2422.763) (-2419.589) -- 0:02:03
      267500 -- (-2419.376) (-2421.913) (-2415.931) [-2424.715] * (-2416.810) [-2414.649] (-2418.489) (-2419.418) -- 0:02:03
      268000 -- (-2421.032) [-2419.031] (-2419.608) (-2427.223) * (-2418.500) (-2413.520) [-2418.662] (-2418.970) -- 0:02:02
      268500 -- (-2413.204) [-2414.381] (-2425.754) (-2418.770) * (-2419.017) (-2420.257) (-2418.457) [-2415.887] -- 0:02:02
      269000 -- (-2417.710) (-2415.358) (-2418.077) [-2412.272] * [-2412.207] (-2416.737) (-2417.963) (-2413.915) -- 0:02:02
      269500 -- (-2416.828) (-2420.860) [-2415.211] (-2419.807) * (-2419.097) [-2417.286] (-2419.999) (-2422.870) -- 0:02:01
      270000 -- (-2416.935) (-2428.094) [-2414.084] (-2420.725) * (-2417.116) (-2416.819) [-2416.827] (-2421.726) -- 0:02:01

      Average standard deviation of split frequencies: 0.006618

      270500 -- [-2412.860] (-2417.610) (-2414.666) (-2417.111) * (-2423.044) (-2417.541) (-2418.316) [-2415.942] -- 0:02:01
      271000 -- (-2419.183) (-2413.205) (-2421.542) [-2417.324] * [-2421.641] (-2434.184) (-2419.502) (-2413.615) -- 0:02:01
      271500 -- (-2419.781) [-2418.509] (-2417.247) (-2424.903) * [-2413.684] (-2418.930) (-2418.345) (-2415.450) -- 0:02:00
      272000 -- (-2419.863) (-2418.550) (-2414.318) [-2420.597] * (-2414.652) (-2424.753) (-2414.793) [-2416.560] -- 0:02:03
      272500 -- (-2427.120) [-2426.302] (-2429.508) (-2423.355) * (-2417.572) (-2426.877) (-2416.216) [-2416.869] -- 0:02:02
      273000 -- (-2416.973) (-2422.909) [-2421.383] (-2415.509) * (-2419.035) (-2417.688) [-2419.768] (-2425.217) -- 0:02:02
      273500 -- (-2420.787) (-2415.005) (-2417.215) [-2416.020] * (-2421.110) [-2414.835] (-2418.404) (-2417.966) -- 0:02:02
      274000 -- [-2414.045] (-2421.332) (-2426.032) (-2417.066) * [-2411.052] (-2426.391) (-2418.554) (-2418.868) -- 0:02:01
      274500 -- (-2424.989) (-2420.469) [-2416.075] (-2417.799) * [-2414.973] (-2424.878) (-2418.954) (-2418.198) -- 0:02:01
      275000 -- (-2418.625) (-2417.227) (-2425.765) [-2415.272] * (-2418.420) (-2426.408) (-2416.265) [-2414.867] -- 0:02:01

      Average standard deviation of split frequencies: 0.003843

      275500 -- (-2422.142) (-2415.519) (-2425.322) [-2419.578] * (-2414.510) [-2416.760] (-2419.811) (-2414.694) -- 0:02:00
      276000 -- (-2422.461) (-2417.614) (-2422.576) [-2419.595] * [-2413.269] (-2415.983) (-2421.894) (-2420.953) -- 0:02:00
      276500 -- (-2416.629) (-2418.477) [-2417.596] (-2423.162) * (-2420.798) [-2413.993] (-2422.661) (-2414.579) -- 0:02:00
      277000 -- (-2421.814) [-2417.669] (-2422.202) (-2419.256) * [-2428.461] (-2413.788) (-2418.092) (-2418.051) -- 0:02:00
      277500 -- (-2417.427) (-2413.217) [-2416.157] (-2413.459) * (-2429.814) (-2428.213) (-2419.242) [-2416.464] -- 0:01:59
      278000 -- (-2413.664) [-2415.395] (-2419.041) (-2423.838) * [-2420.644] (-2418.859) (-2412.770) (-2419.732) -- 0:02:02
      278500 -- (-2419.843) [-2412.596] (-2413.262) (-2420.209) * (-2418.768) (-2414.412) [-2419.800] (-2418.911) -- 0:02:01
      279000 -- (-2420.501) (-2418.724) [-2417.962] (-2423.772) * (-2422.008) (-2412.581) [-2417.157] (-2418.902) -- 0:02:01
      279500 -- (-2421.937) (-2413.353) [-2414.569] (-2424.443) * (-2418.516) (-2423.103) [-2417.734] (-2414.026) -- 0:02:01
      280000 -- (-2415.747) (-2413.732) [-2423.666] (-2418.820) * [-2414.172] (-2415.756) (-2426.750) (-2419.890) -- 0:02:00

      Average standard deviation of split frequencies: 0.002939

      280500 -- [-2420.693] (-2424.140) (-2416.558) (-2419.367) * (-2422.928) (-2413.951) (-2416.223) [-2422.187] -- 0:02:00
      281000 -- (-2424.450) (-2438.198) (-2419.840) [-2412.631] * (-2418.525) (-2420.427) (-2423.586) [-2419.227] -- 0:02:00
      281500 -- [-2413.764] (-2424.130) (-2434.352) (-2419.429) * [-2422.291] (-2427.247) (-2421.793) (-2420.946) -- 0:01:59
      282000 -- (-2417.159) (-2421.489) (-2427.394) [-2415.996] * [-2415.134] (-2426.276) (-2425.914) (-2418.108) -- 0:01:59
      282500 -- (-2420.466) (-2422.071) (-2421.518) [-2415.610] * [-2417.657] (-2429.854) (-2420.063) (-2420.839) -- 0:01:59
      283000 -- (-2415.699) (-2417.989) [-2417.383] (-2417.649) * (-2410.601) (-2430.657) (-2417.980) [-2422.084] -- 0:01:59
      283500 -- (-2419.470) (-2412.785) (-2424.400) [-2420.269] * (-2419.070) (-2435.902) (-2417.284) [-2419.553] -- 0:01:58
      284000 -- [-2425.904] (-2418.226) (-2428.006) (-2423.175) * [-2417.172] (-2436.055) (-2411.863) (-2423.893) -- 0:02:01
      284500 -- (-2414.308) (-2413.004) (-2425.726) [-2416.069] * [-2415.155] (-2426.169) (-2416.005) (-2425.940) -- 0:02:00
      285000 -- (-2423.015) [-2418.305] (-2421.476) (-2418.316) * (-2417.860) (-2423.656) [-2422.802] (-2420.975) -- 0:02:00

      Average standard deviation of split frequencies: 0.002884

      285500 -- [-2418.782] (-2430.080) (-2414.967) (-2413.121) * (-2421.712) (-2423.360) (-2414.505) [-2413.793] -- 0:02:00
      286000 -- (-2427.074) (-2420.568) (-2417.882) [-2415.551] * (-2431.424) (-2414.021) (-2425.812) [-2420.462] -- 0:01:59
      286500 -- [-2415.334] (-2426.222) (-2417.474) (-2423.796) * [-2420.902] (-2424.363) (-2419.131) (-2427.198) -- 0:01:59
      287000 -- [-2424.484] (-2415.451) (-2422.891) (-2421.633) * [-2419.607] (-2428.207) (-2421.953) (-2420.733) -- 0:01:59
      287500 -- (-2421.094) [-2418.697] (-2422.358) (-2426.053) * (-2419.955) [-2419.234] (-2419.850) (-2418.470) -- 0:01:58
      288000 -- [-2420.709] (-2416.814) (-2423.492) (-2432.732) * (-2415.173) [-2416.932] (-2422.642) (-2418.238) -- 0:01:58
      288500 -- [-2416.896] (-2420.089) (-2422.113) (-2413.423) * (-2424.025) (-2419.562) [-2420.431] (-2419.885) -- 0:01:58
      289000 -- (-2421.175) (-2422.167) [-2420.452] (-2420.996) * (-2422.097) (-2418.629) [-2415.884] (-2417.576) -- 0:01:58
      289500 -- (-2415.107) (-2430.759) (-2414.366) [-2422.134] * (-2424.695) [-2420.122] (-2423.016) (-2424.365) -- 0:01:57
      290000 -- (-2415.567) (-2433.070) (-2431.552) [-2416.770]