--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 08 18:20:45 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/176/CG6421-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1223.05 -1232.03
2 -1223.08 -1234.51
--------------------------------------
TOTAL -1223.06 -1233.90
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.551914 0.007810 0.395447 0.726582 0.543081 1173.76 1284.27 1.000
r(A<->C){all} 0.076154 0.001165 0.013770 0.143467 0.072408 656.84 814.79 1.000
r(A<->G){all} 0.169494 0.002287 0.084950 0.265889 0.164477 818.74 885.02 1.000
r(A<->T){all} 0.132018 0.002010 0.048348 0.220727 0.128237 702.95 771.75 1.001
r(C<->G){all} 0.044722 0.000424 0.009307 0.087624 0.042101 990.67 1005.72 1.000
r(C<->T){all} 0.524238 0.004496 0.394796 0.656930 0.525014 791.02 831.34 1.002
r(G<->T){all} 0.053375 0.000718 0.009469 0.108650 0.049744 636.57 747.95 1.000
pi(A){all} 0.240925 0.000351 0.206515 0.279747 0.240572 1061.94 1272.45 1.000
pi(C){all} 0.235111 0.000310 0.201700 0.269150 0.234768 1038.20 1158.88 1.000
pi(G){all} 0.288607 0.000385 0.248174 0.325518 0.287983 1037.79 1190.18 1.000
pi(T){all} 0.235357 0.000308 0.201405 0.268592 0.234814 1276.75 1285.76 1.002
alpha{1,2} 0.052730 0.001276 0.000215 0.118040 0.047936 1212.54 1303.79 1.000
alpha{3} 2.013788 0.566903 0.762891 3.505539 1.906073 1447.87 1454.94 1.000
pinvar{all} 0.250327 0.008970 0.060288 0.428598 0.254233 1403.30 1433.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1142.317805
Model 2: PositiveSelection -1142.317805
Model 0: one-ratio -1149.73709
Model 3: discrete -1142.314021
Model 7: beta -1142.813433
Model 8: beta&w>1 -1142.329019
Model 0 vs 1 14.838570000000345
Model 2 vs 1 0.0
Model 8 vs 7 0.9688280000000304
>C1
MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCAKDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
CIERYEDEGFE
>C2
MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
CIEKYEDEGFQ
>C3
MRVFLRYFVYLLLSPALVQGQGHVLDKPVTELCLTCICEAISGCNATAIC
TSTEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAADL
VQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEECI
EKYEDEGFQoo
>C4
MRFFLRYFVYLQLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGENPDSDNAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGQMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
CIEKYEDKGFQ
>C5
MRVFLGYFLFLLLVLSPSLVQGQGHVLDKPVTEKCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFVNCANDPHCAA
DLVQNYMKKFNQDCNEDGEMDCHDYARIHKLGAYGCQADMPYTFQSVFEE
CIEKFEDEGLE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=163
C1 MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
C2 MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
C3 MRVFLRYFVYLL--LSPALVQGQGHVLDKPVTELCLTCICEAISGCNATA
C4 MRFFLRYFVYLQLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
C5 MRVFLGYFLFLLLVLSPSLVQGQGHVLDKPVTEKCLTCICEAISGCNATA
**.** * ::* ***:*************** ****************
C1 ICTSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCAKDPHCAA
C2 ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
C3 ICTSTEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
C4 ICTSPEKGTCGIFRITWGYWVDAGKLTVNGENPDSDNAFINCANDPHCAA
C5 ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFVNCANDPHCAA
****.***:**********************:***::**:***:******
C1 DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
C2 DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
C3 DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
C4 DLVQNYMKKFNQDCNDDGQMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
C5 DLVQNYMKKFNQDCNEDGEMDCHDYARIHKLGAYGCQADMPYTFQSVFEE
***************:**:***********************.*******
C1 CIERYEDEGFE--
C2 CIEKYEDEGFQ--
C3 CIEKYEDEGFQoo
C4 CIEKYEDKGFQ--
C5 CIEKFEDEGLE--
***::**:*::
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3294]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [3294]--->[3285]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/176/CG6421-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.263 Mb, Max= 30.479 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCAKDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
CIERYEDEGFE--
>C2
MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
CIEKYEDEGFQ--
>C3
MRVFLRYFVYLL--LSPALVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSTEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
CIEKYEDEGFQoo
>C4
MRFFLRYFVYLQLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGENPDSDNAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGQMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
CIEKYEDKGFQ--
>C5
MRVFLGYFLFLLLVLSPSLVQGQGHVLDKPVTEKCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFVNCANDPHCAA
DLVQNYMKKFNQDCNEDGEMDCHDYARIHKLGAYGCQADMPYTFQSVFEE
CIEKFEDEGLE--
FORMAT of file /tmp/tmp6035943178287012990aln Not Supported[FATAL:T-COFFEE]
>C1
MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCAKDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
CIERYEDEGFE--
>C2
MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
CIEKYEDEGFQ--
>C3
MRVFLRYFVYLL--LSPALVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSTEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
CIEKYEDEGFQoo
>C4
MRFFLRYFVYLQLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGENPDSDNAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGQMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
CIEKYEDKGFQ--
>C5
MRVFLGYFLFLLLVLSPSLVQGQGHVLDKPVTEKCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFVNCANDPHCAA
DLVQNYMKKFNQDCNEDGEMDCHDYARIHKLGAYGCQADMPYTFQSVFEE
CIEKFEDEGLE--
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:163 S:99 BS:163
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 96.27 C1 C2 96.27
TOP 1 0 96.27 C2 C1 96.27
BOT 0 2 94.97 C1 C3 94.97
TOP 2 0 94.97 C3 C1 94.97
BOT 0 3 90.06 C1 C4 90.06
TOP 3 0 90.06 C4 C1 90.06
BOT 0 4 91.30 C1 C5 91.30
TOP 4 0 91.30 C5 C1 91.30
BOT 1 2 95.60 C2 C3 95.60
TOP 2 1 95.60 C3 C2 95.60
BOT 1 3 93.79 C2 C4 93.79
TOP 3 1 93.79 C4 C2 93.79
BOT 1 4 93.17 C2 C5 93.17
TOP 4 1 93.17 C5 C2 93.17
BOT 2 3 93.08 C3 C4 93.08
TOP 3 2 93.08 C4 C3 93.08
BOT 2 4 91.82 C3 C5 91.82
TOP 4 2 91.82 C5 C3 91.82
BOT 3 4 89.44 C4 C5 89.44
TOP 4 3 89.44 C5 C4 89.44
AVG 0 C1 * 93.15
AVG 1 C2 * 94.71
AVG 2 C3 * 93.87
AVG 3 C4 * 91.59
AVG 4 C5 * 91.43
TOT TOT * 92.95
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGAGTTTTCCTGCTATATTCCATATATTTGCTGCTGGTGCTGTCGCC
C2 ATGCGAGTTTTCCTGCTATATTCTATATATCTGCTGCTGGTACTGTCGCC
C3 ATGCGAGTTTTTCTGCGTTATTTTGTATATCTGCTG------CTGTCGCC
C4 ATGCGATTTTTTCTGCGCTATTTTGTATATCTGCAGCTGGTGCTGTCGCC
C5 ATGAGAGTTTTCTTGGGATATTTCCTTTTCTTACTGCTGGTTCTATCGCC
***.** **** ** **** *:*: *.*:* **.*****
C1 TTCATTGGTTCAAGGCCAAGGTCATGTGCTGGATAAGCCGGTAACGGAGC
C2 TTCATTGGTTCAAGGCCAAGGTCATGTGCTGGATAAACCCGTAACGGAGC
C3 TGCATTGGTACAAGGCCAAGGTCATGTGTTGGATAAGCCCGTAACGGAGC
C4 TTCATTGGTACAAGGCCAAGGTCATGTGCTGGATAAACCCGTAACGGAGC
C5 TTCATTAGTGCAAGGTCAAGGTCATGTGCTGGATAAACCCGTAACGGAGA
* ****.** ***** ************ *******.** *********.
C1 TGTGTCTCACCTGCATTTGTGAGGCCATTAGTGGTTGCAATGCCACGGCG
C2 TGTGTCTCACCTGCATTTGTGAGGCCATCAGTGGCTGCAATGCCACAGCG
C3 TGTGCCTCACCTGCATTTGTGAGGCCATCAGTGGCTGTAATGCCACGGCG
C4 TGTGTCTCACCTGCATTTGTGAGGCCATCAGTGGCTGTAATGCCACGGCG
C5 AGTGCCTCACGTGCATTTGCGAGGCAATCAGCGGCTGCAATGCCACGGCG
:*** ***** ******** *****.** ** ** ** ********.***
C1 ATTTGCACCAGTGCGGAAAAGGGAGCATGCGGCATATTCCGCATCACCTG
C2 ATTTGCACCAGTCCGGAAAAGGGAACCTGCGGCATATTCCGCATCACCTG
C3 ATTTGCACCAGTACGGAAAAGGGAGCATGCGGCATATTTCGCATCACCTG
C4 ATTTGCACTAGTCCGGAAAAGGGAACCTGCGGCATATTCCGCATCACCTG
C5 ATTTGCACCAGTCCGGAAAAGGGAACCTGCGGCATTTTCCGCATCACCTG
******** *** ***********.*.********:** ***********
C1 GGGATACTGGGTGGATGCTGGCAAACTGACGGTAAATGGAGAGCATCCCG
C2 GGGATACTGGGTGGATGCTGGCAAGCTGACGGTTAATGGAGAGCATCCCG
C3 GGGATATTGGGTGGATGCAGGCAAACTGACAGTCAATGGAGAGCATCCCG
C4 GGGATATTGGGTGGATGCTGGAAAACTGACAGTGAATGGAGAGAACCCCG
C5 GGGCTACTGGGTGGATGCAGGCAAGCTGACTGTCAACGGAGAGCATCCCG
***.** ***********:**.**.***** ** ** ******.* ****
C1 ATTCGGAAAAGGCTTTCATCAACTGCGCCAAGGATCCGCACTGTGCCGCC
C2 ATTCGGAAAAGGCCTTCATCAACTGCGCCAATGATCCGCACTGTGCCGCC
C3 ATTCGGAGAAGGCCTTCATCAACTGCGCCAATGATCCGCACTGTGCCGCC
C4 ATTCGGATAACGCCTTTATCAACTGCGCCAATGATCCGCATTGTGCCGCC
C5 ACTCGGAAAAGGCCTTCGTCAACTGTGCCAATGATCCGCACTGCGCCGCC
* ***** ** ** ** .******* ***** ******** ** ******
C1 GATTTGGTGCAAAACTATATGAAGAAGTTCAATCAGGATTGCAATGATGA
C2 GACTTGGTGCAAAACTATATGAAGAAGTTCAATCAGGATTGCAACGATGA
C3 GACTTGGTGCAGAACTACATGAAGAAGTTCAATCAGGACTGCAACGATGA
C4 GACTTGGTGCAAAACTACATGAAGAAGTTCAATCAGGACTGCAATGATGA
C5 GACTTGGTGCAGAACTACATGAAGAAGTTCAACCAGGACTGCAATGAGGA
** ********.***** ************** ***** ***** ** **
C1 TGGTGAGATGGATTGCCACGATTATGCTCGAATCCATAAACTGGGGGCTT
C2 TGGCGAGATGGATTGCCACGATTATGCTCGAATCCATAAACTGGGGGCTT
C3 TGGCGAGATGGATTGCCATGATTATGCTCGAATCCATAAATTGGGCGCCT
C4 TGGCCAGATGGATTGCCATGATTATGCCCGAATCCATAAATTGGGCGCTT
C5 TGGCGAGATGGATTGCCACGACTATGCCCGAATCCACAAATTGGGGGCTT
*** ************* ** ***** ******** *** **** ** *
C1 ATGGCTGCCAAGCGGACATGCCCTACAATTTCCAGAGTGTGTTCGAGGAG
C2 ATGGCTGCCAAGCGGATATGCCCTACAAATTCCAGAGTGTGTTCGAGGAG
C3 ATGGCTGTCAAGCAGACATGCCATACAATTTCCAAAGTGTGTTCGAGGAG
C4 ATGGCTGTCAAGCGGACATGCCCTACAAATTCCAAAGTGTGTTTGAGGAG
C5 ATGGCTGTCAAGCGGACATGCCCTATACTTTTCAGAGCGTGTTCGAGGAG
******* *****.** *****.** *.:** **.** ***** ******
C1 TGCATCGAGAGGTACGAGGATGAGGGATTTGAG------
C2 TGCATCGAGAAGTACGAGGATGAGGGATTTCAG------
C3 TGTATCGAGAAGTACGAGGATGAGGGATTTCAG------
C4 TGCATCGAGAAGTACGAGGATAAGGGATTTCAG------
C5 TGCATCGAGAAATTCGAGGATGAGGGCTTGGAG------
** *******..*:*******.****.** **
>C1
ATGCGAGTTTTCCTGCTATATTCCATATATTTGCTGCTGGTGCTGTCGCC
TTCATTGGTTCAAGGCCAAGGTCATGTGCTGGATAAGCCGGTAACGGAGC
TGTGTCTCACCTGCATTTGTGAGGCCATTAGTGGTTGCAATGCCACGGCG
ATTTGCACCAGTGCGGAAAAGGGAGCATGCGGCATATTCCGCATCACCTG
GGGATACTGGGTGGATGCTGGCAAACTGACGGTAAATGGAGAGCATCCCG
ATTCGGAAAAGGCTTTCATCAACTGCGCCAAGGATCCGCACTGTGCCGCC
GATTTGGTGCAAAACTATATGAAGAAGTTCAATCAGGATTGCAATGATGA
TGGTGAGATGGATTGCCACGATTATGCTCGAATCCATAAACTGGGGGCTT
ATGGCTGCCAAGCGGACATGCCCTACAATTTCCAGAGTGTGTTCGAGGAG
TGCATCGAGAGGTACGAGGATGAGGGATTTGAG------
>C2
ATGCGAGTTTTCCTGCTATATTCTATATATCTGCTGCTGGTACTGTCGCC
TTCATTGGTTCAAGGCCAAGGTCATGTGCTGGATAAACCCGTAACGGAGC
TGTGTCTCACCTGCATTTGTGAGGCCATCAGTGGCTGCAATGCCACAGCG
ATTTGCACCAGTCCGGAAAAGGGAACCTGCGGCATATTCCGCATCACCTG
GGGATACTGGGTGGATGCTGGCAAGCTGACGGTTAATGGAGAGCATCCCG
ATTCGGAAAAGGCCTTCATCAACTGCGCCAATGATCCGCACTGTGCCGCC
GACTTGGTGCAAAACTATATGAAGAAGTTCAATCAGGATTGCAACGATGA
TGGCGAGATGGATTGCCACGATTATGCTCGAATCCATAAACTGGGGGCTT
ATGGCTGCCAAGCGGATATGCCCTACAAATTCCAGAGTGTGTTCGAGGAG
TGCATCGAGAAGTACGAGGATGAGGGATTTCAG------
>C3
ATGCGAGTTTTTCTGCGTTATTTTGTATATCTGCTG------CTGTCGCC
TGCATTGGTACAAGGCCAAGGTCATGTGTTGGATAAGCCCGTAACGGAGC
TGTGCCTCACCTGCATTTGTGAGGCCATCAGTGGCTGTAATGCCACGGCG
ATTTGCACCAGTACGGAAAAGGGAGCATGCGGCATATTTCGCATCACCTG
GGGATATTGGGTGGATGCAGGCAAACTGACAGTCAATGGAGAGCATCCCG
ATTCGGAGAAGGCCTTCATCAACTGCGCCAATGATCCGCACTGTGCCGCC
GACTTGGTGCAGAACTACATGAAGAAGTTCAATCAGGACTGCAACGATGA
TGGCGAGATGGATTGCCATGATTATGCTCGAATCCATAAATTGGGCGCCT
ATGGCTGTCAAGCAGACATGCCATACAATTTCCAAAGTGTGTTCGAGGAG
TGTATCGAGAAGTACGAGGATGAGGGATTTCAG------
>C4
ATGCGATTTTTTCTGCGCTATTTTGTATATCTGCAGCTGGTGCTGTCGCC
TTCATTGGTACAAGGCCAAGGTCATGTGCTGGATAAACCCGTAACGGAGC
TGTGTCTCACCTGCATTTGTGAGGCCATCAGTGGCTGTAATGCCACGGCG
ATTTGCACTAGTCCGGAAAAGGGAACCTGCGGCATATTCCGCATCACCTG
GGGATATTGGGTGGATGCTGGAAAACTGACAGTGAATGGAGAGAACCCCG
ATTCGGATAACGCCTTTATCAACTGCGCCAATGATCCGCATTGTGCCGCC
GACTTGGTGCAAAACTACATGAAGAAGTTCAATCAGGACTGCAATGATGA
TGGCCAGATGGATTGCCATGATTATGCCCGAATCCATAAATTGGGCGCTT
ATGGCTGTCAAGCGGACATGCCCTACAAATTCCAAAGTGTGTTTGAGGAG
TGCATCGAGAAGTACGAGGATAAGGGATTTCAG------
>C5
ATGAGAGTTTTCTTGGGATATTTCCTTTTCTTACTGCTGGTTCTATCGCC
TTCATTAGTGCAAGGTCAAGGTCATGTGCTGGATAAACCCGTAACGGAGA
AGTGCCTCACGTGCATTTGCGAGGCAATCAGCGGCTGCAATGCCACGGCG
ATTTGCACCAGTCCGGAAAAGGGAACCTGCGGCATTTTCCGCATCACCTG
GGGCTACTGGGTGGATGCAGGCAAGCTGACTGTCAACGGAGAGCATCCCG
ACTCGGAAAAGGCCTTCGTCAACTGTGCCAATGATCCGCACTGCGCCGCC
GACTTGGTGCAGAACTACATGAAGAAGTTCAACCAGGACTGCAATGAGGA
TGGCGAGATGGATTGCCACGACTATGCCCGAATCCACAAATTGGGGGCTT
ATGGCTGTCAAGCGGACATGCCCTATACTTTTCAGAGCGTGTTCGAGGAG
TGCATCGAGAAATTCGAGGATGAGGGCTTGGAG------
>C1
MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCAKDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
CIERYEDEGFE
>C2
MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
CIEKYEDEGFQ
>C3
MRVFLRYFVYLLooLSPALVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSTEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
CIEKYEDEGFQ
>C4
MRFFLRYFVYLQLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGENPDSDNAFINCANDPHCAA
DLVQNYMKKFNQDCNDDGQMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
CIEKYEDKGFQ
>C5
MRVFLGYFLFLLLVLSPSLVQGQGHVLDKPVTEKCLTCICEAISGCNATA
ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFVNCANDPHCAA
DLVQNYMKKFNQDCNEDGEMDCHDYARIHKLGAYGCQADMPYTFQSVFEE
CIEKFEDEGLE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 489 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478629001
Setting output file names to "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1504695154
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2273098199
Seed = 164627751
Swapseed = 1478629001
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 23 unique site patterns
Division 2 has 13 unique site patterns
Division 3 has 48 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1426.737230 -- -25.624409
Chain 2 -- -1420.760058 -- -25.624409
Chain 3 -- -1392.220506 -- -25.624409
Chain 4 -- -1397.342454 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1412.603750 -- -25.624409
Chain 2 -- -1415.272591 -- -25.624409
Chain 3 -- -1417.173070 -- -25.624409
Chain 4 -- -1395.929778 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1426.737] (-1420.760) (-1392.221) (-1397.342) * [-1412.604] (-1415.273) (-1417.173) (-1395.930)
500 -- [-1263.138] (-1275.391) (-1269.541) (-1279.142) * (-1270.337) [-1266.312] (-1274.627) (-1278.039) -- 0:33:19
1000 -- (-1255.167) (-1263.915) [-1258.698] (-1268.063) * (-1264.495) (-1254.583) [-1263.943] (-1270.933) -- 0:16:39
1500 -- (-1247.397) (-1247.973) [-1246.181] (-1258.399) * (-1257.410) [-1244.595] (-1250.018) (-1258.562) -- 0:11:05
2000 -- (-1250.321) (-1239.171) [-1234.837] (-1249.303) * (-1239.723) (-1238.754) [-1232.331] (-1255.712) -- 0:08:19
2500 -- (-1250.863) [-1229.498] (-1233.461) (-1238.045) * (-1237.102) (-1233.153) [-1227.664] (-1250.153) -- 0:06:39
3000 -- (-1232.624) [-1223.717] (-1227.125) (-1244.629) * [-1232.404] (-1232.547) (-1229.209) (-1241.973) -- 0:05:32
3500 -- (-1237.011) [-1223.371] (-1226.049) (-1237.414) * [-1227.532] (-1231.729) (-1225.298) (-1229.199) -- 0:04:44
4000 -- (-1236.577) [-1230.984] (-1225.431) (-1225.685) * (-1229.772) (-1228.702) [-1228.296] (-1231.236) -- 0:04:09
4500 -- (-1228.325) (-1231.718) (-1221.936) [-1232.420] * (-1226.063) [-1226.822] (-1231.289) (-1224.944) -- 0:03:41
5000 -- (-1237.594) (-1227.762) [-1221.269] (-1230.057) * [-1224.621] (-1228.537) (-1235.045) (-1230.170) -- 0:03:19
Average standard deviation of split frequencies: 0.039284
5500 -- (-1228.806) (-1228.044) [-1234.598] (-1235.334) * (-1233.361) (-1224.489) (-1232.265) [-1229.889] -- 0:06:01
6000 -- (-1224.273) (-1222.270) [-1227.641] (-1226.358) * (-1234.474) (-1227.166) [-1222.796] (-1227.717) -- 0:05:31
6500 -- [-1230.981] (-1222.769) (-1223.322) (-1225.763) * (-1227.163) [-1219.215] (-1226.464) (-1237.105) -- 0:05:05
7000 -- (-1227.795) [-1232.868] (-1226.595) (-1226.582) * (-1226.251) (-1221.832) (-1230.453) [-1225.862] -- 0:04:43
7500 -- (-1230.143) (-1233.759) (-1226.419) [-1228.454] * (-1224.037) (-1221.065) (-1221.450) [-1223.465] -- 0:04:24
8000 -- (-1230.055) [-1228.866] (-1221.849) (-1234.244) * (-1224.109) (-1225.669) [-1227.350] (-1226.642) -- 0:04:08
8500 -- [-1227.138] (-1227.441) (-1223.897) (-1235.758) * (-1225.527) [-1226.064] (-1224.045) (-1223.187) -- 0:03:53
9000 -- (-1229.930) (-1228.984) (-1231.918) [-1234.126] * (-1225.461) [-1227.282] (-1225.852) (-1220.951) -- 0:03:40
9500 -- [-1230.718] (-1229.803) (-1222.699) (-1231.790) * (-1225.623) (-1235.070) [-1223.739] (-1226.795) -- 0:03:28
10000 -- (-1230.820) [-1222.335] (-1228.785) (-1229.922) * (-1224.453) (-1227.364) (-1224.848) [-1223.542] -- 0:03:18
Average standard deviation of split frequencies: 0.066291
10500 -- (-1232.291) (-1223.279) [-1225.505] (-1227.221) * (-1235.623) [-1225.675] (-1228.188) (-1229.421) -- 0:03:08
11000 -- (-1227.772) (-1230.368) [-1224.042] (-1230.160) * (-1232.391) (-1223.859) [-1222.818] (-1228.953) -- 0:04:29
11500 -- [-1226.663] (-1231.486) (-1221.684) (-1223.655) * (-1230.300) (-1226.687) [-1222.557] (-1232.907) -- 0:04:17
12000 -- (-1224.443) [-1228.522] (-1223.452) (-1232.392) * (-1228.095) (-1223.758) (-1228.547) [-1228.753] -- 0:04:07
12500 -- (-1226.446) (-1224.592) (-1231.115) [-1227.274] * [-1223.326] (-1227.575) (-1227.321) (-1224.448) -- 0:03:57
13000 -- (-1228.365) (-1230.813) [-1223.610] (-1229.931) * (-1228.586) [-1223.438] (-1229.471) (-1227.818) -- 0:03:47
13500 -- (-1228.282) (-1231.566) [-1223.537] (-1230.068) * (-1223.174) (-1226.474) [-1226.002] (-1232.211) -- 0:03:39
14000 -- (-1223.258) [-1225.673] (-1225.757) (-1221.217) * [-1224.291] (-1228.917) (-1227.408) (-1235.932) -- 0:03:31
14500 -- (-1231.112) (-1231.146) (-1225.635) [-1231.114] * (-1225.723) (-1225.531) (-1223.947) [-1235.022] -- 0:03:23
15000 -- [-1221.942] (-1226.059) (-1223.047) (-1219.966) * (-1230.734) (-1222.286) [-1224.151] (-1230.826) -- 0:03:17
Average standard deviation of split frequencies: 0.095754
15500 -- (-1227.611) (-1229.088) [-1224.256] (-1227.497) * (-1226.408) [-1224.791] (-1231.194) (-1229.316) -- 0:03:10
16000 -- (-1225.325) (-1230.782) (-1229.097) [-1224.391] * (-1231.759) [-1227.803] (-1226.957) (-1228.997) -- 0:03:04
16500 -- (-1229.193) (-1228.073) (-1224.241) [-1228.189] * (-1231.149) (-1224.484) (-1229.460) [-1227.389] -- 0:03:58
17000 -- (-1224.044) [-1229.217] (-1231.798) (-1222.485) * (-1224.415) [-1220.054] (-1224.014) (-1224.608) -- 0:03:51
17500 -- (-1228.565) (-1222.244) (-1227.295) [-1221.124] * (-1227.380) (-1221.973) [-1226.701] (-1230.889) -- 0:03:44
18000 -- (-1226.814) [-1227.426] (-1227.801) (-1222.866) * (-1223.124) [-1221.350] (-1225.772) (-1227.746) -- 0:03:38
18500 -- (-1228.116) [-1235.587] (-1225.999) (-1222.250) * (-1223.682) (-1228.545) (-1226.369) [-1222.368] -- 0:03:32
19000 -- (-1225.744) (-1242.984) (-1227.773) [-1227.549] * (-1228.569) [-1228.518] (-1227.219) (-1225.318) -- 0:03:26
19500 -- [-1228.836] (-1233.054) (-1228.141) (-1221.001) * (-1230.576) (-1227.991) (-1221.722) [-1225.040] -- 0:03:21
20000 -- (-1227.787) (-1230.662) (-1226.835) [-1221.947] * (-1229.941) [-1226.242] (-1232.232) (-1223.006) -- 0:03:16
Average standard deviation of split frequencies: 0.074132
20500 -- (-1222.566) (-1229.927) (-1225.805) [-1223.492] * (-1224.787) (-1232.414) [-1221.990] (-1225.166) -- 0:03:11
21000 -- (-1223.046) (-1227.581) (-1239.635) [-1226.940] * [-1227.142] (-1227.264) (-1224.497) (-1226.315) -- 0:03:06
21500 -- (-1224.136) [-1226.507] (-1235.635) (-1230.630) * [-1224.344] (-1231.894) (-1225.229) (-1229.088) -- 0:03:47
22000 -- (-1221.731) [-1223.711] (-1228.767) (-1226.206) * (-1221.938) (-1225.489) [-1225.091] (-1226.593) -- 0:03:42
22500 -- [-1226.597] (-1227.838) (-1224.073) (-1228.077) * (-1223.219) (-1228.330) (-1228.608) [-1226.063] -- 0:03:37
23000 -- [-1227.016] (-1229.385) (-1223.230) (-1226.624) * (-1220.140) [-1226.530] (-1227.623) (-1226.849) -- 0:03:32
23500 -- (-1226.538) [-1227.274] (-1229.116) (-1229.551) * (-1233.879) (-1226.569) [-1231.116] (-1228.341) -- 0:03:27
24000 -- (-1226.535) [-1226.380] (-1228.773) (-1236.805) * (-1237.067) [-1223.674] (-1226.390) (-1229.161) -- 0:03:23
24500 -- (-1226.225) [-1224.507] (-1226.293) (-1231.827) * (-1232.424) [-1219.903] (-1226.351) (-1225.159) -- 0:03:19
25000 -- [-1222.856] (-1227.669) (-1226.513) (-1236.910) * [-1224.000] (-1232.670) (-1230.125) (-1229.423) -- 0:03:15
Average standard deviation of split frequencies: 0.077057
25500 -- (-1229.244) [-1231.542] (-1224.071) (-1235.734) * (-1227.878) [-1222.972] (-1233.782) (-1230.612) -- 0:03:11
26000 -- [-1226.102] (-1225.018) (-1222.288) (-1235.415) * (-1226.927) [-1231.485] (-1228.418) (-1226.571) -- 0:03:07
26500 -- [-1226.534] (-1220.394) (-1221.139) (-1229.689) * (-1225.555) (-1229.375) [-1225.641] (-1227.219) -- 0:03:03
27000 -- [-1224.206] (-1221.943) (-1229.007) (-1229.906) * (-1220.062) (-1228.116) (-1227.486) [-1225.496] -- 0:03:36
27500 -- (-1227.173) (-1226.471) (-1228.806) [-1228.386] * (-1225.005) (-1224.762) [-1221.113] (-1222.344) -- 0:03:32
28000 -- (-1225.832) [-1226.145] (-1227.095) (-1232.503) * (-1224.947) (-1222.469) (-1224.080) [-1221.914] -- 0:03:28
28500 -- (-1234.124) (-1225.631) [-1226.421] (-1232.422) * (-1231.637) (-1218.475) (-1226.586) [-1223.867] -- 0:03:24
29000 -- [-1222.693] (-1226.128) (-1225.425) (-1224.326) * (-1223.661) (-1230.257) [-1231.541] (-1228.616) -- 0:03:20
29500 -- [-1222.360] (-1224.710) (-1224.101) (-1226.727) * (-1228.441) (-1228.130) [-1225.093] (-1226.837) -- 0:03:17
30000 -- (-1221.909) [-1225.127] (-1230.186) (-1231.876) * (-1228.405) [-1223.584] (-1228.730) (-1229.651) -- 0:03:14
Average standard deviation of split frequencies: 0.061488
30500 -- (-1228.050) (-1225.095) (-1222.225) [-1227.900] * (-1226.750) (-1228.938) (-1225.489) [-1224.518] -- 0:03:10
31000 -- (-1224.473) (-1227.684) [-1228.310] (-1226.700) * (-1227.510) (-1235.160) [-1225.845] (-1222.610) -- 0:03:07
31500 -- [-1227.323] (-1225.509) (-1223.192) (-1228.788) * (-1228.396) (-1231.460) [-1224.203] (-1228.982) -- 0:03:04
32000 -- (-1224.257) (-1224.692) [-1226.097] (-1228.847) * (-1232.126) (-1231.025) (-1225.580) [-1227.012] -- 0:03:01
32500 -- (-1233.068) (-1229.335) (-1225.731) [-1223.684] * (-1226.892) [-1223.180] (-1230.528) (-1224.619) -- 0:03:28
33000 -- [-1227.534] (-1229.011) (-1228.321) (-1222.322) * [-1223.246] (-1229.634) (-1224.897) (-1226.559) -- 0:03:25
33500 -- [-1221.708] (-1227.141) (-1227.206) (-1225.446) * (-1226.841) (-1231.191) (-1226.784) [-1224.568] -- 0:03:21
34000 -- [-1222.931] (-1224.578) (-1224.112) (-1221.476) * (-1226.075) [-1225.084] (-1226.497) (-1226.374) -- 0:03:18
34500 -- (-1222.712) (-1229.113) [-1224.677] (-1228.111) * [-1227.008] (-1227.198) (-1223.032) (-1224.420) -- 0:03:15
35000 -- (-1229.151) (-1236.395) (-1224.582) [-1223.925] * (-1228.456) (-1228.249) (-1226.388) [-1222.273] -- 0:03:13
Average standard deviation of split frequencies: 0.043649
35500 -- (-1222.281) (-1236.790) (-1230.207) [-1218.509] * (-1226.000) [-1226.448] (-1230.226) (-1225.721) -- 0:03:10
36000 -- [-1223.587] (-1229.434) (-1240.042) (-1224.903) * (-1230.155) (-1226.707) [-1223.493] (-1228.209) -- 0:03:07
36500 -- (-1227.775) (-1223.361) (-1226.955) [-1224.273] * [-1224.112] (-1222.877) (-1229.834) (-1227.010) -- 0:03:04
37000 -- (-1225.957) (-1226.240) (-1225.027) [-1230.637] * (-1224.789) (-1222.917) (-1229.842) [-1226.425] -- 0:03:02
37500 -- (-1225.594) [-1229.273] (-1232.162) (-1232.143) * [-1223.511] (-1225.927) (-1231.250) (-1228.381) -- 0:03:25
38000 -- (-1235.434) (-1237.326) [-1229.618] (-1225.248) * (-1223.243) (-1222.113) [-1228.007] (-1232.519) -- 0:03:22
38500 -- (-1230.553) (-1228.235) (-1229.674) [-1228.403] * [-1228.149] (-1221.796) (-1230.694) (-1229.544) -- 0:03:19
39000 -- (-1229.909) (-1228.826) [-1227.997] (-1226.649) * (-1224.352) (-1228.215) (-1231.292) [-1227.753] -- 0:03:17
39500 -- (-1226.424) [-1227.364] (-1234.012) (-1233.553) * (-1235.309) [-1224.021] (-1222.428) (-1223.156) -- 0:03:14
40000 -- (-1226.701) (-1226.256) [-1234.955] (-1225.642) * (-1231.704) (-1226.855) (-1222.351) [-1222.628] -- 0:03:12
Average standard deviation of split frequencies: 0.050232
40500 -- [-1221.664] (-1225.749) (-1235.915) (-1222.854) * [-1230.429] (-1232.892) (-1225.817) (-1223.993) -- 0:03:09
41000 -- (-1223.487) (-1232.468) (-1234.296) [-1226.609] * (-1231.874) (-1227.455) [-1230.050] (-1224.754) -- 0:03:07
41500 -- (-1227.721) [-1224.321] (-1226.944) (-1225.475) * (-1228.356) (-1221.842) (-1229.137) [-1225.214] -- 0:03:04
42000 -- (-1231.155) [-1228.313] (-1221.943) (-1227.890) * (-1232.847) (-1225.429) (-1235.183) [-1226.648] -- 0:03:02
42500 -- (-1229.140) [-1222.298] (-1228.688) (-1234.808) * (-1225.247) (-1223.470) [-1227.623] (-1226.917) -- 0:03:00
43000 -- (-1227.307) [-1223.927] (-1223.772) (-1242.747) * (-1226.527) (-1231.385) (-1225.892) [-1222.629] -- 0:03:20
43500 -- (-1228.597) [-1227.712] (-1222.255) (-1229.475) * [-1222.178] (-1226.638) (-1228.838) (-1230.143) -- 0:03:17
44000 -- (-1231.474) (-1225.493) [-1228.849] (-1230.388) * (-1226.635) [-1223.342] (-1236.511) (-1221.112) -- 0:03:15
44500 -- (-1227.878) [-1227.471] (-1226.740) (-1229.192) * (-1224.236) (-1223.997) (-1237.038) [-1224.659] -- 0:03:13
45000 -- (-1225.847) (-1226.680) (-1228.181) [-1225.598] * (-1230.685) (-1230.483) (-1228.971) [-1231.990] -- 0:03:11
Average standard deviation of split frequencies: 0.003416
45500 -- [-1228.206] (-1221.868) (-1224.026) (-1226.288) * (-1232.381) (-1226.782) (-1229.112) [-1220.730] -- 0:03:08
46000 -- (-1226.192) (-1222.424) [-1222.731] (-1221.648) * (-1224.024) (-1228.528) (-1229.865) [-1224.854] -- 0:03:06
46500 -- [-1227.152] (-1226.619) (-1223.955) (-1225.118) * [-1225.137] (-1229.735) (-1225.311) (-1230.462) -- 0:03:04
47000 -- (-1229.401) (-1230.590) (-1222.816) [-1232.033] * (-1225.663) (-1226.665) (-1222.700) [-1228.074] -- 0:03:02
47500 -- [-1224.382] (-1224.814) (-1224.076) (-1222.593) * (-1239.314) (-1227.768) (-1230.631) [-1229.752] -- 0:03:00
48000 -- (-1226.147) (-1228.421) [-1227.081] (-1229.945) * [-1230.409] (-1221.904) (-1222.383) (-1235.174) -- 0:02:58
48500 -- (-1222.861) (-1223.227) [-1227.537] (-1223.816) * (-1231.400) (-1225.362) (-1229.852) [-1225.406] -- 0:03:16
49000 -- (-1224.070) [-1227.304] (-1225.571) (-1221.469) * (-1225.640) (-1224.150) [-1227.945] (-1228.342) -- 0:03:14
49500 -- [-1227.122] (-1224.787) (-1223.481) (-1224.766) * (-1229.816) [-1225.948] (-1228.174) (-1230.460) -- 0:03:12
50000 -- (-1228.298) (-1228.929) [-1223.138] (-1221.962) * [-1225.966] (-1221.651) (-1225.248) (-1225.434) -- 0:03:10
Average standard deviation of split frequencies: 0.012405
50500 -- (-1227.675) (-1225.636) [-1227.054] (-1227.475) * (-1235.472) [-1225.303] (-1227.876) (-1223.277) -- 0:03:08
51000 -- (-1227.007) [-1219.453] (-1227.287) (-1225.290) * (-1233.001) [-1224.215] (-1231.991) (-1226.490) -- 0:03:06
51500 -- (-1224.217) (-1225.634) [-1225.347] (-1225.834) * [-1226.947] (-1222.204) (-1230.111) (-1224.966) -- 0:03:04
52000 -- (-1224.843) [-1226.288] (-1226.931) (-1223.573) * (-1231.760) (-1231.134) [-1227.017] (-1236.920) -- 0:03:02
52500 -- [-1224.219] (-1226.674) (-1222.939) (-1227.780) * [-1228.216] (-1226.855) (-1225.909) (-1231.251) -- 0:03:00
53000 -- (-1228.407) [-1225.007] (-1229.176) (-1224.898) * (-1230.493) (-1231.348) [-1223.142] (-1229.444) -- 0:02:58
53500 -- (-1231.146) (-1220.412) [-1226.678] (-1227.415) * (-1228.703) [-1227.444] (-1223.958) (-1233.189) -- 0:02:56
54000 -- (-1225.690) (-1222.399) (-1230.206) [-1224.634] * (-1224.494) (-1228.558) [-1225.983] (-1226.296) -- 0:03:12
54500 -- [-1227.076] (-1220.836) (-1232.626) (-1224.902) * (-1227.993) (-1228.872) (-1223.154) [-1221.649] -- 0:03:10
55000 -- (-1225.580) [-1226.682] (-1226.200) (-1228.195) * (-1225.740) [-1226.973] (-1223.477) (-1227.623) -- 0:03:09
Average standard deviation of split frequencies: 0.008418
55500 -- [-1221.455] (-1226.551) (-1232.579) (-1226.398) * [-1229.269] (-1226.871) (-1223.596) (-1220.265) -- 0:03:07
56000 -- [-1226.787] (-1222.905) (-1228.039) (-1234.026) * (-1227.783) (-1225.466) [-1221.845] (-1230.430) -- 0:03:05
56500 -- (-1231.411) [-1223.271] (-1223.962) (-1233.872) * (-1222.035) (-1233.524) [-1226.809] (-1228.285) -- 0:03:03
57000 -- (-1227.036) (-1227.070) [-1228.452] (-1234.937) * [-1223.963] (-1235.107) (-1229.027) (-1231.737) -- 0:03:01
57500 -- (-1228.364) (-1227.127) [-1224.980] (-1235.468) * (-1225.253) (-1229.807) [-1226.939] (-1228.040) -- 0:03:00
58000 -- [-1223.147] (-1230.846) (-1226.974) (-1230.328) * (-1227.185) (-1231.186) [-1225.906] (-1235.972) -- 0:02:58
58500 -- (-1227.658) (-1225.091) [-1232.899] (-1228.393) * (-1228.079) [-1234.573] (-1222.719) (-1230.054) -- 0:02:57
59000 -- (-1229.835) [-1226.177] (-1228.003) (-1228.500) * [-1225.168] (-1229.950) (-1230.998) (-1223.084) -- 0:03:11
59500 -- (-1232.480) (-1223.810) (-1225.009) [-1225.854] * [-1225.246] (-1236.047) (-1229.585) (-1231.931) -- 0:03:09
60000 -- [-1231.767] (-1226.251) (-1230.635) (-1227.652) * (-1224.048) (-1224.469) [-1222.405] (-1232.782) -- 0:03:08
Average standard deviation of split frequencies: 0.007770
60500 -- (-1231.445) [-1228.880] (-1224.812) (-1228.838) * (-1227.594) [-1225.698] (-1225.526) (-1226.782) -- 0:03:06
61000 -- [-1229.192] (-1225.162) (-1227.273) (-1228.731) * [-1232.528] (-1231.476) (-1227.636) (-1234.168) -- 0:03:04
61500 -- (-1229.773) [-1223.604] (-1223.633) (-1224.447) * (-1243.452) (-1239.290) [-1223.991] (-1227.119) -- 0:03:03
62000 -- [-1220.070] (-1224.974) (-1226.831) (-1222.369) * (-1238.164) (-1234.557) [-1222.182] (-1226.577) -- 0:03:01
62500 -- [-1219.725] (-1223.616) (-1225.578) (-1225.906) * (-1234.657) (-1230.813) (-1234.167) [-1223.300] -- 0:03:00
63000 -- (-1239.651) [-1221.817] (-1226.462) (-1226.043) * (-1232.575) (-1230.632) (-1227.453) [-1225.432] -- 0:02:58
63500 -- (-1226.811) (-1226.897) (-1226.717) [-1224.590] * (-1233.707) (-1230.695) (-1227.846) [-1224.851] -- 0:02:56
64000 -- (-1223.912) (-1230.636) (-1224.144) [-1225.211] * (-1228.749) (-1228.995) (-1232.390) [-1221.527] -- 0:02:55
64500 -- [-1225.032] (-1232.560) (-1223.633) (-1230.632) * (-1228.441) (-1225.085) [-1226.867] (-1223.556) -- 0:03:08
65000 -- (-1229.608) [-1221.550] (-1227.881) (-1228.646) * (-1227.965) [-1226.950] (-1230.133) (-1228.684) -- 0:03:07
Average standard deviation of split frequencies: 0.014285
65500 -- (-1227.692) (-1228.084) [-1222.872] (-1226.948) * (-1224.395) [-1229.236] (-1230.425) (-1230.107) -- 0:03:05
66000 -- [-1232.314] (-1224.801) (-1233.533) (-1228.652) * (-1225.788) (-1228.140) [-1226.502] (-1228.360) -- 0:03:03
66500 -- (-1231.078) [-1229.022] (-1230.376) (-1232.044) * [-1222.005] (-1228.867) (-1221.225) (-1222.313) -- 0:03:02
67000 -- (-1227.451) (-1225.595) (-1230.807) [-1226.331] * (-1226.273) (-1226.839) (-1223.789) [-1224.554] -- 0:03:01
67500 -- (-1226.699) (-1233.369) (-1230.161) [-1232.598] * (-1232.748) [-1225.046] (-1228.462) (-1228.957) -- 0:02:59
68000 -- (-1229.436) (-1226.466) (-1236.250) [-1233.601] * (-1227.946) [-1223.928] (-1233.792) (-1227.304) -- 0:02:58
68500 -- [-1230.544] (-1228.750) (-1224.752) (-1233.305) * (-1228.135) (-1230.189) [-1222.628] (-1227.036) -- 0:02:56
69000 -- (-1230.167) (-1225.788) [-1228.879] (-1224.922) * [-1225.694] (-1224.617) (-1221.887) (-1228.769) -- 0:02:55
69500 -- (-1225.782) (-1227.108) [-1223.031] (-1227.453) * (-1227.590) (-1224.272) (-1220.838) [-1232.313] -- 0:02:54
70000 -- [-1228.892] (-1230.380) (-1236.632) (-1224.424) * (-1231.116) (-1227.778) (-1228.527) [-1235.385] -- 0:03:06
Average standard deviation of split frequencies: 0.015009
70500 -- [-1223.030] (-1229.073) (-1225.726) (-1229.122) * [-1224.868] (-1226.450) (-1228.260) (-1230.508) -- 0:03:04
71000 -- [-1223.152] (-1225.615) (-1223.838) (-1226.206) * (-1224.807) [-1220.854] (-1232.367) (-1223.968) -- 0:03:03
71500 -- (-1231.077) (-1225.898) [-1228.275] (-1227.281) * (-1225.090) (-1227.360) (-1231.051) [-1223.371] -- 0:03:01
72000 -- (-1229.310) [-1224.358] (-1231.235) (-1225.721) * (-1225.521) [-1224.582] (-1230.921) (-1227.749) -- 0:03:00
72500 -- (-1228.216) [-1227.530] (-1232.325) (-1225.871) * (-1227.623) [-1225.182] (-1227.619) (-1226.136) -- 0:02:59
73000 -- (-1226.674) (-1231.307) (-1230.213) [-1226.647] * (-1233.542) (-1226.558) [-1229.886] (-1224.408) -- 0:02:57
73500 -- (-1230.872) (-1224.991) [-1234.457] (-1220.972) * [-1225.383] (-1228.066) (-1225.025) (-1229.242) -- 0:02:56
74000 -- (-1227.199) (-1225.611) (-1226.150) [-1221.024] * (-1230.109) [-1223.841] (-1229.264) (-1227.344) -- 0:02:55
74500 -- (-1229.049) (-1228.640) [-1224.798] (-1225.720) * [-1221.711] (-1224.009) (-1233.587) (-1229.106) -- 0:02:53
75000 -- (-1228.877) (-1231.991) [-1227.841] (-1227.789) * (-1224.959) [-1226.253] (-1224.887) (-1225.251) -- 0:03:05
Average standard deviation of split frequencies: 0.017057
75500 -- (-1223.333) [-1225.901] (-1225.096) (-1227.414) * [-1223.863] (-1226.736) (-1229.847) (-1221.670) -- 0:03:03
76000 -- [-1221.776] (-1227.535) (-1225.183) (-1227.579) * [-1230.609] (-1230.802) (-1233.450) (-1225.758) -- 0:03:02
76500 -- (-1227.885) (-1230.390) [-1224.421] (-1223.613) * (-1230.125) (-1222.625) [-1228.752] (-1229.679) -- 0:03:01
77000 -- [-1231.321] (-1231.408) (-1224.447) (-1226.274) * (-1226.093) (-1225.061) (-1227.751) [-1223.281] -- 0:02:59
77500 -- (-1226.854) [-1226.930] (-1224.701) (-1226.990) * (-1225.156) (-1227.230) [-1227.611] (-1227.339) -- 0:02:58
78000 -- (-1224.328) [-1221.389] (-1226.802) (-1228.982) * (-1228.677) (-1226.332) [-1224.234] (-1223.789) -- 0:02:57
78500 -- (-1226.800) (-1220.981) [-1221.181] (-1221.444) * (-1231.860) (-1226.374) [-1226.513] (-1222.403) -- 0:02:56
79000 -- (-1225.526) (-1223.850) [-1225.909] (-1226.079) * (-1229.173) [-1229.241] (-1233.918) (-1229.413) -- 0:02:54
79500 -- (-1230.109) (-1226.112) (-1225.776) [-1226.198] * (-1227.108) (-1229.606) (-1228.168) [-1221.561] -- 0:02:53
80000 -- [-1227.761] (-1227.668) (-1231.052) (-1225.412) * [-1227.162] (-1231.918) (-1223.546) (-1230.075) -- 0:02:52
Average standard deviation of split frequencies: 0.027758
80500 -- [-1228.520] (-1227.177) (-1230.667) (-1233.728) * (-1225.761) [-1225.005] (-1232.987) (-1227.261) -- 0:03:02
81000 -- (-1234.396) (-1220.306) [-1225.523] (-1226.690) * (-1228.088) (-1230.030) (-1229.284) [-1231.878] -- 0:03:01
81500 -- (-1229.848) [-1230.635] (-1228.253) (-1223.433) * [-1223.541] (-1225.619) (-1230.393) (-1230.233) -- 0:03:00
82000 -- (-1233.849) (-1227.069) (-1226.699) [-1228.109] * [-1220.807] (-1228.662) (-1226.359) (-1225.852) -- 0:02:59
82500 -- (-1233.588) (-1227.615) [-1222.934] (-1225.841) * (-1227.617) (-1228.213) (-1230.832) [-1223.825] -- 0:02:57
83000 -- [-1235.209] (-1225.273) (-1227.225) (-1227.925) * (-1225.762) [-1223.895] (-1235.848) (-1225.830) -- 0:02:56
83500 -- (-1239.595) (-1222.197) [-1227.340] (-1227.239) * (-1223.986) (-1226.544) [-1225.817] (-1228.734) -- 0:02:55
84000 -- [-1226.984] (-1233.748) (-1228.184) (-1224.600) * [-1225.000] (-1230.632) (-1225.113) (-1225.834) -- 0:02:54
84500 -- (-1223.934) (-1227.950) (-1236.435) [-1223.632] * [-1222.554] (-1224.876) (-1225.679) (-1228.086) -- 0:02:53
85000 -- (-1223.323) (-1222.973) (-1231.072) [-1227.710] * (-1225.036) [-1231.322] (-1231.260) (-1220.147) -- 0:02:52
Average standard deviation of split frequencies: 0.028778
85500 -- (-1229.480) [-1228.071] (-1231.800) (-1227.126) * (-1228.561) (-1229.995) [-1225.675] (-1226.804) -- 0:02:51
86000 -- (-1233.251) (-1230.027) (-1226.338) [-1233.700] * (-1226.912) (-1223.099) (-1228.338) [-1224.448] -- 0:03:00
86500 -- [-1228.603] (-1224.320) (-1227.692) (-1228.292) * (-1222.591) (-1225.367) (-1227.956) [-1229.062] -- 0:02:59
87000 -- (-1226.074) (-1227.676) [-1223.232] (-1238.376) * (-1227.217) (-1229.880) (-1231.060) [-1226.868] -- 0:02:58
87500 -- (-1227.036) [-1227.599] (-1225.555) (-1228.084) * [-1227.884] (-1220.998) (-1230.472) (-1225.816) -- 0:02:57
88000 -- (-1226.439) (-1221.811) [-1225.719] (-1228.010) * (-1226.765) (-1223.497) (-1227.235) [-1226.750] -- 0:02:56
88500 -- (-1231.582) [-1222.208] (-1225.004) (-1227.536) * (-1223.435) (-1240.848) [-1226.158] (-1225.208) -- 0:02:55
89000 -- (-1229.023) (-1223.065) [-1225.802] (-1230.015) * (-1228.261) (-1227.837) (-1233.061) [-1220.610] -- 0:02:54
89500 -- (-1226.947) [-1227.049] (-1224.286) (-1229.330) * (-1225.381) (-1225.677) (-1236.241) [-1219.996] -- 0:02:52
90000 -- (-1224.834) (-1235.545) (-1222.817) [-1228.288] * (-1231.905) (-1226.865) [-1232.250] (-1225.534) -- 0:02:51
Average standard deviation of split frequencies: 0.029896
90500 -- (-1225.126) [-1232.303] (-1224.742) (-1225.495) * [-1228.702] (-1223.368) (-1230.117) (-1229.064) -- 0:02:50
91000 -- (-1231.448) [-1225.139] (-1237.643) (-1229.674) * (-1228.427) [-1226.347] (-1225.719) (-1226.288) -- 0:02:49
91500 -- (-1230.513) [-1227.600] (-1225.808) (-1227.579) * (-1225.975) [-1224.608] (-1230.238) (-1227.717) -- 0:02:58
92000 -- (-1232.178) (-1229.451) [-1221.237] (-1223.163) * (-1224.467) [-1228.067] (-1233.484) (-1234.869) -- 0:02:57
92500 -- (-1236.835) [-1229.888] (-1228.424) (-1229.954) * (-1227.751) (-1221.727) [-1226.908] (-1238.036) -- 0:02:56
93000 -- (-1224.372) (-1228.822) [-1223.548] (-1224.269) * [-1233.020] (-1224.304) (-1233.248) (-1239.905) -- 0:02:55
93500 -- (-1227.517) (-1234.587) (-1228.809) [-1223.119] * (-1225.959) (-1235.320) (-1227.590) [-1224.832] -- 0:02:54
94000 -- (-1229.181) (-1227.565) [-1226.092] (-1236.277) * [-1224.753] (-1226.579) (-1232.211) (-1226.572) -- 0:02:53
94500 -- (-1226.745) (-1228.652) [-1233.936] (-1227.710) * (-1221.302) (-1222.422) (-1231.404) [-1222.111] -- 0:02:52
95000 -- (-1235.365) (-1232.347) [-1224.243] (-1224.685) * [-1224.037] (-1227.919) (-1225.248) (-1223.467) -- 0:02:51
Average standard deviation of split frequencies: 0.040511
95500 -- (-1229.186) (-1220.210) (-1226.876) [-1227.076] * [-1225.390] (-1228.767) (-1223.593) (-1222.352) -- 0:02:50
96000 -- (-1226.211) (-1220.807) (-1227.237) [-1227.434] * (-1227.225) (-1223.089) [-1222.674] (-1227.968) -- 0:02:49
96500 -- [-1224.257] (-1226.228) (-1226.384) (-1223.676) * (-1224.462) [-1221.493] (-1227.408) (-1224.783) -- 0:02:57
97000 -- (-1233.819) [-1226.828] (-1228.521) (-1225.558) * (-1228.637) (-1222.250) (-1223.842) [-1227.858] -- 0:02:56
97500 -- (-1234.252) (-1223.949) (-1229.008) [-1222.142] * [-1224.922] (-1223.595) (-1227.562) (-1227.164) -- 0:02:55
98000 -- [-1230.024] (-1225.228) (-1231.118) (-1226.904) * [-1220.749] (-1223.546) (-1224.869) (-1227.023) -- 0:02:54
98500 -- (-1231.655) (-1224.137) (-1229.070) [-1225.139] * (-1223.027) [-1225.283] (-1221.962) (-1222.351) -- 0:02:53
99000 -- (-1230.863) [-1223.054] (-1225.478) (-1226.196) * (-1227.836) (-1231.947) (-1224.577) [-1225.489] -- 0:02:52
99500 -- (-1225.474) (-1224.543) (-1226.697) [-1223.085] * (-1225.439) (-1229.173) [-1227.304] (-1224.388) -- 0:02:51
100000 -- (-1228.107) [-1223.282] (-1224.063) (-1228.585) * (-1226.161) [-1225.063] (-1228.634) (-1232.234) -- 0:02:51
Average standard deviation of split frequencies: 0.033950
100500 -- (-1226.574) (-1226.800) (-1229.472) [-1225.318] * [-1223.167] (-1225.299) (-1228.246) (-1228.136) -- 0:02:50
101000 -- (-1225.609) [-1230.248] (-1232.564) (-1224.710) * (-1222.987) [-1223.065] (-1226.337) (-1228.359) -- 0:02:49
101500 -- (-1224.122) [-1222.002] (-1229.198) (-1226.906) * (-1225.784) (-1224.180) [-1221.987] (-1224.333) -- 0:02:48
102000 -- (-1220.520) (-1225.207) [-1223.958] (-1225.840) * (-1224.683) (-1224.213) [-1226.883] (-1232.036) -- 0:02:56
102500 -- (-1226.907) (-1231.811) (-1229.694) [-1226.817] * (-1230.156) (-1223.518) [-1224.823] (-1225.944) -- 0:02:55
103000 -- (-1226.158) (-1227.793) [-1225.726] (-1229.959) * (-1228.617) (-1226.310) (-1225.022) [-1222.643] -- 0:02:54
103500 -- [-1226.994] (-1223.461) (-1227.551) (-1225.945) * (-1222.893) (-1232.357) (-1230.389) [-1223.712] -- 0:02:53
104000 -- (-1226.885) (-1222.102) (-1226.967) [-1225.909] * (-1221.066) [-1221.306] (-1223.536) (-1225.040) -- 0:02:52
104500 -- (-1231.004) (-1231.537) (-1228.045) [-1225.648] * (-1230.423) [-1224.141] (-1228.129) (-1230.494) -- 0:02:51
105000 -- (-1229.879) (-1224.338) (-1223.409) [-1226.495] * (-1229.681) (-1227.258) [-1222.781] (-1222.148) -- 0:02:50
Average standard deviation of split frequencies: 0.034466
105500 -- (-1222.667) [-1225.488] (-1230.670) (-1226.140) * (-1228.485) (-1225.752) [-1230.060] (-1229.447) -- 0:02:49
106000 -- (-1225.120) [-1228.070] (-1234.243) (-1229.099) * (-1227.628) [-1223.572] (-1225.825) (-1226.361) -- 0:02:48
106500 -- (-1237.561) (-1227.859) [-1226.070] (-1227.744) * [-1229.355] (-1228.586) (-1226.234) (-1229.566) -- 0:02:47
107000 -- [-1228.091] (-1231.969) (-1225.076) (-1223.254) * (-1226.679) (-1229.609) [-1229.428] (-1232.052) -- 0:02:55
107500 -- (-1223.023) (-1233.347) [-1227.239] (-1227.649) * (-1228.843) (-1231.329) (-1230.670) [-1230.114] -- 0:02:54
108000 -- (-1227.647) (-1228.772) (-1226.652) [-1233.169] * (-1225.578) (-1226.422) [-1224.651] (-1229.964) -- 0:02:53
108500 -- (-1230.250) (-1233.067) [-1225.278] (-1228.619) * (-1226.907) [-1224.669] (-1227.649) (-1231.250) -- 0:02:52
109000 -- [-1221.248] (-1232.218) (-1228.382) (-1223.975) * (-1234.469) [-1223.268] (-1230.253) (-1224.850) -- 0:02:51
109500 -- (-1223.428) (-1233.004) (-1225.363) [-1227.271] * (-1229.762) (-1222.762) (-1225.581) [-1229.648] -- 0:02:50
110000 -- (-1224.842) (-1229.777) [-1222.213] (-1239.824) * [-1224.069] (-1224.595) (-1232.025) (-1226.628) -- 0:02:49
Average standard deviation of split frequencies: 0.038337
110500 -- (-1228.493) [-1237.485] (-1222.152) (-1230.638) * (-1224.937) (-1231.608) (-1226.985) [-1227.481] -- 0:02:49
111000 -- [-1225.183] (-1240.557) (-1224.872) (-1239.019) * (-1222.633) (-1225.599) (-1232.857) [-1222.245] -- 0:02:48
111500 -- (-1223.251) (-1229.880) [-1224.574] (-1229.626) * (-1227.405) [-1223.195] (-1227.857) (-1226.578) -- 0:02:47
112000 -- (-1225.528) (-1231.622) [-1223.410] (-1229.981) * (-1223.821) (-1231.282) [-1237.692] (-1229.028) -- 0:02:46
112500 -- (-1228.116) (-1225.841) (-1225.457) [-1224.827] * [-1225.185] (-1223.280) (-1230.008) (-1226.089) -- 0:02:53
113000 -- (-1228.694) [-1225.698] (-1224.254) (-1227.476) * [-1226.852] (-1227.794) (-1221.304) (-1228.371) -- 0:02:52
113500 -- (-1224.783) [-1227.692] (-1231.066) (-1221.990) * (-1229.805) (-1225.732) [-1223.125] (-1228.803) -- 0:02:51
114000 -- (-1223.332) [-1222.153] (-1223.880) (-1227.881) * (-1224.546) (-1229.670) (-1227.093) [-1223.663] -- 0:02:50
114500 -- [-1227.274] (-1225.959) (-1223.521) (-1227.193) * (-1225.421) (-1221.612) (-1221.544) [-1223.408] -- 0:02:50
115000 -- [-1229.116] (-1231.338) (-1230.662) (-1223.988) * [-1226.494] (-1223.719) (-1235.172) (-1222.394) -- 0:02:49
Average standard deviation of split frequencies: 0.030479
115500 -- [-1223.194] (-1230.149) (-1222.574) (-1223.314) * (-1226.499) [-1228.716] (-1232.956) (-1225.482) -- 0:02:48
116000 -- [-1227.015] (-1230.607) (-1229.431) (-1229.890) * (-1224.858) [-1233.704] (-1226.969) (-1222.028) -- 0:02:47
116500 -- (-1223.035) [-1228.243] (-1230.864) (-1229.107) * (-1224.009) [-1230.167] (-1229.836) (-1224.313) -- 0:02:46
117000 -- (-1224.316) [-1222.823] (-1229.099) (-1227.071) * (-1228.166) (-1228.663) (-1226.187) [-1221.602] -- 0:02:46
117500 -- [-1225.740] (-1229.940) (-1227.474) (-1229.377) * [-1224.809] (-1224.524) (-1226.066) (-1227.772) -- 0:02:45
118000 -- (-1228.219) [-1223.608] (-1227.026) (-1224.051) * [-1226.410] (-1227.581) (-1231.677) (-1227.330) -- 0:02:51
118500 -- (-1225.275) (-1233.384) [-1228.206] (-1224.927) * (-1227.373) (-1224.339) [-1220.215] (-1233.524) -- 0:02:51
119000 -- (-1222.014) [-1222.744] (-1225.993) (-1222.322) * (-1229.717) [-1223.966] (-1224.543) (-1220.745) -- 0:02:50
119500 -- [-1222.311] (-1226.013) (-1234.893) (-1228.958) * [-1229.342] (-1221.614) (-1231.635) (-1221.677) -- 0:02:49
120000 -- (-1227.999) (-1221.565) (-1224.931) [-1224.945] * (-1231.367) (-1227.599) (-1226.410) [-1225.696] -- 0:02:48
Average standard deviation of split frequencies: 0.030277
120500 -- (-1229.415) [-1222.537] (-1224.004) (-1225.936) * (-1228.584) [-1228.110] (-1226.996) (-1222.821) -- 0:02:47
121000 -- (-1231.431) [-1222.295] (-1227.950) (-1223.345) * (-1230.304) (-1227.079) [-1229.621] (-1222.569) -- 0:02:47
121500 -- (-1225.835) (-1225.315) [-1225.303] (-1226.581) * (-1224.161) (-1224.772) [-1226.821] (-1228.074) -- 0:02:46
122000 -- (-1222.761) [-1225.590] (-1231.538) (-1231.418) * [-1224.349] (-1223.816) (-1227.138) (-1222.652) -- 0:02:45
122500 -- (-1226.447) [-1225.642] (-1223.450) (-1233.684) * (-1227.274) (-1226.831) (-1226.748) [-1229.347] -- 0:02:44
123000 -- (-1226.338) (-1231.897) [-1226.479] (-1233.060) * (-1222.090) (-1227.513) [-1227.732] (-1224.774) -- 0:02:43
123500 -- (-1229.057) [-1226.518] (-1230.834) (-1235.496) * [-1222.956] (-1225.620) (-1229.492) (-1228.159) -- 0:02:50
124000 -- (-1237.628) (-1233.698) [-1226.990] (-1235.403) * (-1222.189) (-1222.470) (-1225.215) [-1225.814] -- 0:02:49
124500 -- (-1232.995) [-1229.326] (-1225.917) (-1233.779) * (-1224.222) (-1223.319) (-1227.295) [-1227.623] -- 0:02:48
125000 -- (-1238.403) (-1225.635) [-1225.377] (-1232.204) * (-1231.721) [-1226.411] (-1221.760) (-1227.538) -- 0:02:48
Average standard deviation of split frequencies: 0.027124
125500 -- (-1230.378) [-1225.931] (-1229.055) (-1237.213) * (-1224.687) (-1229.243) (-1226.333) [-1230.666] -- 0:02:47
126000 -- (-1230.294) (-1230.792) (-1221.302) [-1225.182] * (-1226.686) (-1223.941) (-1228.069) [-1229.703] -- 0:02:46
126500 -- (-1241.078) (-1229.209) (-1226.993) [-1224.952] * (-1231.537) [-1227.599] (-1228.387) (-1229.385) -- 0:02:45
127000 -- [-1227.600] (-1222.454) (-1228.067) (-1228.852) * [-1230.375] (-1226.408) (-1227.459) (-1227.778) -- 0:02:44
127500 -- (-1226.971) (-1228.534) (-1230.144) [-1222.718] * (-1224.704) (-1226.628) (-1224.913) [-1229.597] -- 0:02:44
128000 -- (-1224.157) (-1226.670) (-1227.882) [-1227.744] * [-1224.698] (-1225.320) (-1227.158) (-1228.179) -- 0:02:43
128500 -- (-1226.873) (-1222.121) [-1225.983] (-1225.400) * [-1223.145] (-1225.225) (-1234.062) (-1230.263) -- 0:02:49
129000 -- (-1226.038) [-1225.798] (-1227.002) (-1223.195) * (-1232.422) (-1226.118) [-1229.699] (-1225.541) -- 0:02:48
129500 -- (-1224.762) [-1227.808] (-1220.743) (-1225.856) * (-1222.840) [-1224.693] (-1228.367) (-1232.278) -- 0:02:48
130000 -- (-1220.288) (-1225.216) [-1227.338] (-1229.214) * (-1225.425) (-1229.871) [-1224.915] (-1226.598) -- 0:02:47
Average standard deviation of split frequencies: 0.020744
130500 -- (-1230.532) [-1222.342] (-1227.065) (-1231.715) * (-1224.150) (-1226.290) [-1231.419] (-1222.010) -- 0:02:46
131000 -- [-1225.523] (-1235.401) (-1222.901) (-1239.959) * (-1225.103) (-1226.613) (-1225.299) [-1221.864] -- 0:02:45
131500 -- (-1229.291) (-1223.335) [-1227.010] (-1232.720) * (-1225.067) (-1228.914) [-1221.884] (-1228.245) -- 0:02:45
132000 -- (-1227.792) (-1222.870) (-1224.849) [-1227.353] * [-1226.731] (-1230.205) (-1223.859) (-1230.830) -- 0:02:44
132500 -- (-1229.332) (-1226.084) [-1221.566] (-1228.056) * (-1232.981) (-1228.092) (-1227.744) [-1226.911] -- 0:02:43
133000 -- (-1226.576) (-1228.643) [-1225.507] (-1227.760) * (-1229.582) (-1228.460) (-1221.756) [-1227.722] -- 0:02:42
133500 -- (-1230.517) [-1222.580] (-1227.711) (-1225.048) * (-1222.670) (-1227.136) (-1230.919) [-1226.012] -- 0:02:42
134000 -- [-1233.548] (-1227.493) (-1225.612) (-1229.787) * [-1220.987] (-1237.599) (-1229.290) (-1231.062) -- 0:02:48
134500 -- (-1230.502) (-1230.340) (-1224.392) [-1224.206] * [-1222.990] (-1232.241) (-1224.563) (-1224.631) -- 0:02:47
135000 -- (-1223.967) [-1221.091] (-1226.391) (-1220.476) * (-1227.882) [-1227.567] (-1225.104) (-1232.017) -- 0:02:46
Average standard deviation of split frequencies: 0.018198
135500 -- (-1227.576) [-1222.950] (-1221.832) (-1224.219) * (-1223.890) (-1229.753) [-1220.096] (-1227.068) -- 0:02:45
136000 -- (-1229.936) (-1223.871) [-1226.075] (-1227.817) * (-1225.494) (-1227.465) [-1224.776] (-1222.535) -- 0:02:45
136500 -- (-1229.987) [-1222.325] (-1226.036) (-1228.413) * (-1222.304) (-1229.185) (-1225.269) [-1225.796] -- 0:02:44
137000 -- (-1225.872) (-1229.600) (-1231.077) [-1223.508] * (-1227.137) (-1229.700) [-1220.944] (-1230.519) -- 0:02:43
137500 -- [-1224.374] (-1225.060) (-1229.673) (-1226.366) * (-1226.839) (-1225.878) (-1230.557) [-1228.330] -- 0:02:43
138000 -- (-1227.749) (-1224.104) (-1231.160) [-1229.078] * (-1223.956) (-1230.302) (-1238.440) [-1223.604] -- 0:02:42
138500 -- (-1230.364) [-1227.987] (-1227.847) (-1227.560) * (-1223.296) [-1228.411] (-1228.114) (-1230.291) -- 0:02:41
139000 -- (-1226.916) (-1225.850) [-1223.173] (-1224.528) * (-1224.411) (-1229.168) [-1224.403] (-1227.930) -- 0:02:41
139500 -- (-1225.120) (-1227.286) (-1230.828) [-1226.687] * [-1225.853] (-1227.941) (-1224.446) (-1224.584) -- 0:02:46
140000 -- (-1223.570) (-1226.654) (-1229.340) [-1226.296] * [-1224.174] (-1225.571) (-1232.398) (-1224.653) -- 0:02:45
Average standard deviation of split frequencies: 0.020945
140500 -- (-1222.647) (-1222.952) (-1226.594) [-1226.113] * [-1228.891] (-1226.991) (-1224.954) (-1227.366) -- 0:02:45
141000 -- (-1221.616) (-1230.170) [-1222.302] (-1222.472) * (-1223.197) [-1224.679] (-1231.118) (-1221.548) -- 0:02:44
141500 -- (-1226.342) (-1226.416) (-1226.476) [-1224.128] * [-1224.516] (-1232.428) (-1225.122) (-1226.972) -- 0:02:43
142000 -- (-1230.024) [-1223.816] (-1224.441) (-1226.407) * (-1226.516) [-1226.659] (-1229.837) (-1225.397) -- 0:02:43
142500 -- (-1232.224) (-1223.640) [-1224.041] (-1239.652) * (-1232.557) (-1225.869) [-1225.634] (-1233.290) -- 0:02:42
143000 -- (-1224.267) (-1229.470) [-1222.191] (-1226.923) * (-1227.057) [-1228.387] (-1224.058) (-1228.993) -- 0:02:41
143500 -- (-1227.016) (-1228.920) (-1226.992) [-1222.162] * [-1230.274] (-1225.873) (-1222.551) (-1230.445) -- 0:02:41
144000 -- (-1228.522) [-1227.018] (-1224.849) (-1226.734) * (-1222.714) (-1226.868) [-1221.897] (-1231.077) -- 0:02:40
144500 -- (-1223.186) (-1224.165) (-1225.331) [-1222.117] * (-1227.413) (-1230.168) [-1222.165] (-1230.385) -- 0:02:39
145000 -- (-1225.849) [-1228.123] (-1223.793) (-1224.364) * [-1226.315] (-1227.431) (-1220.394) (-1223.770) -- 0:02:45
Average standard deviation of split frequencies: 0.023409
145500 -- (-1230.170) (-1225.743) [-1226.864] (-1225.754) * (-1224.412) (-1234.003) (-1225.491) [-1221.135] -- 0:02:44
146000 -- (-1228.492) (-1225.933) [-1225.044] (-1230.484) * [-1227.167] (-1226.379) (-1225.328) (-1229.965) -- 0:02:43
146500 -- (-1232.271) (-1229.818) [-1227.557] (-1226.521) * (-1228.694) (-1224.001) (-1230.295) [-1226.349] -- 0:02:43
147000 -- (-1227.450) [-1227.108] (-1226.719) (-1228.108) * [-1223.385] (-1235.184) (-1228.554) (-1226.583) -- 0:02:42
147500 -- [-1224.517] (-1235.242) (-1231.018) (-1225.390) * (-1228.956) [-1222.739] (-1228.752) (-1230.486) -- 0:02:41
148000 -- (-1230.672) (-1233.418) (-1226.962) [-1223.386] * (-1227.303) (-1230.480) [-1225.694] (-1222.818) -- 0:02:41
148500 -- (-1227.091) (-1228.056) (-1229.593) [-1229.702] * [-1224.640] (-1229.716) (-1226.109) (-1227.185) -- 0:02:40
149000 -- (-1225.062) (-1235.942) [-1223.740] (-1230.277) * [-1228.047] (-1226.764) (-1225.330) (-1224.339) -- 0:02:39
149500 -- (-1227.443) [-1223.591] (-1221.143) (-1229.906) * (-1227.730) [-1224.958] (-1226.281) (-1223.488) -- 0:02:39
150000 -- (-1228.741) [-1229.392] (-1228.851) (-1228.143) * [-1228.132] (-1230.526) (-1228.820) (-1232.289) -- 0:02:44
Average standard deviation of split frequencies: 0.019555
150500 -- (-1222.155) [-1228.536] (-1220.782) (-1229.248) * (-1230.883) [-1232.070] (-1225.653) (-1230.900) -- 0:02:43
151000 -- [-1230.567] (-1232.907) (-1228.562) (-1224.868) * [-1231.767] (-1230.202) (-1233.849) (-1226.483) -- 0:02:43
151500 -- (-1227.357) (-1227.900) [-1224.796] (-1224.092) * (-1225.361) (-1226.344) (-1235.507) [-1221.846] -- 0:02:42
152000 -- (-1228.571) [-1232.670] (-1226.949) (-1227.209) * [-1225.274] (-1228.017) (-1229.176) (-1228.459) -- 0:02:41
152500 -- (-1238.853) [-1228.575] (-1221.889) (-1225.275) * (-1228.448) (-1230.259) [-1225.997] (-1225.561) -- 0:02:41
153000 -- (-1227.979) (-1222.984) [-1223.508] (-1227.368) * (-1221.625) (-1224.601) [-1222.170] (-1226.801) -- 0:02:40
153500 -- (-1226.414) (-1226.663) (-1224.220) [-1220.709] * (-1226.504) [-1226.301] (-1224.551) (-1235.355) -- 0:02:39
154000 -- (-1231.231) [-1222.664] (-1225.239) (-1222.883) * (-1237.198) [-1227.498] (-1223.214) (-1231.493) -- 0:02:39
154500 -- (-1222.969) (-1224.423) [-1224.189] (-1230.758) * [-1227.917] (-1235.213) (-1223.333) (-1231.114) -- 0:02:38
155000 -- (-1223.271) (-1226.149) [-1225.090] (-1225.543) * (-1228.842) (-1232.451) [-1229.191] (-1233.208) -- 0:02:38
Average standard deviation of split frequencies: 0.018131
155500 -- [-1222.584] (-1231.914) (-1225.854) (-1226.469) * (-1229.603) (-1242.538) (-1226.883) [-1225.858] -- 0:02:42
156000 -- (-1228.436) (-1231.387) (-1232.046) [-1225.838] * (-1229.101) (-1234.465) [-1225.050] (-1230.226) -- 0:02:42
156500 -- [-1228.956] (-1233.352) (-1233.687) (-1223.951) * [-1226.721] (-1238.178) (-1226.095) (-1228.321) -- 0:02:41
157000 -- [-1223.648] (-1234.450) (-1241.583) (-1226.077) * (-1233.515) (-1228.470) [-1230.290] (-1231.839) -- 0:02:41
157500 -- (-1225.834) (-1231.542) (-1233.211) [-1228.412] * (-1226.320) [-1233.894] (-1226.912) (-1223.381) -- 0:02:40
158000 -- (-1223.664) (-1233.513) (-1224.936) [-1224.989] * (-1225.514) (-1231.674) (-1225.789) [-1226.731] -- 0:02:39
158500 -- (-1222.976) (-1240.181) [-1224.617] (-1227.533) * (-1223.741) (-1227.873) (-1228.149) [-1222.695] -- 0:02:39
159000 -- [-1225.389] (-1229.267) (-1224.577) (-1224.117) * (-1225.207) [-1227.786] (-1233.036) (-1224.761) -- 0:02:38
159500 -- (-1228.544) (-1236.614) [-1228.020] (-1223.446) * [-1225.539] (-1223.578) (-1229.094) (-1225.992) -- 0:02:38
160000 -- (-1229.785) (-1228.218) (-1233.221) [-1220.708] * (-1228.383) (-1229.521) (-1226.081) [-1222.702] -- 0:02:37
Average standard deviation of split frequencies: 0.022005
160500 -- (-1225.815) [-1221.998] (-1227.387) (-1223.553) * (-1226.719) [-1228.485] (-1228.376) (-1223.304) -- 0:02:42
161000 -- (-1230.941) (-1224.806) [-1224.387] (-1225.215) * (-1221.199) (-1227.667) [-1226.392] (-1225.517) -- 0:02:41
161500 -- (-1227.955) [-1226.305] (-1226.764) (-1228.729) * (-1222.852) (-1233.994) (-1224.030) [-1222.887] -- 0:02:40
162000 -- [-1230.117] (-1225.055) (-1227.402) (-1222.942) * (-1233.549) (-1227.041) (-1224.352) [-1228.685] -- 0:02:40
162500 -- (-1225.734) (-1225.244) (-1227.152) [-1221.784] * [-1224.793] (-1228.432) (-1226.107) (-1222.456) -- 0:02:39
163000 -- [-1226.354] (-1227.560) (-1228.586) (-1222.461) * [-1230.986] (-1224.988) (-1228.580) (-1228.955) -- 0:02:39
163500 -- (-1230.193) (-1226.321) (-1225.167) [-1226.872] * [-1226.834] (-1226.723) (-1232.316) (-1227.332) -- 0:02:38
164000 -- (-1226.694) [-1228.723] (-1221.868) (-1233.102) * (-1223.570) (-1226.860) (-1233.317) [-1224.371] -- 0:02:38
164500 -- (-1227.901) (-1227.708) (-1229.688) [-1229.722] * (-1229.633) (-1232.489) (-1225.945) [-1225.155] -- 0:02:37
165000 -- [-1229.393] (-1229.464) (-1225.030) (-1227.571) * (-1226.861) (-1230.017) [-1221.341] (-1225.159) -- 0:02:36
Average standard deviation of split frequencies: 0.023428
165500 -- (-1228.120) (-1230.471) [-1229.099] (-1224.370) * (-1227.556) [-1229.550] (-1223.674) (-1222.156) -- 0:02:36
166000 -- (-1223.294) (-1227.888) [-1232.037] (-1224.058) * (-1229.086) (-1232.079) [-1221.981] (-1222.589) -- 0:02:40
166500 -- (-1234.662) (-1221.973) [-1229.935] (-1229.348) * [-1223.860] (-1227.206) (-1225.103) (-1224.549) -- 0:02:40
167000 -- (-1224.469) (-1221.834) (-1233.075) [-1224.604] * (-1232.703) (-1226.082) [-1224.641] (-1231.737) -- 0:02:39
167500 -- (-1226.355) (-1223.816) [-1223.607] (-1229.075) * (-1227.757) [-1227.293] (-1224.532) (-1230.813) -- 0:02:39
168000 -- (-1224.568) (-1230.397) [-1225.283] (-1232.480) * [-1226.253] (-1229.595) (-1230.213) (-1233.477) -- 0:02:38
168500 -- (-1222.139) (-1226.825) (-1226.721) [-1228.083] * (-1225.942) (-1227.959) (-1225.289) [-1229.291] -- 0:02:37
169000 -- (-1225.432) (-1236.942) [-1228.574] (-1230.297) * [-1231.902] (-1229.676) (-1228.068) (-1227.717) -- 0:02:37
169500 -- [-1224.926] (-1226.584) (-1223.260) (-1232.262) * (-1230.341) (-1225.672) [-1226.045] (-1232.971) -- 0:02:36
170000 -- [-1227.117] (-1227.437) (-1230.285) (-1226.744) * (-1228.792) (-1223.663) [-1228.058] (-1224.280) -- 0:02:36
Average standard deviation of split frequencies: 0.017954
170500 -- (-1235.560) [-1224.879] (-1221.913) (-1224.550) * (-1226.689) [-1233.607] (-1225.756) (-1229.348) -- 0:02:35
171000 -- (-1225.606) (-1221.156) [-1225.434] (-1227.038) * [-1224.995] (-1228.776) (-1228.806) (-1228.852) -- 0:02:35
171500 -- (-1228.963) (-1221.321) [-1224.430] (-1231.727) * (-1226.873) (-1231.338) (-1223.949) [-1225.820] -- 0:02:39
172000 -- (-1229.527) (-1228.696) [-1223.063] (-1230.392) * (-1221.417) [-1227.320] (-1229.546) (-1227.598) -- 0:02:38
172500 -- (-1226.558) (-1225.110) (-1231.422) [-1232.005] * [-1223.834] (-1225.013) (-1227.777) (-1232.230) -- 0:02:38
173000 -- (-1233.321) [-1224.244] (-1227.725) (-1225.272) * [-1227.744] (-1227.734) (-1226.722) (-1235.231) -- 0:02:37
173500 -- (-1235.275) (-1220.525) (-1230.157) [-1223.745] * (-1225.158) [-1222.241] (-1224.426) (-1230.318) -- 0:02:37
174000 -- (-1229.856) [-1223.090] (-1228.913) (-1226.882) * (-1228.064) [-1231.189] (-1229.113) (-1230.244) -- 0:02:36
174500 -- (-1232.167) [-1233.655] (-1224.984) (-1230.794) * (-1227.201) (-1224.968) (-1227.846) [-1230.639] -- 0:02:36
175000 -- [-1228.384] (-1228.638) (-1233.422) (-1228.355) * [-1220.284] (-1239.825) (-1229.417) (-1226.415) -- 0:02:35
Average standard deviation of split frequencies: 0.014731
175500 -- (-1230.006) [-1222.486] (-1226.254) (-1225.310) * (-1228.786) (-1229.782) [-1233.137] (-1221.937) -- 0:02:35
176000 -- (-1225.938) [-1231.144] (-1225.712) (-1225.788) * [-1226.612] (-1226.523) (-1229.612) (-1228.311) -- 0:02:34
176500 -- (-1222.928) (-1226.910) (-1235.421) [-1226.190] * (-1223.937) (-1226.456) (-1226.749) [-1230.108] -- 0:02:38
177000 -- (-1226.600) (-1225.774) (-1227.926) [-1227.077] * (-1225.034) (-1232.132) [-1226.254] (-1225.855) -- 0:02:38
177500 -- (-1231.396) [-1225.267] (-1227.968) (-1237.597) * [-1224.772] (-1224.484) (-1230.351) (-1221.728) -- 0:02:37
178000 -- (-1223.474) (-1227.504) (-1228.085) [-1229.565] * [-1221.879] (-1223.916) (-1226.909) (-1232.733) -- 0:02:37
178500 -- (-1238.093) (-1230.231) (-1229.665) [-1228.156] * (-1224.003) (-1222.275) (-1224.209) [-1224.920] -- 0:02:36
179000 -- (-1225.181) (-1233.224) [-1227.843] (-1225.065) * (-1223.634) [-1233.853] (-1236.608) (-1223.615) -- 0:02:35
179500 -- [-1220.330] (-1235.501) (-1227.677) (-1225.429) * (-1230.039) [-1223.551] (-1222.912) (-1225.122) -- 0:02:35
180000 -- (-1224.729) (-1230.997) [-1227.840] (-1223.922) * (-1222.286) (-1227.991) [-1225.438] (-1222.747) -- 0:02:34
Average standard deviation of split frequencies: 0.020874
180500 -- (-1226.497) (-1226.594) (-1225.046) [-1223.861] * [-1221.604] (-1232.681) (-1227.781) (-1227.906) -- 0:02:34
181000 -- (-1222.559) (-1229.523) [-1222.856] (-1229.652) * (-1225.940) (-1229.903) [-1221.923] (-1228.107) -- 0:02:33
181500 -- (-1226.237) [-1229.225] (-1228.384) (-1226.945) * (-1223.506) (-1222.385) (-1223.718) [-1220.729] -- 0:02:33
182000 -- [-1224.773] (-1220.411) (-1227.848) (-1233.729) * [-1223.580] (-1231.164) (-1223.128) (-1223.011) -- 0:02:37
182500 -- [-1224.926] (-1220.042) (-1227.189) (-1227.543) * [-1220.308] (-1232.233) (-1222.989) (-1224.484) -- 0:02:36
183000 -- (-1225.679) (-1227.591) (-1227.973) [-1229.011] * [-1223.013] (-1226.971) (-1221.592) (-1230.211) -- 0:02:36
183500 -- (-1224.975) (-1224.479) [-1226.236] (-1224.864) * (-1235.244) (-1230.257) [-1223.615] (-1230.253) -- 0:02:35
184000 -- (-1224.611) (-1232.165) (-1225.289) [-1224.242] * (-1231.695) [-1227.130] (-1226.484) (-1224.014) -- 0:02:35
184500 -- (-1226.408) [-1223.552] (-1224.611) (-1231.439) * [-1231.672] (-1229.184) (-1234.702) (-1226.570) -- 0:02:34
185000 -- [-1225.746] (-1225.608) (-1236.928) (-1230.861) * (-1225.417) (-1230.488) (-1227.193) [-1224.802] -- 0:02:34
Average standard deviation of split frequencies: 0.019008
185500 -- [-1222.103] (-1227.124) (-1239.255) (-1226.330) * (-1225.693) [-1222.058] (-1224.743) (-1226.817) -- 0:02:33
186000 -- [-1225.063] (-1225.310) (-1233.578) (-1225.029) * [-1229.537] (-1229.305) (-1224.576) (-1228.051) -- 0:02:33
186500 -- (-1223.640) [-1221.202] (-1225.790) (-1220.834) * (-1224.857) (-1226.563) [-1225.925] (-1231.063) -- 0:02:32
187000 -- [-1226.953] (-1225.335) (-1226.926) (-1226.644) * (-1224.522) (-1226.131) [-1228.143] (-1235.154) -- 0:02:32
187500 -- (-1225.137) [-1225.324] (-1227.900) (-1229.228) * (-1226.851) (-1223.599) [-1223.338] (-1225.453) -- 0:02:36
188000 -- (-1224.664) [-1221.331] (-1228.552) (-1229.244) * (-1223.628) [-1226.708] (-1228.042) (-1224.577) -- 0:02:35
188500 -- (-1232.111) (-1227.606) [-1221.552] (-1240.425) * [-1222.319] (-1227.030) (-1230.450) (-1230.080) -- 0:02:34
189000 -- (-1224.217) [-1227.870] (-1224.481) (-1231.554) * (-1227.849) [-1224.141] (-1224.218) (-1223.842) -- 0:02:34
189500 -- [-1227.990] (-1222.175) (-1223.582) (-1225.663) * (-1223.768) (-1228.839) [-1224.457] (-1222.954) -- 0:02:33
190000 -- [-1228.155] (-1222.472) (-1225.321) (-1228.486) * (-1229.533) [-1231.006] (-1221.875) (-1223.193) -- 0:02:33
Average standard deviation of split frequencies: 0.008653
190500 -- (-1223.422) (-1225.322) [-1223.923] (-1223.172) * (-1228.031) [-1230.843] (-1227.092) (-1225.340) -- 0:02:32
191000 -- [-1226.628] (-1229.314) (-1227.673) (-1226.995) * (-1229.733) (-1229.875) [-1225.626] (-1224.632) -- 0:02:32
191500 -- [-1231.298] (-1222.027) (-1224.009) (-1225.848) * [-1227.839] (-1225.846) (-1223.778) (-1223.111) -- 0:02:31
192000 -- (-1226.807) [-1228.634] (-1225.493) (-1222.541) * [-1222.844] (-1223.752) (-1229.159) (-1224.077) -- 0:02:31
192500 -- (-1222.104) [-1225.770] (-1226.855) (-1232.845) * (-1226.490) [-1224.788] (-1231.277) (-1223.825) -- 0:02:35
193000 -- (-1222.287) (-1229.755) [-1230.470] (-1236.595) * [-1221.677] (-1229.288) (-1235.004) (-1226.375) -- 0:02:34
193500 -- (-1229.993) (-1222.008) [-1227.017] (-1231.412) * (-1230.076) [-1228.699] (-1225.213) (-1226.410) -- 0:02:34
194000 -- [-1226.824] (-1225.385) (-1225.341) (-1232.885) * (-1221.969) [-1225.755] (-1228.171) (-1225.647) -- 0:02:33
194500 -- [-1225.356] (-1226.505) (-1221.720) (-1235.197) * (-1223.128) (-1227.589) (-1227.058) [-1231.736] -- 0:02:33
195000 -- [-1224.703] (-1223.099) (-1224.305) (-1224.034) * (-1221.872) [-1231.878] (-1235.877) (-1225.099) -- 0:02:32
Average standard deviation of split frequencies: 0.009019
195500 -- (-1224.725) [-1226.324] (-1224.505) (-1226.576) * [-1228.564] (-1228.552) (-1230.642) (-1223.286) -- 0:02:32
196000 -- (-1220.632) (-1229.460) (-1224.277) [-1223.479] * (-1228.512) (-1226.524) (-1227.493) [-1227.603] -- 0:02:31
196500 -- (-1227.933) (-1230.466) (-1224.790) [-1222.196] * (-1237.601) (-1235.444) (-1234.624) [-1226.453] -- 0:02:31
197000 -- (-1232.229) (-1222.753) [-1222.857] (-1228.809) * (-1237.620) (-1227.392) (-1223.063) [-1221.488] -- 0:02:30
197500 -- (-1225.280) (-1227.309) [-1222.216] (-1225.241) * (-1230.242) (-1228.229) [-1227.086] (-1230.176) -- 0:02:30
198000 -- [-1223.529] (-1221.407) (-1228.364) (-1222.063) * (-1231.498) (-1224.421) [-1225.337] (-1233.684) -- 0:02:33
198500 -- (-1226.201) (-1221.601) (-1222.341) [-1229.859] * [-1224.871] (-1231.930) (-1225.152) (-1224.402) -- 0:02:33
199000 -- (-1224.598) (-1229.144) (-1230.657) [-1230.137] * (-1227.132) [-1225.838] (-1228.307) (-1224.957) -- 0:02:32
199500 -- (-1223.199) [-1227.684] (-1228.362) (-1223.579) * (-1226.739) (-1223.224) (-1223.283) [-1226.368] -- 0:02:32
200000 -- (-1222.313) (-1226.779) [-1227.825] (-1225.292) * [-1226.207] (-1223.510) (-1226.392) (-1224.478) -- 0:02:32
Average standard deviation of split frequencies: 0.008809
200500 -- [-1226.629] (-1233.248) (-1226.192) (-1225.979) * (-1225.947) (-1221.338) (-1229.174) [-1225.643] -- 0:02:31
201000 -- (-1225.675) (-1224.446) [-1225.670] (-1229.361) * [-1221.310] (-1229.128) (-1232.364) (-1226.511) -- 0:02:31
201500 -- (-1231.560) [-1229.015] (-1227.113) (-1228.110) * (-1224.947) (-1222.713) [-1228.632] (-1227.417) -- 0:02:30
202000 -- (-1230.744) (-1229.393) [-1233.726] (-1229.871) * (-1226.983) [-1225.394] (-1225.882) (-1229.973) -- 0:02:30
202500 -- (-1230.536) (-1237.717) [-1226.635] (-1230.120) * (-1227.548) (-1225.185) (-1225.645) [-1227.372] -- 0:02:29
203000 -- (-1225.093) (-1240.531) [-1221.111] (-1222.083) * (-1223.819) [-1222.783] (-1227.082) (-1224.574) -- 0:02:29
203500 -- (-1222.628) (-1235.462) (-1226.975) [-1227.037] * (-1224.901) (-1230.077) (-1229.531) [-1224.683] -- 0:02:32
204000 -- (-1224.459) [-1230.183] (-1226.494) (-1230.032) * (-1227.716) [-1228.148] (-1235.873) (-1228.796) -- 0:02:32
204500 -- [-1221.794] (-1237.361) (-1227.281) (-1224.220) * (-1225.278) [-1226.890] (-1234.170) (-1230.520) -- 0:02:31
205000 -- (-1236.832) (-1229.266) [-1224.153] (-1227.648) * (-1226.564) (-1224.340) (-1231.675) [-1222.889] -- 0:02:31
Average standard deviation of split frequencies: 0.009726
205500 -- (-1224.342) [-1223.737] (-1225.609) (-1228.557) * (-1224.513) (-1225.676) [-1229.576] (-1227.341) -- 0:02:30
206000 -- [-1225.344] (-1226.463) (-1228.402) (-1225.631) * (-1230.514) [-1227.088] (-1229.145) (-1226.623) -- 0:02:30
206500 -- (-1226.180) [-1236.663] (-1226.896) (-1233.318) * (-1223.404) (-1231.467) [-1229.352] (-1224.854) -- 0:02:29
207000 -- (-1226.429) [-1222.726] (-1234.339) (-1224.906) * (-1224.637) (-1232.349) [-1224.614] (-1232.357) -- 0:02:29
207500 -- (-1224.727) [-1227.375] (-1223.065) (-1219.966) * (-1227.397) [-1229.523] (-1220.954) (-1225.370) -- 0:02:28
208000 -- (-1227.842) (-1229.123) (-1223.601) [-1233.266] * [-1223.858] (-1228.177) (-1239.314) (-1227.927) -- 0:02:28
208500 -- (-1225.287) (-1231.277) [-1228.410] (-1227.601) * (-1223.575) (-1231.716) (-1234.704) [-1231.202] -- 0:02:28
209000 -- [-1223.799] (-1228.718) (-1227.552) (-1226.610) * (-1223.282) (-1227.647) (-1228.878) [-1231.270] -- 0:02:31
209500 -- (-1228.653) [-1225.245] (-1223.355) (-1224.492) * (-1227.452) (-1226.411) (-1222.615) [-1231.346] -- 0:02:30
210000 -- (-1221.359) (-1224.993) [-1228.353] (-1225.493) * (-1232.555) (-1223.460) (-1228.269) [-1232.057] -- 0:02:30
Average standard deviation of split frequencies: 0.013985
210500 -- (-1231.040) (-1227.204) (-1230.070) [-1223.109] * [-1229.336] (-1224.934) (-1225.829) (-1239.456) -- 0:02:30
211000 -- (-1232.015) [-1225.640] (-1230.084) (-1226.456) * [-1223.893] (-1221.465) (-1229.051) (-1233.278) -- 0:02:29
211500 -- (-1230.997) (-1228.012) [-1228.593] (-1230.120) * (-1229.771) (-1227.259) (-1234.486) [-1231.629] -- 0:02:29
212000 -- (-1231.795) [-1232.107] (-1225.859) (-1232.796) * [-1230.034] (-1228.761) (-1229.549) (-1233.129) -- 0:02:28
212500 -- (-1226.900) (-1233.493) (-1225.583) [-1225.722] * (-1230.136) [-1225.319] (-1225.090) (-1226.340) -- 0:02:28
213000 -- (-1229.296) [-1230.245] (-1227.775) (-1225.181) * (-1230.707) (-1226.069) (-1231.178) [-1224.924] -- 0:02:27
213500 -- (-1228.677) (-1223.571) [-1230.401] (-1224.251) * (-1232.300) (-1223.092) (-1234.580) [-1220.966] -- 0:02:27
214000 -- [-1226.108] (-1226.698) (-1226.648) (-1228.307) * (-1226.860) [-1226.522] (-1234.090) (-1223.684) -- 0:02:30
214500 -- (-1222.393) (-1230.182) [-1227.610] (-1223.252) * (-1227.645) (-1227.803) [-1229.984] (-1228.248) -- 0:02:30
215000 -- (-1224.674) (-1226.294) [-1232.896] (-1230.186) * [-1227.948] (-1224.520) (-1226.181) (-1222.709) -- 0:02:29
Average standard deviation of split frequencies: 0.016914
215500 -- [-1222.959] (-1227.751) (-1225.658) (-1225.699) * (-1227.969) [-1225.352] (-1228.389) (-1221.783) -- 0:02:29
216000 -- [-1226.420] (-1228.076) (-1222.515) (-1228.410) * [-1224.370] (-1225.114) (-1234.409) (-1222.559) -- 0:02:28
216500 -- (-1222.053) (-1232.587) (-1227.256) [-1225.981] * [-1230.486] (-1224.252) (-1231.041) (-1225.157) -- 0:02:28
217000 -- [-1221.101] (-1226.027) (-1233.062) (-1232.488) * [-1226.007] (-1224.774) (-1235.078) (-1231.271) -- 0:02:27
217500 -- (-1224.002) (-1229.729) (-1241.843) [-1230.239] * [-1222.485] (-1227.322) (-1236.049) (-1232.756) -- 0:02:27
218000 -- (-1228.862) (-1227.340) (-1225.913) [-1223.812] * (-1236.101) (-1234.440) [-1235.726] (-1220.458) -- 0:02:27
218500 -- (-1227.544) (-1230.589) (-1229.596) [-1228.438] * (-1226.313) (-1226.355) [-1224.678] (-1225.382) -- 0:02:26
219000 -- (-1225.151) [-1232.098] (-1226.689) (-1229.808) * (-1225.239) (-1223.510) (-1232.210) [-1224.741] -- 0:02:26
219500 -- (-1228.670) (-1230.425) (-1225.857) [-1228.331] * [-1220.497] (-1238.616) (-1222.005) (-1224.760) -- 0:02:29
220000 -- (-1223.827) (-1230.240) [-1227.168] (-1227.105) * (-1220.446) [-1230.534] (-1223.369) (-1224.097) -- 0:02:28
Average standard deviation of split frequencies: 0.021363
220500 -- (-1222.237) (-1225.960) [-1226.951] (-1230.486) * (-1228.206) (-1225.862) (-1236.002) [-1223.427] -- 0:02:28
221000 -- (-1227.315) (-1226.737) [-1225.420] (-1229.284) * (-1222.440) (-1225.703) (-1222.280) [-1229.504] -- 0:02:28
221500 -- (-1229.904) [-1219.293] (-1231.174) (-1231.177) * (-1227.327) (-1223.846) (-1225.060) [-1228.121] -- 0:02:27
222000 -- (-1226.430) [-1224.414] (-1232.860) (-1236.097) * [-1224.166] (-1223.304) (-1222.110) (-1236.613) -- 0:02:27
222500 -- [-1226.466] (-1228.290) (-1236.921) (-1229.494) * (-1223.830) (-1231.224) [-1222.407] (-1226.629) -- 0:02:26
223000 -- (-1222.923) (-1233.526) (-1236.591) [-1234.799] * [-1225.871] (-1224.070) (-1225.036) (-1230.176) -- 0:02:26
223500 -- [-1224.162] (-1229.149) (-1229.567) (-1228.042) * (-1232.163) (-1225.686) (-1223.717) [-1225.582] -- 0:02:25
224000 -- (-1220.064) (-1223.980) (-1222.774) [-1231.738] * (-1229.781) (-1225.336) (-1237.152) [-1222.029] -- 0:02:25
224500 -- (-1223.752) (-1230.632) (-1223.120) [-1227.607] * (-1226.852) (-1224.261) (-1235.827) [-1222.292] -- 0:02:25
225000 -- (-1226.434) (-1228.635) (-1225.375) [-1227.353] * (-1221.219) [-1226.765] (-1234.345) (-1227.131) -- 0:02:28
Average standard deviation of split frequencies: 0.021902
225500 -- (-1229.943) [-1226.869] (-1227.206) (-1224.057) * (-1221.510) (-1227.344) (-1224.824) [-1229.427] -- 0:02:27
226000 -- (-1226.939) (-1231.838) [-1227.559] (-1225.055) * (-1225.945) [-1227.719] (-1225.224) (-1234.046) -- 0:02:27
226500 -- (-1222.141) [-1229.784] (-1227.180) (-1234.324) * (-1228.353) (-1225.755) [-1223.646] (-1234.817) -- 0:02:26
227000 -- [-1227.083] (-1225.366) (-1223.863) (-1229.453) * (-1228.658) [-1220.999] (-1222.923) (-1230.578) -- 0:02:26
227500 -- (-1226.331) (-1224.120) [-1228.632] (-1227.610) * (-1226.070) (-1225.504) [-1221.933] (-1231.604) -- 0:02:26
228000 -- [-1223.235] (-1225.468) (-1229.221) (-1229.431) * [-1226.821] (-1224.128) (-1222.388) (-1226.084) -- 0:02:25
228500 -- (-1228.904) (-1230.676) [-1224.376] (-1240.036) * [-1221.621] (-1226.877) (-1221.999) (-1229.083) -- 0:02:25
229000 -- (-1229.805) (-1227.919) (-1229.730) [-1229.452] * (-1224.513) (-1224.640) [-1225.010] (-1227.080) -- 0:02:24
229500 -- [-1227.378] (-1226.551) (-1228.604) (-1226.417) * [-1223.002] (-1223.771) (-1225.626) (-1230.299) -- 0:02:24
230000 -- (-1223.375) (-1226.455) (-1232.348) [-1222.945] * [-1225.651] (-1227.589) (-1225.682) (-1225.616) -- 0:02:23
Average standard deviation of split frequencies: 0.022480
230500 -- (-1223.828) (-1224.944) (-1225.074) [-1226.659] * [-1226.912] (-1231.031) (-1223.485) (-1224.925) -- 0:02:26
231000 -- (-1224.717) (-1223.209) [-1223.199] (-1233.283) * [-1226.024] (-1227.844) (-1228.466) (-1230.100) -- 0:02:26
231500 -- (-1227.200) (-1224.459) (-1225.737) [-1221.139] * (-1225.860) (-1226.063) (-1227.680) [-1223.345] -- 0:02:26
232000 -- [-1223.041] (-1223.585) (-1228.225) (-1229.309) * [-1223.705] (-1227.771) (-1231.593) (-1230.593) -- 0:02:25
232500 -- (-1226.045) (-1225.454) [-1221.995] (-1226.801) * (-1224.223) (-1228.290) [-1228.138] (-1230.613) -- 0:02:25
233000 -- (-1224.944) [-1226.132] (-1225.432) (-1232.712) * (-1224.704) [-1221.505] (-1227.264) (-1224.840) -- 0:02:24
233500 -- (-1223.625) (-1231.974) (-1223.903) [-1230.557] * [-1223.689] (-1221.832) (-1227.510) (-1226.337) -- 0:02:24
234000 -- (-1227.395) [-1226.660] (-1228.525) (-1226.635) * [-1225.126] (-1231.819) (-1226.698) (-1225.704) -- 0:02:24
234500 -- (-1223.806) (-1225.589) (-1230.451) [-1232.145] * (-1225.318) (-1223.073) (-1240.904) [-1227.462] -- 0:02:23
235000 -- (-1227.696) (-1223.828) (-1230.806) [-1230.958] * (-1227.189) [-1221.397] (-1224.648) (-1229.496) -- 0:02:23
Average standard deviation of split frequencies: 0.019975
235500 -- [-1222.610] (-1227.998) (-1225.533) (-1228.341) * (-1228.777) (-1234.498) [-1225.363] (-1229.044) -- 0:02:26
236000 -- [-1230.271] (-1229.230) (-1227.766) (-1225.609) * (-1225.995) (-1232.891) [-1221.628] (-1232.818) -- 0:02:25
236500 -- (-1222.763) [-1228.706] (-1224.514) (-1232.052) * [-1221.190] (-1225.621) (-1217.622) (-1228.730) -- 0:02:25
237000 -- [-1228.796] (-1228.695) (-1229.513) (-1229.939) * (-1228.242) (-1230.234) [-1221.179] (-1230.073) -- 0:02:24
237500 -- (-1224.072) (-1231.655) (-1226.970) [-1222.290] * (-1224.997) (-1226.402) [-1224.298] (-1223.642) -- 0:02:24
238000 -- (-1238.085) (-1226.649) (-1226.966) [-1223.089] * (-1227.645) [-1222.953] (-1221.319) (-1225.676) -- 0:02:24
238500 -- [-1231.632] (-1227.913) (-1223.383) (-1229.737) * (-1231.928) [-1223.029] (-1223.193) (-1231.287) -- 0:02:23
239000 -- (-1226.072) (-1222.520) [-1224.611] (-1226.179) * [-1226.743] (-1231.275) (-1225.510) (-1222.519) -- 0:02:23
239500 -- (-1228.822) [-1222.914] (-1221.753) (-1224.074) * (-1228.509) [-1226.807] (-1226.576) (-1228.774) -- 0:02:22
240000 -- (-1225.635) [-1221.344] (-1229.957) (-1221.001) * [-1225.763] (-1227.887) (-1223.064) (-1232.488) -- 0:02:22
Average standard deviation of split frequencies: 0.018608
240500 -- (-1223.863) (-1223.300) [-1231.762] (-1220.613) * (-1226.443) (-1225.010) (-1226.567) [-1222.124] -- 0:02:22
241000 -- [-1230.089] (-1227.668) (-1229.776) (-1225.050) * (-1221.071) (-1224.645) (-1227.556) [-1221.812] -- 0:02:24
241500 -- (-1228.152) (-1230.390) [-1223.375] (-1224.463) * [-1221.133] (-1230.388) (-1223.300) (-1226.273) -- 0:02:24
242000 -- (-1236.015) (-1230.038) (-1225.750) [-1224.406] * [-1224.682] (-1225.967) (-1225.578) (-1223.639) -- 0:02:24
242500 -- [-1227.553] (-1230.630) (-1231.111) (-1225.145) * (-1230.238) (-1232.636) (-1225.886) [-1221.646] -- 0:02:23
243000 -- (-1229.869) [-1222.344] (-1227.807) (-1224.544) * [-1225.944] (-1236.776) (-1227.475) (-1220.678) -- 0:02:23
243500 -- (-1230.915) (-1227.758) [-1225.245] (-1223.592) * (-1226.684) (-1231.125) (-1223.334) [-1230.169] -- 0:02:22
244000 -- (-1229.563) [-1229.851] (-1229.085) (-1225.002) * (-1225.571) (-1226.762) (-1220.591) [-1222.896] -- 0:02:22
244500 -- (-1235.007) (-1224.320) (-1223.088) [-1231.583] * (-1222.137) [-1226.308] (-1231.898) (-1232.002) -- 0:02:22
245000 -- (-1238.019) (-1232.806) [-1226.948] (-1227.850) * (-1235.227) (-1226.354) (-1228.241) [-1218.716] -- 0:02:21
Average standard deviation of split frequencies: 0.018205
245500 -- (-1236.482) (-1223.506) [-1222.432] (-1225.724) * (-1228.600) (-1229.279) [-1226.913] (-1224.696) -- 0:02:21
246000 -- (-1231.857) (-1228.044) (-1228.425) [-1231.102] * (-1226.385) [-1222.383] (-1231.636) (-1226.846) -- 0:02:20
246500 -- (-1233.488) [-1223.422] (-1224.930) (-1226.650) * (-1230.929) (-1227.546) [-1226.631] (-1237.515) -- 0:02:23
247000 -- (-1230.493) [-1224.684] (-1222.991) (-1229.285) * (-1236.772) (-1228.904) [-1223.455] (-1226.577) -- 0:02:23
247500 -- (-1228.736) [-1227.751] (-1230.607) (-1230.927) * (-1226.756) (-1228.303) [-1226.563] (-1224.411) -- 0:02:22
248000 -- (-1223.762) [-1224.366] (-1231.588) (-1228.991) * (-1223.692) (-1226.423) (-1235.235) [-1223.626] -- 0:02:22
248500 -- (-1222.357) (-1227.689) [-1224.717] (-1221.754) * (-1221.536) (-1227.341) [-1220.359] (-1224.527) -- 0:02:22
249000 -- [-1223.410] (-1229.163) (-1227.105) (-1229.857) * [-1224.797] (-1232.831) (-1226.200) (-1228.301) -- 0:02:21
249500 -- [-1224.349] (-1229.464) (-1223.296) (-1225.997) * (-1224.364) (-1235.723) (-1224.476) [-1224.700] -- 0:02:21
250000 -- (-1229.724) [-1230.734] (-1230.066) (-1230.073) * [-1220.726] (-1227.188) (-1228.398) (-1228.601) -- 0:02:21
Average standard deviation of split frequencies: 0.018336
250500 -- (-1223.568) [-1233.907] (-1225.890) (-1236.447) * (-1226.864) (-1224.484) (-1229.092) [-1231.133] -- 0:02:20
251000 -- [-1223.434] (-1226.086) (-1229.342) (-1230.072) * (-1224.601) (-1224.722) (-1227.259) [-1225.711] -- 0:02:20
251500 -- (-1230.006) (-1226.854) (-1226.148) [-1226.156] * (-1222.284) (-1229.978) [-1225.210] (-1225.372) -- 0:02:22
252000 -- (-1224.828) [-1227.470] (-1229.181) (-1228.117) * (-1224.653) (-1228.138) (-1219.795) [-1227.804] -- 0:02:22
252500 -- (-1227.878) (-1231.100) [-1230.375] (-1230.087) * (-1224.895) (-1227.536) [-1224.311] (-1228.654) -- 0:02:22
253000 -- (-1226.568) (-1224.267) (-1224.205) [-1224.025] * [-1222.651] (-1225.994) (-1226.191) (-1230.143) -- 0:02:21
253500 -- (-1225.955) [-1223.541] (-1227.575) (-1223.867) * (-1227.176) (-1227.415) [-1225.716] (-1232.483) -- 0:02:21
254000 -- (-1226.754) [-1225.237] (-1225.559) (-1226.434) * [-1225.821] (-1227.594) (-1228.713) (-1224.602) -- 0:02:20
254500 -- (-1227.482) (-1228.217) (-1223.263) [-1226.330] * [-1227.927] (-1225.980) (-1224.879) (-1229.456) -- 0:02:20
255000 -- (-1226.699) [-1227.863] (-1221.583) (-1225.408) * (-1221.855) (-1224.644) (-1226.471) [-1225.899] -- 0:02:20
Average standard deviation of split frequencies: 0.017033
255500 -- [-1223.776] (-1230.381) (-1221.763) (-1225.947) * [-1221.774] (-1228.525) (-1229.901) (-1228.783) -- 0:02:19
256000 -- (-1225.225) [-1225.984] (-1222.030) (-1230.578) * (-1221.853) (-1227.929) (-1226.338) [-1229.040] -- 0:02:19
256500 -- (-1227.377) (-1226.695) [-1225.167] (-1227.538) * (-1224.770) [-1228.509] (-1232.146) (-1228.498) -- 0:02:19
257000 -- (-1222.524) (-1229.509) [-1228.128] (-1232.153) * (-1226.903) (-1229.655) (-1225.698) [-1224.576] -- 0:02:21
257500 -- [-1225.256] (-1227.926) (-1228.921) (-1226.236) * (-1226.403) [-1227.640] (-1224.794) (-1228.771) -- 0:02:21
258000 -- [-1226.402] (-1229.693) (-1226.114) (-1233.609) * (-1224.201) (-1227.680) (-1230.437) [-1225.864] -- 0:02:20
258500 -- (-1222.320) [-1225.895] (-1232.384) (-1227.190) * (-1229.880) [-1222.612] (-1227.541) (-1227.818) -- 0:02:20
259000 -- (-1227.011) (-1233.026) [-1228.680] (-1223.346) * [-1228.326] (-1228.711) (-1238.138) (-1226.143) -- 0:02:20
259500 -- (-1231.967) [-1228.891] (-1231.687) (-1224.782) * (-1231.555) (-1225.703) [-1230.465] (-1226.818) -- 0:02:19
260000 -- (-1228.678) (-1228.122) [-1224.860] (-1224.509) * [-1228.793] (-1226.677) (-1229.481) (-1230.015) -- 0:02:19
Average standard deviation of split frequencies: 0.015824
260500 -- [-1222.881] (-1229.699) (-1231.840) (-1222.159) * [-1224.115] (-1237.441) (-1226.060) (-1227.899) -- 0:02:19
261000 -- [-1225.643] (-1231.933) (-1228.865) (-1225.281) * (-1222.431) (-1230.488) [-1222.824] (-1220.138) -- 0:02:18
261500 -- [-1223.099] (-1235.062) (-1225.880) (-1229.227) * (-1232.241) (-1230.580) (-1223.596) [-1223.438] -- 0:02:18
262000 -- [-1224.654] (-1231.487) (-1226.063) (-1226.924) * (-1227.747) [-1227.819] (-1229.676) (-1225.828) -- 0:02:18
262500 -- [-1223.952] (-1227.750) (-1229.613) (-1228.084) * (-1226.864) (-1230.098) [-1225.984] (-1229.150) -- 0:02:20
263000 -- (-1227.985) [-1231.752] (-1221.372) (-1226.953) * (-1221.820) [-1225.625] (-1228.050) (-1230.408) -- 0:02:20
263500 -- (-1232.083) [-1232.345] (-1226.631) (-1229.833) * (-1227.869) (-1226.922) (-1227.321) [-1222.815] -- 0:02:19
264000 -- (-1227.350) [-1223.228] (-1229.045) (-1230.105) * [-1225.968] (-1228.550) (-1224.929) (-1225.517) -- 0:02:19
264500 -- (-1231.121) [-1224.015] (-1224.444) (-1229.223) * [-1226.294] (-1224.141) (-1227.369) (-1227.617) -- 0:02:19
265000 -- (-1226.892) [-1224.943] (-1231.009) (-1225.351) * (-1221.826) (-1222.807) [-1222.584] (-1233.691) -- 0:02:18
Average standard deviation of split frequencies: 0.017279
265500 -- [-1229.105] (-1225.196) (-1233.997) (-1230.887) * [-1220.097] (-1224.271) (-1223.508) (-1224.597) -- 0:02:18
266000 -- (-1224.093) (-1222.849) [-1231.821] (-1228.900) * (-1223.225) (-1224.534) [-1224.270] (-1220.780) -- 0:02:17
266500 -- [-1232.288] (-1228.428) (-1227.361) (-1226.725) * (-1230.299) (-1225.999) (-1228.563) [-1220.535] -- 0:02:17
267000 -- (-1226.059) (-1224.366) [-1224.930] (-1233.113) * [-1224.857] (-1233.461) (-1229.288) (-1225.323) -- 0:02:17
267500 -- (-1223.039) (-1226.201) [-1225.871] (-1226.236) * (-1226.942) (-1228.323) [-1224.327] (-1225.775) -- 0:02:19
268000 -- (-1222.751) (-1229.711) [-1228.775] (-1225.643) * (-1229.386) (-1235.378) [-1226.848] (-1224.999) -- 0:02:19
268500 -- (-1221.718) [-1233.648] (-1230.046) (-1226.313) * (-1228.035) (-1231.587) (-1231.600) [-1233.813] -- 0:02:18
269000 -- (-1223.886) (-1233.757) [-1223.619] (-1225.349) * (-1223.758) (-1237.668) (-1231.116) [-1225.440] -- 0:02:18
269500 -- [-1222.487] (-1233.237) (-1221.668) (-1228.071) * (-1224.075) (-1224.589) (-1231.982) [-1230.079] -- 0:02:18
270000 -- [-1222.405] (-1225.951) (-1226.836) (-1221.094) * (-1237.810) (-1232.500) (-1231.122) [-1228.115] -- 0:02:17
Average standard deviation of split frequencies: 0.016110
270500 -- (-1221.842) [-1228.676] (-1231.192) (-1223.172) * (-1225.144) [-1227.518] (-1230.618) (-1225.995) -- 0:02:17
271000 -- (-1225.168) [-1228.815] (-1229.661) (-1230.754) * [-1225.027] (-1225.013) (-1226.242) (-1224.178) -- 0:02:17
271500 -- (-1221.030) (-1229.935) (-1231.234) [-1222.108] * (-1231.106) (-1227.100) (-1224.956) [-1224.392] -- 0:02:16
272000 -- (-1224.206) (-1229.126) (-1229.171) [-1224.612] * (-1223.370) (-1232.182) (-1224.590) [-1223.605] -- 0:02:16
272500 -- (-1226.929) (-1227.712) (-1226.401) [-1225.541] * (-1230.904) [-1225.396] (-1227.519) (-1226.244) -- 0:02:16
273000 -- (-1226.582) (-1227.982) (-1227.712) [-1227.066] * (-1239.289) (-1226.614) (-1225.567) [-1224.562] -- 0:02:18
273500 -- [-1227.096] (-1226.666) (-1229.559) (-1229.025) * (-1232.092) (-1230.183) (-1231.163) [-1222.602] -- 0:02:18
274000 -- (-1230.231) (-1224.570) (-1231.220) [-1224.268] * (-1229.840) (-1241.972) (-1231.081) [-1230.010] -- 0:02:17
274500 -- (-1228.752) (-1227.238) [-1225.312] (-1223.594) * (-1231.740) (-1229.497) [-1227.319] (-1224.036) -- 0:02:17
275000 -- (-1225.351) (-1230.227) (-1225.927) [-1225.980] * (-1222.462) (-1226.699) (-1223.345) [-1230.218] -- 0:02:17
Average standard deviation of split frequencies: 0.014945
275500 -- (-1229.165) (-1230.577) (-1225.322) [-1221.382] * [-1226.647] (-1237.380) (-1224.091) (-1228.450) -- 0:02:16
276000 -- (-1230.433) (-1229.936) [-1228.855] (-1225.143) * (-1232.069) [-1230.117] (-1223.033) (-1227.676) -- 0:02:16
276500 -- (-1229.804) (-1229.418) (-1230.391) [-1222.086] * (-1227.760) [-1227.747] (-1221.515) (-1225.948) -- 0:02:16
277000 -- (-1228.428) (-1227.378) [-1223.402] (-1224.371) * (-1228.270) (-1226.854) (-1227.891) [-1227.442] -- 0:02:15
277500 -- (-1227.502) [-1222.917] (-1231.594) (-1222.598) * (-1231.267) [-1223.686] (-1225.714) (-1233.216) -- 0:02:15
278000 -- [-1226.249] (-1225.243) (-1228.337) (-1223.870) * (-1233.167) (-1223.511) [-1225.160] (-1225.471) -- 0:02:15
278500 -- [-1226.465] (-1229.211) (-1230.844) (-1233.106) * (-1230.269) [-1229.410] (-1235.377) (-1224.872) -- 0:02:17
279000 -- (-1223.908) (-1226.748) (-1230.396) [-1226.248] * (-1240.484) [-1226.354] (-1230.610) (-1229.839) -- 0:02:16
279500 -- (-1222.508) [-1231.872] (-1232.261) (-1228.722) * (-1235.330) (-1225.879) (-1229.000) [-1229.257] -- 0:02:16
280000 -- (-1222.946) (-1231.664) (-1221.180) [-1227.653] * (-1224.779) (-1225.190) (-1234.965) [-1227.505] -- 0:02:16
Average standard deviation of split frequencies: 0.013857
280500 -- (-1228.196) (-1228.038) (-1228.751) [-1223.940] * (-1227.367) [-1228.037] (-1225.766) (-1224.964) -- 0:02:15
281000 -- [-1230.024] (-1236.298) (-1226.433) (-1226.459) * (-1222.191) [-1227.427] (-1228.578) (-1227.686) -- 0:02:15
281500 -- (-1231.529) (-1240.859) (-1232.627) [-1225.231] * (-1226.237) (-1232.420) (-1229.852) [-1225.105] -- 0:02:15
282000 -- (-1231.803) (-1228.828) (-1223.937) [-1227.941] * (-1223.774) (-1223.909) (-1230.706) [-1223.706] -- 0:02:14
282500 -- (-1233.227) (-1233.362) [-1227.485] (-1223.947) * (-1227.736) (-1225.077) [-1226.724] (-1224.579) -- 0:02:14
283000 -- (-1227.122) (-1230.890) [-1225.376] (-1229.316) * (-1232.228) [-1223.871] (-1227.097) (-1224.843) -- 0:02:14
283500 -- [-1222.895] (-1230.082) (-1230.833) (-1225.204) * (-1231.967) [-1221.991] (-1227.283) (-1228.664) -- 0:02:13
284000 -- [-1222.819] (-1236.126) (-1227.472) (-1222.298) * (-1227.143) [-1229.676] (-1224.139) (-1229.790) -- 0:02:16
284500 -- (-1226.353) [-1229.660] (-1225.986) (-1230.271) * (-1224.859) (-1228.258) (-1225.167) [-1228.368] -- 0:02:15
285000 -- (-1224.092) [-1225.244] (-1233.894) (-1222.908) * (-1226.976) [-1222.811] (-1223.409) (-1227.097) -- 0:02:15
Average standard deviation of split frequencies: 0.016071
285500 -- (-1226.187) [-1225.719] (-1238.938) (-1224.864) * [-1222.959] (-1225.763) (-1223.444) (-1232.207) -- 0:02:15
286000 -- [-1226.111] (-1230.062) (-1225.053) (-1221.456) * (-1227.470) (-1229.053) (-1223.848) [-1228.544] -- 0:02:14
286500 -- (-1232.513) (-1227.683) (-1228.495) [-1225.474] * (-1230.172) (-1232.974) (-1221.454) [-1224.441] -- 0:02:14
287000 -- [-1225.689] (-1227.236) (-1226.339) (-1227.983) * (-1225.913) [-1232.932] (-1225.700) (-1223.616) -- 0:02:14
287500 -- (-1227.163) (-1230.176) (-1227.209) [-1226.319] * [-1226.299] (-1226.409) (-1230.352) (-1225.857) -- 0:02:13
288000 -- [-1223.786] (-1229.832) (-1227.735) (-1230.444) * (-1223.116) (-1221.530) (-1229.025) [-1225.295] -- 0:02:13
288500 -- (-1228.257) [-1229.454] (-1222.923) (-1224.849) * (-1226.929) (-1229.988) [-1223.340] (-1222.950) -- 0:02:13
289000 -- (-1234.268) [-1224.623] (-1223.172) (-1224.756) * (-1226.994) (-1222.653) (-1224.433) [-1230.781] -- 0:02:15
289500 -- (-1226.236) [-1229.608] (-1221.672) (-1228.975) * (-1224.744) [-1229.985] (-1228.375) (-1222.950) -- 0:02:14
290000 -- (-1226.828) (-1228.594) (-1226.278) [-1225.368] * (-1228.177) (-1229.766) (-1227.109) [-1225.500] -- 0:02:14
Average standard deviation of split frequencies: 0.014191
290500 -- (-1226.460) (-1228.722) (-1226.448) [-1232.066] * (-1224.499) [-1225.710] (-1226.030) (-1226.391) -- 0:02:14
291000 -- (-1230.259) [-1226.166] (-1225.377) (-1224.557) * [-1223.634] (-1229.886) (-1234.368) (-1223.171) -- 0:02:14
291500 -- (-1227.566) (-1223.521) (-1229.063) [-1225.044] * (-1225.690) [-1228.337] (-1221.945) (-1224.975) -- 0:02:13
292000 -- (-1231.933) (-1223.884) [-1223.141] (-1227.585) * (-1224.471) (-1226.590) (-1230.970) [-1222.252] -- 0:02:13
292500 -- [-1228.374] (-1220.241) (-1231.792) (-1219.686) * (-1223.115) (-1229.816) (-1229.272) [-1231.137] -- 0:02:13
293000 -- [-1227.562] (-1230.240) (-1229.428) (-1228.243) * (-1223.676) (-1232.509) [-1225.767] (-1225.125) -- 0:02:12
293500 -- (-1223.135) (-1223.759) (-1232.083) [-1226.469] * (-1232.759) (-1228.743) [-1237.316] (-1227.325) -- 0:02:12
294000 -- (-1222.011) (-1230.178) (-1229.764) [-1223.300] * (-1230.161) (-1228.977) (-1232.541) [-1229.393] -- 0:02:12
294500 -- [-1224.628] (-1227.947) (-1223.065) (-1229.024) * (-1233.582) (-1230.888) (-1225.508) [-1228.249] -- 0:02:14
295000 -- [-1227.601] (-1225.370) (-1230.906) (-1223.381) * [-1224.264] (-1231.907) (-1222.786) (-1227.203) -- 0:02:13
Average standard deviation of split frequencies: 0.016324
295500 -- (-1230.909) (-1229.226) [-1226.961] (-1228.300) * [-1227.917] (-1231.565) (-1223.996) (-1223.691) -- 0:02:13
296000 -- (-1226.746) (-1228.966) (-1225.768) [-1230.042] * (-1226.458) [-1227.666] (-1228.244) (-1227.364) -- 0:02:13
296500 -- (-1227.747) (-1229.704) [-1223.663] (-1224.912) * [-1230.550] (-1224.387) (-1228.075) (-1233.808) -- 0:02:12
297000 -- (-1227.730) [-1221.325] (-1228.641) (-1225.534) * (-1227.527) (-1226.741) (-1233.366) [-1224.462] -- 0:02:12
297500 -- (-1230.747) (-1223.008) (-1226.829) [-1224.925] * (-1228.448) (-1221.838) [-1226.232] (-1227.974) -- 0:02:12
298000 -- (-1235.544) [-1223.836] (-1227.701) (-1228.111) * (-1221.268) (-1229.427) [-1228.991] (-1229.763) -- 0:02:11
298500 -- (-1230.392) [-1222.304] (-1232.067) (-1226.248) * (-1222.988) [-1224.230] (-1226.443) (-1227.654) -- 0:02:11
299000 -- (-1226.287) (-1223.334) [-1226.073] (-1228.555) * (-1223.998) [-1226.253] (-1232.248) (-1224.619) -- 0:02:11
299500 -- (-1222.742) [-1222.489] (-1229.679) (-1227.608) * (-1224.874) (-1229.070) (-1228.011) [-1226.995] -- 0:02:10
300000 -- [-1224.265] (-1224.265) (-1226.383) (-1222.117) * (-1231.606) (-1229.671) (-1230.175) [-1227.822] -- 0:02:13
Average standard deviation of split frequencies: 0.016855
300500 -- [-1222.608] (-1226.931) (-1228.796) (-1225.773) * (-1231.559) [-1222.632] (-1223.974) (-1224.473) -- 0:02:12
301000 -- (-1229.848) [-1221.629] (-1231.351) (-1236.121) * (-1230.431) (-1228.113) (-1224.608) [-1222.239] -- 0:02:12
301500 -- [-1221.552] (-1223.118) (-1236.280) (-1242.803) * (-1228.386) (-1228.770) (-1223.849) [-1219.526] -- 0:02:12
302000 -- (-1222.028) [-1224.816] (-1227.586) (-1228.403) * (-1226.397) (-1227.699) [-1229.187] (-1221.294) -- 0:02:11
302500 -- [-1225.245] (-1225.812) (-1231.315) (-1228.302) * (-1227.573) (-1222.766) (-1225.029) [-1224.558] -- 0:02:11
303000 -- (-1222.563) (-1231.709) (-1226.642) [-1226.911] * (-1222.231) (-1226.963) (-1230.668) [-1227.844] -- 0:02:11
303500 -- (-1223.024) (-1226.495) [-1225.948] (-1225.291) * (-1224.685) (-1227.923) [-1223.128] (-1225.716) -- 0:02:10
304000 -- [-1224.864] (-1227.180) (-1228.154) (-1230.330) * (-1230.332) (-1224.928) [-1229.203] (-1224.425) -- 0:02:10
304500 -- (-1227.610) (-1236.863) [-1224.039] (-1222.687) * (-1232.833) (-1231.537) [-1224.655] (-1231.971) -- 0:02:10
305000 -- (-1229.530) [-1232.060] (-1230.822) (-1222.378) * (-1225.476) [-1226.971] (-1230.097) (-1233.264) -- 0:02:09
Average standard deviation of split frequencies: 0.016561
305500 -- [-1229.645] (-1227.729) (-1224.537) (-1231.578) * (-1227.592) [-1227.665] (-1226.040) (-1225.489) -- 0:02:11
306000 -- (-1227.129) [-1227.290] (-1223.771) (-1225.918) * [-1223.255] (-1228.252) (-1230.419) (-1222.886) -- 0:02:11
306500 -- (-1225.044) [-1223.184] (-1234.843) (-1225.843) * [-1226.840] (-1225.477) (-1226.408) (-1225.227) -- 0:02:11
307000 -- (-1227.996) (-1223.600) [-1230.115] (-1221.769) * [-1225.046] (-1231.634) (-1226.190) (-1227.926) -- 0:02:10
307500 -- (-1234.054) [-1224.324] (-1223.766) (-1232.149) * (-1230.022) (-1229.478) (-1232.289) [-1225.429] -- 0:02:10
308000 -- (-1230.049) (-1224.344) (-1223.455) [-1223.998] * (-1237.028) (-1225.074) (-1229.913) [-1227.130] -- 0:02:10
308500 -- (-1228.348) [-1224.864] (-1230.485) (-1225.555) * (-1228.308) (-1232.254) (-1224.314) [-1227.648] -- 0:02:10
309000 -- (-1222.960) [-1225.941] (-1232.530) (-1226.402) * (-1231.868) [-1226.411] (-1232.383) (-1230.037) -- 0:02:09
309500 -- (-1224.536) (-1225.101) [-1231.195] (-1226.056) * [-1227.120] (-1227.352) (-1226.067) (-1231.125) -- 0:02:09
310000 -- (-1222.634) (-1233.617) (-1223.557) [-1227.305] * (-1221.652) (-1227.826) [-1224.712] (-1232.732) -- 0:02:09
Average standard deviation of split frequencies: 0.014795
310500 -- (-1226.146) [-1220.729] (-1223.694) (-1226.354) * [-1225.507] (-1232.977) (-1221.180) (-1231.023) -- 0:02:11
311000 -- [-1223.803] (-1229.964) (-1225.912) (-1229.568) * (-1221.912) [-1223.150] (-1227.806) (-1227.677) -- 0:02:10
311500 -- (-1224.133) (-1228.171) (-1227.823) [-1228.885] * (-1228.199) [-1226.505] (-1225.667) (-1224.528) -- 0:02:10
312000 -- (-1224.700) (-1221.954) [-1225.221] (-1225.642) * [-1227.515] (-1230.288) (-1223.927) (-1226.423) -- 0:02:10
312500 -- (-1228.760) (-1228.529) [-1227.186] (-1224.973) * (-1222.809) (-1232.985) [-1222.516] (-1228.319) -- 0:02:09
313000 -- (-1223.268) (-1221.612) [-1224.129] (-1224.261) * (-1226.150) (-1228.839) (-1227.572) [-1223.205] -- 0:02:09
313500 -- (-1229.884) [-1225.719] (-1221.765) (-1221.513) * [-1221.942] (-1230.038) (-1226.289) (-1227.749) -- 0:02:09
314000 -- (-1225.719) (-1226.910) (-1225.540) [-1220.886] * [-1222.187] (-1224.860) (-1226.031) (-1228.987) -- 0:02:08
314500 -- [-1226.985] (-1225.197) (-1226.671) (-1222.709) * (-1224.794) [-1226.154] (-1225.328) (-1226.736) -- 0:02:08
315000 -- (-1224.080) (-1228.845) (-1228.759) [-1221.530] * (-1228.403) (-1221.915) (-1232.476) [-1224.844] -- 0:02:08
Average standard deviation of split frequencies: 0.013799
315500 -- (-1224.854) (-1226.395) (-1229.433) [-1222.294] * [-1225.879] (-1227.787) (-1223.566) (-1226.461) -- 0:02:08
316000 -- (-1228.235) [-1224.967] (-1227.153) (-1228.747) * [-1228.442] (-1227.612) (-1223.917) (-1232.770) -- 0:02:09
316500 -- (-1224.338) [-1227.556] (-1226.369) (-1227.492) * (-1228.802) (-1232.344) [-1225.405] (-1231.794) -- 0:02:09
317000 -- (-1224.695) (-1229.890) (-1229.674) [-1222.526] * [-1226.099] (-1231.240) (-1228.089) (-1223.528) -- 0:02:09
317500 -- [-1230.512] (-1229.809) (-1224.831) (-1227.118) * (-1226.468) (-1229.866) (-1224.910) [-1229.153] -- 0:02:08
318000 -- (-1231.835) [-1228.257] (-1225.961) (-1226.505) * [-1228.215] (-1234.008) (-1230.657) (-1227.748) -- 0:02:08
318500 -- (-1229.455) [-1224.571] (-1232.384) (-1229.920) * (-1226.489) (-1230.460) (-1226.405) [-1230.778] -- 0:02:08
319000 -- (-1231.793) (-1226.048) (-1224.630) [-1229.728] * (-1222.911) (-1239.364) (-1231.607) [-1226.754] -- 0:02:08
319500 -- [-1229.444] (-1224.580) (-1226.434) (-1223.774) * (-1230.723) [-1233.126] (-1238.997) (-1229.842) -- 0:02:07
320000 -- [-1221.368] (-1230.811) (-1220.393) (-1226.264) * [-1229.305] (-1226.606) (-1223.592) (-1226.952) -- 0:02:07
Average standard deviation of split frequencies: 0.012863
320500 -- [-1223.718] (-1231.488) (-1237.236) (-1231.960) * [-1225.874] (-1227.495) (-1230.495) (-1226.796) -- 0:02:07
321000 -- [-1223.769] (-1226.521) (-1230.195) (-1228.115) * (-1227.603) (-1228.582) (-1230.532) [-1223.469] -- 0:02:06
321500 -- [-1226.420] (-1231.692) (-1225.594) (-1236.937) * (-1230.591) (-1225.064) (-1230.841) [-1227.291] -- 0:02:08
322000 -- (-1223.249) (-1236.968) [-1225.257] (-1228.519) * [-1222.769] (-1227.886) (-1227.711) (-1223.410) -- 0:02:08
322500 -- [-1225.191] (-1231.568) (-1224.448) (-1230.933) * [-1222.511] (-1227.251) (-1226.060) (-1223.724) -- 0:02:08
323000 -- (-1230.747) [-1223.975] (-1232.182) (-1232.152) * (-1227.145) (-1234.401) [-1225.223] (-1222.157) -- 0:02:07
323500 -- [-1223.080] (-1233.932) (-1226.058) (-1230.794) * (-1229.239) (-1221.826) [-1227.793] (-1223.530) -- 0:02:07
324000 -- (-1224.676) (-1225.287) (-1228.353) [-1221.668] * (-1224.861) (-1225.103) (-1226.090) [-1227.333] -- 0:02:07
324500 -- [-1224.913] (-1226.910) (-1226.681) (-1230.073) * (-1230.652) (-1230.378) [-1227.655] (-1224.912) -- 0:02:06
325000 -- (-1225.811) (-1225.925) [-1223.235] (-1224.512) * (-1229.698) (-1221.770) (-1224.935) [-1228.442] -- 0:02:06
Average standard deviation of split frequencies: 0.009761
325500 -- (-1230.093) (-1231.756) [-1223.632] (-1227.580) * (-1222.450) (-1232.344) (-1226.392) [-1227.771] -- 0:02:06
326000 -- (-1227.484) (-1230.573) [-1221.991] (-1227.110) * (-1222.210) (-1231.988) (-1227.153) [-1223.963] -- 0:02:06
326500 -- (-1226.170) [-1225.043] (-1228.872) (-1224.916) * [-1226.610] (-1227.860) (-1221.839) (-1227.378) -- 0:02:05
327000 -- [-1221.282] (-1228.956) (-1224.049) (-1224.896) * [-1228.933] (-1228.205) (-1225.133) (-1223.158) -- 0:02:07
327500 -- (-1223.987) (-1226.354) [-1228.037] (-1225.498) * [-1224.700] (-1231.408) (-1223.359) (-1229.246) -- 0:02:07
328000 -- [-1223.182] (-1224.679) (-1224.652) (-1228.496) * (-1232.898) (-1233.747) [-1227.887] (-1224.599) -- 0:02:07
328500 -- (-1229.211) [-1223.074] (-1225.316) (-1230.556) * (-1231.468) (-1227.166) (-1224.839) [-1224.983] -- 0:02:06
329000 -- (-1229.258) [-1223.915] (-1228.801) (-1234.272) * [-1227.932] (-1223.472) (-1225.168) (-1230.915) -- 0:02:06
329500 -- (-1223.858) (-1224.827) [-1221.416] (-1230.864) * (-1227.474) [-1226.860] (-1232.657) (-1225.285) -- 0:02:06
330000 -- (-1233.920) (-1225.943) (-1230.662) [-1233.577] * (-1234.673) (-1226.309) (-1226.083) [-1221.609] -- 0:02:05
Average standard deviation of split frequencies: 0.011761
330500 -- [-1222.658] (-1229.454) (-1220.067) (-1227.832) * [-1225.299] (-1225.068) (-1225.852) (-1227.088) -- 0:02:05
331000 -- (-1234.567) (-1227.570) [-1227.408] (-1231.820) * (-1226.955) (-1225.362) [-1224.976] (-1234.454) -- 0:02:05
331500 -- (-1229.070) (-1227.396) [-1222.957] (-1224.266) * (-1232.931) (-1224.728) [-1230.528] (-1233.700) -- 0:02:05
332000 -- (-1224.373) [-1221.898] (-1226.432) (-1226.786) * (-1227.095) [-1226.641] (-1227.823) (-1227.458) -- 0:02:04
332500 -- (-1229.024) (-1222.630) [-1224.290] (-1225.241) * (-1233.239) (-1224.738) (-1224.573) [-1232.548] -- 0:02:06
333000 -- (-1225.304) [-1226.307] (-1226.024) (-1223.250) * (-1226.147) [-1225.886] (-1228.520) (-1233.977) -- 0:02:06
333500 -- (-1227.946) [-1223.827] (-1230.560) (-1224.564) * [-1230.752] (-1227.502) (-1226.042) (-1228.930) -- 0:02:05
334000 -- [-1226.467] (-1225.812) (-1233.467) (-1227.604) * [-1225.753] (-1228.938) (-1230.267) (-1230.236) -- 0:02:05
334500 -- (-1230.013) [-1225.975] (-1227.092) (-1226.894) * (-1227.039) [-1226.770] (-1222.882) (-1226.126) -- 0:02:05
335000 -- (-1230.034) (-1225.520) [-1224.896] (-1223.925) * (-1229.129) (-1233.134) [-1223.919] (-1234.136) -- 0:02:05
Average standard deviation of split frequencies: 0.010873
335500 -- (-1235.152) (-1223.722) [-1227.969] (-1231.185) * (-1228.091) (-1228.621) [-1229.176] (-1230.945) -- 0:02:04
336000 -- (-1227.092) [-1224.535] (-1224.112) (-1228.221) * (-1233.486) (-1222.541) [-1223.803] (-1229.061) -- 0:02:04
336500 -- (-1233.205) (-1225.826) (-1225.245) [-1225.679] * (-1229.514) [-1230.187] (-1223.154) (-1229.364) -- 0:02:04
337000 -- [-1238.029] (-1227.603) (-1226.329) (-1228.354) * (-1225.808) (-1225.469) (-1227.747) [-1223.893] -- 0:02:03
337500 -- (-1229.266) [-1225.603] (-1225.899) (-1222.859) * (-1228.298) (-1226.500) (-1224.677) [-1225.422] -- 0:02:05
338000 -- (-1233.559) (-1223.002) (-1230.420) [-1226.059] * (-1232.168) [-1227.254] (-1232.901) (-1233.810) -- 0:02:05
338500 -- (-1235.391) (-1231.584) (-1224.155) [-1222.647] * (-1224.835) [-1231.440] (-1230.825) (-1225.471) -- 0:02:05
339000 -- (-1230.814) [-1223.277] (-1227.056) (-1225.522) * (-1223.711) (-1230.632) [-1226.017] (-1230.965) -- 0:02:04
339500 -- (-1231.038) (-1232.692) (-1228.869) [-1223.690] * [-1220.331] (-1227.555) (-1226.267) (-1227.769) -- 0:02:04
340000 -- (-1222.883) [-1220.100] (-1229.770) (-1227.481) * (-1232.203) [-1225.142] (-1226.371) (-1232.701) -- 0:02:04
Average standard deviation of split frequencies: 0.010724
340500 -- (-1224.732) (-1224.460) [-1230.974] (-1228.667) * [-1227.946] (-1222.816) (-1233.008) (-1232.272) -- 0:02:03
341000 -- (-1225.433) (-1222.905) (-1242.544) [-1223.880] * (-1229.046) [-1226.974] (-1237.637) (-1228.262) -- 0:02:03
341500 -- (-1229.070) (-1221.626) (-1228.654) [-1228.577] * (-1227.490) (-1225.379) (-1234.186) [-1232.873] -- 0:02:03
342000 -- (-1222.906) (-1222.787) (-1227.525) [-1226.729] * (-1230.102) (-1226.971) (-1229.857) [-1228.952] -- 0:02:03
342500 -- (-1229.716) [-1225.237] (-1225.366) (-1225.497) * (-1226.250) [-1223.802] (-1232.029) (-1227.394) -- 0:02:02
343000 -- (-1223.745) (-1231.106) (-1222.725) [-1227.622] * (-1233.784) [-1228.292] (-1231.003) (-1232.269) -- 0:02:04
343500 -- (-1224.456) (-1228.270) (-1228.771) [-1231.942] * (-1226.276) [-1226.666] (-1221.661) (-1232.417) -- 0:02:04
344000 -- [-1223.441] (-1224.918) (-1222.176) (-1233.820) * (-1223.503) (-1226.350) [-1229.519] (-1239.551) -- 0:02:03
344500 -- [-1226.961] (-1222.200) (-1225.049) (-1228.863) * (-1223.576) (-1231.344) [-1226.634] (-1228.907) -- 0:02:03
345000 -- (-1233.061) [-1231.977] (-1232.371) (-1225.143) * (-1229.541) (-1232.816) [-1225.677] (-1224.960) -- 0:02:03
Average standard deviation of split frequencies: 0.010559
345500 -- (-1233.377) [-1227.784] (-1224.730) (-1227.928) * (-1225.840) (-1224.766) (-1227.616) [-1223.441] -- 0:02:03
346000 -- (-1231.335) [-1231.416] (-1231.202) (-1225.891) * [-1224.765] (-1221.939) (-1230.605) (-1235.130) -- 0:02:02
346500 -- (-1233.022) (-1230.564) [-1221.594] (-1226.535) * (-1223.337) [-1229.793] (-1237.677) (-1225.063) -- 0:02:02
347000 -- (-1231.047) (-1230.272) (-1223.878) [-1222.305] * [-1225.054] (-1227.555) (-1222.315) (-1226.639) -- 0:02:02
347500 -- [-1228.938] (-1225.281) (-1222.664) (-1222.363) * (-1226.591) [-1222.362] (-1225.695) (-1223.559) -- 0:02:02
348000 -- (-1228.952) (-1229.695) (-1224.787) [-1223.663] * (-1228.049) [-1230.166] (-1231.132) (-1226.007) -- 0:02:01
348500 -- (-1232.663) (-1229.423) [-1222.978] (-1227.153) * (-1223.069) [-1228.526] (-1232.074) (-1227.888) -- 0:02:03
349000 -- (-1238.292) (-1224.229) [-1222.352] (-1227.839) * (-1228.933) [-1223.127] (-1228.783) (-1229.643) -- 0:02:03
349500 -- (-1232.858) [-1229.318] (-1225.360) (-1221.816) * (-1230.534) (-1224.367) [-1227.593] (-1222.100) -- 0:02:02
350000 -- (-1232.494) (-1226.507) (-1222.326) [-1227.515] * (-1230.073) (-1221.499) [-1226.744] (-1226.463) -- 0:02:02
Average standard deviation of split frequencies: 0.009074
350500 -- (-1226.824) (-1224.076) (-1225.461) [-1225.539] * [-1227.937] (-1227.246) (-1239.951) (-1224.206) -- 0:02:02
351000 -- (-1229.056) [-1228.153] (-1227.440) (-1227.462) * (-1225.053) (-1226.013) (-1227.497) [-1226.488] -- 0:02:02
351500 -- (-1225.528) (-1227.257) [-1226.535] (-1232.586) * [-1228.871] (-1221.918) (-1232.614) (-1224.924) -- 0:02:01
352000 -- (-1221.040) [-1227.855] (-1229.927) (-1237.274) * (-1226.569) [-1224.588] (-1232.927) (-1230.326) -- 0:02:01
352500 -- (-1227.020) (-1232.874) (-1228.227) [-1226.497] * (-1227.248) (-1227.694) (-1227.187) [-1231.125] -- 0:02:01
353000 -- (-1225.585) [-1225.657] (-1223.716) (-1230.237) * (-1230.672) (-1227.920) (-1230.962) [-1221.180] -- 0:02:00
353500 -- (-1228.736) (-1232.745) [-1228.422] (-1226.937) * (-1227.010) (-1231.775) (-1228.445) [-1228.807] -- 0:02:00
354000 -- (-1230.008) (-1225.466) (-1226.783) [-1224.479] * (-1233.175) (-1235.640) (-1226.466) [-1228.318] -- 0:02:02
354500 -- (-1229.549) (-1222.031) (-1230.899) [-1224.403] * [-1221.691] (-1222.112) (-1223.823) (-1229.044) -- 0:02:01
355000 -- (-1231.229) (-1220.749) [-1224.912] (-1228.692) * (-1228.365) (-1225.168) (-1227.579) [-1223.221] -- 0:02:01
Average standard deviation of split frequencies: 0.008276
355500 -- (-1225.755) (-1222.226) (-1232.666) [-1230.313] * (-1227.246) (-1220.463) [-1228.580] (-1230.206) -- 0:02:01
356000 -- [-1225.353] (-1223.037) (-1222.012) (-1225.560) * (-1224.169) [-1227.135] (-1222.124) (-1228.994) -- 0:02:01
356500 -- (-1227.709) (-1222.950) (-1227.791) [-1232.091] * (-1229.922) (-1228.428) (-1230.557) [-1233.185] -- 0:02:00
357000 -- (-1229.144) (-1222.961) (-1226.396) [-1230.700] * (-1226.484) (-1230.854) (-1238.444) [-1223.485] -- 0:02:00
357500 -- (-1225.415) (-1225.795) [-1227.958] (-1233.226) * [-1223.468] (-1224.153) (-1232.889) (-1229.050) -- 0:02:00
358000 -- (-1231.170) (-1229.399) (-1231.323) [-1227.703] * (-1228.777) (-1226.485) [-1238.297] (-1224.381) -- 0:02:00
358500 -- (-1225.606) (-1226.864) (-1231.395) [-1224.769] * (-1223.176) [-1224.409] (-1238.784) (-1228.363) -- 0:01:59
359000 -- [-1226.829] (-1226.153) (-1229.193) (-1228.420) * (-1227.899) [-1228.280] (-1234.211) (-1227.164) -- 0:02:01
359500 -- (-1222.738) [-1225.081] (-1232.682) (-1229.573) * (-1222.338) (-1224.571) (-1231.527) [-1221.766] -- 0:02:01
360000 -- [-1227.575] (-1232.101) (-1228.331) (-1229.742) * [-1225.719] (-1220.201) (-1239.458) (-1223.341) -- 0:02:00
Average standard deviation of split frequencies: 0.010783
360500 -- (-1237.740) [-1226.486] (-1223.995) (-1229.065) * (-1231.305) (-1226.998) (-1231.414) [-1228.311] -- 0:02:00
361000 -- (-1230.429) (-1226.034) [-1225.229] (-1223.141) * (-1228.153) (-1225.632) (-1226.758) [-1222.777] -- 0:02:00
361500 -- [-1226.590] (-1225.932) (-1223.861) (-1226.039) * (-1224.736) [-1220.000] (-1228.204) (-1225.786) -- 0:02:00
362000 -- (-1225.204) [-1227.299] (-1228.382) (-1228.294) * (-1229.746) [-1221.600] (-1226.845) (-1232.451) -- 0:01:59
362500 -- (-1222.180) [-1221.901] (-1232.116) (-1222.951) * [-1224.627] (-1230.308) (-1229.530) (-1221.841) -- 0:01:59
363000 -- (-1225.569) (-1225.143) [-1232.514] (-1227.342) * [-1227.501] (-1233.574) (-1235.390) (-1225.528) -- 0:01:59
363500 -- (-1227.948) [-1224.181] (-1229.898) (-1225.925) * [-1222.161] (-1229.115) (-1225.857) (-1222.054) -- 0:01:59
364000 -- (-1223.447) (-1221.232) [-1227.029] (-1234.022) * (-1223.127) (-1222.024) (-1225.921) [-1226.468] -- 0:01:58
364500 -- [-1221.489] (-1227.272) (-1224.964) (-1228.471) * (-1226.951) [-1228.759] (-1227.338) (-1223.702) -- 0:02:00
365000 -- [-1225.833] (-1224.259) (-1231.877) (-1224.968) * (-1227.848) [-1225.696] (-1222.988) (-1226.231) -- 0:02:00
Average standard deviation of split frequencies: 0.008694
365500 -- (-1228.676) [-1222.715] (-1222.327) (-1220.857) * [-1224.895] (-1224.664) (-1230.185) (-1225.842) -- 0:01:59
366000 -- (-1229.861) (-1226.657) (-1223.993) [-1224.720] * (-1225.341) (-1231.206) (-1223.788) [-1227.477] -- 0:01:59
366500 -- [-1223.833] (-1229.740) (-1228.270) (-1224.380) * [-1228.021] (-1225.361) (-1222.885) (-1236.485) -- 0:01:59
367000 -- [-1224.799] (-1227.932) (-1222.768) (-1227.642) * (-1231.718) (-1221.264) [-1224.924] (-1233.916) -- 0:01:59
367500 -- [-1224.403] (-1232.522) (-1223.980) (-1226.750) * (-1228.582) [-1224.179] (-1225.678) (-1226.646) -- 0:01:58
368000 -- (-1221.313) (-1238.683) [-1226.722] (-1224.288) * (-1236.414) (-1225.193) (-1221.547) [-1232.171] -- 0:01:58
368500 -- (-1225.380) (-1232.284) [-1229.746] (-1226.630) * (-1240.109) [-1221.880] (-1224.181) (-1221.455) -- 0:01:58
369000 -- [-1232.206] (-1227.353) (-1224.181) (-1227.001) * (-1230.525) (-1228.351) [-1230.968] (-1223.971) -- 0:01:59
369500 -- [-1228.485] (-1224.114) (-1226.094) (-1227.346) * [-1230.179] (-1230.957) (-1221.625) (-1221.759) -- 0:01:59
370000 -- (-1225.887) [-1226.917] (-1223.292) (-1230.531) * (-1227.646) [-1225.659] (-1224.880) (-1225.589) -- 0:01:59
Average standard deviation of split frequencies: 0.009220
370500 -- [-1230.495] (-1233.136) (-1230.061) (-1231.744) * (-1225.511) [-1227.857] (-1223.286) (-1228.449) -- 0:01:58
371000 -- (-1224.962) [-1229.644] (-1232.226) (-1230.164) * (-1235.619) (-1225.110) [-1225.973] (-1229.338) -- 0:01:58
371500 -- (-1241.692) (-1223.786) [-1230.509] (-1229.216) * (-1223.204) [-1230.473] (-1224.494) (-1231.200) -- 0:01:58
372000 -- [-1232.479] (-1223.679) (-1226.573) (-1219.946) * [-1221.974] (-1233.556) (-1232.599) (-1226.326) -- 0:01:58
372500 -- [-1227.692] (-1227.660) (-1226.915) (-1223.550) * (-1225.198) (-1228.306) [-1220.308] (-1223.280) -- 0:01:57
373000 -- (-1228.090) [-1225.509] (-1230.109) (-1229.576) * (-1230.441) (-1237.106) (-1219.914) [-1225.151] -- 0:01:57
373500 -- [-1230.742] (-1235.407) (-1226.898) (-1223.295) * (-1222.056) [-1221.823] (-1229.742) (-1226.157) -- 0:01:57
374000 -- (-1227.908) (-1226.088) (-1227.591) [-1226.726] * (-1236.147) (-1223.711) [-1221.711] (-1227.188) -- 0:01:58
374500 -- (-1232.879) (-1234.640) [-1224.625] (-1230.722) * (-1226.660) [-1226.545] (-1225.909) (-1230.483) -- 0:01:58
375000 -- [-1233.134] (-1229.436) (-1223.890) (-1235.009) * [-1223.316] (-1224.750) (-1225.773) (-1231.250) -- 0:01:58
Average standard deviation of split frequencies: 0.007522
375500 -- (-1230.841) [-1223.158] (-1225.952) (-1226.160) * (-1222.252) (-1232.244) [-1226.447] (-1229.859) -- 0:01:58
376000 -- (-1231.570) (-1225.067) (-1226.670) [-1228.576] * (-1227.495) (-1227.086) [-1220.784] (-1226.479) -- 0:01:57
376500 -- (-1227.648) (-1229.079) [-1224.902] (-1226.571) * (-1228.730) (-1225.426) [-1231.019] (-1226.313) -- 0:01:57
377000 -- (-1223.442) (-1232.143) [-1220.774] (-1225.086) * [-1224.724] (-1225.047) (-1226.086) (-1230.636) -- 0:01:57
377500 -- [-1223.968] (-1229.310) (-1226.748) (-1226.855) * (-1223.556) (-1225.797) [-1224.438] (-1232.191) -- 0:01:57
378000 -- (-1232.358) (-1242.364) [-1226.270] (-1229.997) * (-1222.782) (-1229.049) (-1224.100) [-1223.426] -- 0:01:56
378500 -- (-1224.782) (-1223.299) [-1227.352] (-1228.882) * [-1223.006] (-1234.030) (-1226.506) (-1228.237) -- 0:01:56
379000 -- [-1227.875] (-1226.655) (-1224.957) (-1234.722) * (-1226.148) (-1227.111) (-1232.640) [-1225.553] -- 0:01:56
379500 -- [-1224.110] (-1225.596) (-1227.271) (-1225.927) * [-1226.608] (-1223.824) (-1231.934) (-1222.803) -- 0:01:57
380000 -- (-1226.011) [-1227.336] (-1226.482) (-1227.298) * (-1226.556) [-1224.233] (-1226.987) (-1225.758) -- 0:01:57
Average standard deviation of split frequencies: 0.006811
380500 -- (-1230.817) (-1225.564) [-1226.393] (-1225.400) * (-1232.266) (-1226.582) (-1239.623) [-1225.553] -- 0:01:57
381000 -- (-1226.918) (-1233.911) [-1225.121] (-1237.187) * [-1227.221] (-1228.884) (-1227.294) (-1227.697) -- 0:01:56
381500 -- (-1227.395) (-1224.576) [-1227.701] (-1227.450) * (-1224.698) (-1229.050) (-1226.945) [-1222.410] -- 0:01:56
382000 -- (-1222.355) (-1221.733) (-1225.790) [-1226.192] * (-1230.870) [-1223.213] (-1224.515) (-1224.606) -- 0:01:56
382500 -- (-1221.526) (-1222.410) (-1231.295) [-1222.452] * (-1225.214) (-1224.141) [-1224.917] (-1224.162) -- 0:01:56
383000 -- [-1226.953] (-1224.142) (-1236.914) (-1226.384) * (-1224.312) (-1220.860) [-1227.427] (-1227.868) -- 0:01:55
383500 -- (-1227.218) (-1232.925) (-1237.014) [-1227.950] * (-1226.862) (-1226.238) (-1227.260) [-1230.114] -- 0:01:55
384000 -- [-1226.061] (-1225.209) (-1227.736) (-1227.274) * (-1226.994) [-1226.917] (-1226.254) (-1225.225) -- 0:01:55
384500 -- (-1230.603) [-1221.292] (-1231.398) (-1228.532) * (-1224.816) (-1226.935) (-1230.303) [-1225.073] -- 0:01:56
385000 -- (-1233.912) (-1225.277) (-1230.726) [-1224.321] * (-1224.964) [-1224.836] (-1227.738) (-1223.193) -- 0:01:56
Average standard deviation of split frequencies: 0.007328
385500 -- (-1229.490) (-1220.643) (-1228.475) [-1230.046] * (-1233.463) (-1228.534) (-1230.395) [-1226.267] -- 0:01:56
386000 -- (-1223.186) (-1227.035) [-1223.487] (-1229.352) * (-1224.248) (-1230.088) (-1226.126) [-1223.159] -- 0:01:56
386500 -- (-1230.380) [-1225.396] (-1229.430) (-1226.937) * [-1228.041] (-1226.472) (-1231.813) (-1230.758) -- 0:01:55
387000 -- (-1222.584) [-1228.335] (-1226.094) (-1227.655) * (-1225.101) [-1223.528] (-1226.100) (-1223.663) -- 0:01:55
387500 -- (-1222.671) (-1225.073) [-1221.019] (-1225.455) * (-1227.517) (-1222.036) (-1229.521) [-1223.573] -- 0:01:55
388000 -- (-1226.742) (-1225.707) (-1226.216) [-1225.051] * [-1227.180] (-1226.897) (-1230.437) (-1227.079) -- 0:01:55
388500 -- (-1226.673) [-1229.768] (-1226.783) (-1225.813) * (-1225.475) (-1236.224) (-1228.288) [-1226.709] -- 0:01:54
389000 -- [-1226.640] (-1224.208) (-1227.972) (-1222.886) * (-1229.485) (-1229.484) (-1226.520) [-1228.809] -- 0:01:54
389500 -- (-1225.969) (-1226.833) [-1229.302] (-1221.092) * (-1228.344) [-1228.028] (-1229.081) (-1225.922) -- 0:01:54
390000 -- (-1223.158) (-1232.925) [-1230.210] (-1222.053) * (-1220.842) (-1228.739) (-1225.568) [-1229.579] -- 0:01:55
Average standard deviation of split frequencies: 0.007542
390500 -- [-1225.921] (-1228.355) (-1225.474) (-1226.340) * (-1234.264) [-1225.061] (-1222.668) (-1231.690) -- 0:01:55
391000 -- [-1221.306] (-1224.981) (-1223.503) (-1234.089) * (-1228.456) [-1226.823] (-1224.072) (-1225.319) -- 0:01:55
391500 -- (-1223.294) [-1230.833] (-1228.673) (-1229.607) * (-1227.598) (-1223.456) [-1226.173] (-1228.132) -- 0:01:55
392000 -- (-1228.751) [-1231.009] (-1229.039) (-1224.570) * [-1228.883] (-1223.081) (-1230.737) (-1231.977) -- 0:01:54
392500 -- (-1229.005) [-1230.368] (-1233.608) (-1223.092) * (-1221.880) [-1225.821] (-1228.545) (-1225.249) -- 0:01:54
393000 -- (-1223.524) (-1233.430) (-1228.265) [-1226.741] * [-1225.513] (-1225.379) (-1226.702) (-1226.539) -- 0:01:54
393500 -- [-1220.238] (-1229.219) (-1224.279) (-1230.674) * (-1222.937) [-1224.409] (-1228.611) (-1230.196) -- 0:01:54
394000 -- [-1225.213] (-1226.451) (-1226.450) (-1231.916) * (-1221.187) (-1224.871) (-1229.777) [-1224.858] -- 0:01:53
394500 -- (-1229.197) (-1235.042) [-1226.744] (-1228.471) * (-1228.858) (-1228.154) [-1226.963] (-1221.931) -- 0:01:53
395000 -- (-1227.798) [-1226.526] (-1224.115) (-1228.039) * (-1223.083) (-1231.133) (-1229.185) [-1224.008] -- 0:01:53
Average standard deviation of split frequencies: 0.005654
395500 -- (-1224.698) (-1230.565) (-1229.177) [-1229.263] * [-1226.777] (-1233.614) (-1226.726) (-1229.998) -- 0:01:54
396000 -- (-1221.944) (-1232.059) [-1225.981] (-1227.256) * (-1229.024) (-1228.664) (-1227.521) [-1225.806] -- 0:01:54
396500 -- (-1226.130) [-1227.109] (-1226.720) (-1224.016) * (-1229.128) [-1222.805] (-1221.805) (-1226.009) -- 0:01:54
397000 -- (-1226.079) [-1223.591] (-1224.413) (-1227.001) * (-1221.607) [-1224.752] (-1230.155) (-1227.076) -- 0:01:53
397500 -- (-1231.442) (-1224.056) (-1227.371) [-1225.414] * [-1225.538] (-1222.369) (-1230.707) (-1225.080) -- 0:01:53
398000 -- (-1226.132) (-1231.179) [-1223.756] (-1228.323) * (-1225.184) (-1227.223) (-1225.018) [-1223.826] -- 0:01:53
398500 -- [-1222.618] (-1232.907) (-1227.516) (-1229.991) * (-1221.968) (-1226.719) (-1228.658) [-1226.106] -- 0:01:53
399000 -- (-1224.148) (-1231.527) (-1227.756) [-1230.860] * (-1221.518) [-1226.485] (-1230.220) (-1223.596) -- 0:01:52
399500 -- (-1228.841) [-1228.242] (-1227.367) (-1233.915) * [-1227.605] (-1223.237) (-1228.624) (-1225.899) -- 0:01:52
400000 -- (-1225.467) (-1230.426) [-1227.339] (-1232.715) * (-1231.112) (-1225.871) (-1224.795) [-1227.483] -- 0:01:52
Average standard deviation of split frequencies: 0.003824
400500 -- [-1226.491] (-1227.978) (-1222.616) (-1225.848) * (-1234.821) (-1224.726) [-1224.213] (-1223.806) -- 0:01:53
401000 -- (-1225.759) (-1224.786) [-1224.491] (-1226.594) * (-1229.493) (-1224.879) [-1224.643] (-1226.480) -- 0:01:53
401500 -- (-1229.228) (-1231.620) (-1222.867) [-1225.862] * (-1235.677) (-1225.505) [-1223.906] (-1226.486) -- 0:01:53
402000 -- [-1227.936] (-1229.329) (-1225.503) (-1225.934) * (-1231.425) (-1228.592) [-1228.108] (-1230.269) -- 0:01:53
402500 -- (-1222.149) [-1226.298] (-1228.423) (-1221.117) * (-1228.646) [-1225.581] (-1225.498) (-1225.465) -- 0:01:52
403000 -- [-1236.137] (-1227.835) (-1229.447) (-1230.151) * (-1226.671) (-1224.945) (-1220.076) [-1228.265] -- 0:01:52
403500 -- [-1227.101] (-1224.118) (-1229.320) (-1224.913) * (-1227.179) [-1223.023] (-1222.543) (-1223.973) -- 0:01:52
404000 -- (-1225.093) [-1223.240] (-1228.248) (-1228.623) * (-1234.188) (-1225.401) (-1223.656) [-1224.911] -- 0:01:52
404500 -- (-1221.394) [-1219.860] (-1225.874) (-1226.277) * (-1229.105) (-1228.245) (-1224.525) [-1224.868] -- 0:01:51
405000 -- (-1226.321) (-1232.517) [-1222.736] (-1222.655) * (-1231.491) [-1223.708] (-1224.057) (-1226.709) -- 0:01:51
Average standard deviation of split frequencies: 0.005225
405500 -- (-1227.938) [-1228.103] (-1224.211) (-1233.008) * (-1229.648) [-1222.793] (-1234.082) (-1221.889) -- 0:01:51
406000 -- [-1224.345] (-1228.274) (-1224.727) (-1230.840) * (-1231.367) [-1227.010] (-1225.564) (-1222.560) -- 0:01:52
406500 -- [-1226.730] (-1227.735) (-1227.694) (-1226.903) * (-1230.257) (-1237.371) (-1225.669) [-1224.119] -- 0:01:52
407000 -- (-1231.633) (-1222.216) [-1223.656] (-1228.759) * (-1234.609) (-1228.430) [-1221.235] (-1231.418) -- 0:01:52
407500 -- (-1227.903) [-1228.255] (-1221.200) (-1227.847) * (-1227.045) (-1226.792) (-1228.444) [-1224.732] -- 0:01:51
408000 -- [-1225.527] (-1224.642) (-1225.120) (-1226.163) * [-1223.142] (-1229.594) (-1224.966) (-1224.774) -- 0:01:51
408500 -- (-1227.957) [-1222.444] (-1221.123) (-1226.927) * [-1223.885] (-1232.207) (-1229.202) (-1227.017) -- 0:01:51
409000 -- [-1230.246] (-1228.896) (-1234.642) (-1225.536) * (-1223.555) [-1227.318] (-1227.240) (-1230.611) -- 0:01:51
409500 -- (-1225.819) (-1229.330) (-1223.314) [-1226.696] * [-1226.138] (-1224.846) (-1230.125) (-1222.875) -- 0:01:51
410000 -- (-1226.479) [-1225.371] (-1227.837) (-1223.205) * [-1226.535] (-1223.809) (-1220.968) (-1225.392) -- 0:01:50
Average standard deviation of split frequencies: 0.005740
410500 -- (-1224.824) (-1224.727) [-1228.086] (-1233.915) * (-1225.489) (-1225.295) (-1231.975) [-1233.362] -- 0:01:50
411000 -- (-1230.864) (-1220.425) (-1220.600) [-1226.952] * (-1228.604) (-1224.360) (-1230.558) [-1228.583] -- 0:01:50
411500 -- (-1230.828) (-1226.455) (-1230.486) [-1224.760] * (-1230.014) [-1225.120] (-1230.740) (-1226.176) -- 0:01:51
412000 -- [-1225.775] (-1228.009) (-1234.637) (-1228.600) * (-1234.400) (-1225.783) (-1224.615) [-1224.800] -- 0:01:51
412500 -- (-1223.693) [-1224.321] (-1227.209) (-1222.034) * [-1228.189] (-1229.845) (-1227.870) (-1224.920) -- 0:01:51
413000 -- (-1226.385) (-1226.315) [-1227.174] (-1227.037) * [-1220.500] (-1228.290) (-1226.067) (-1221.615) -- 0:01:50
413500 -- (-1229.444) (-1226.840) [-1225.980] (-1231.143) * (-1229.092) [-1224.105] (-1222.309) (-1226.269) -- 0:01:50
414000 -- (-1225.714) (-1230.626) [-1222.789] (-1223.155) * [-1222.827] (-1221.589) (-1223.403) (-1225.374) -- 0:01:50
414500 -- [-1222.464] (-1226.813) (-1223.426) (-1233.726) * (-1228.746) [-1221.883] (-1229.521) (-1220.341) -- 0:01:50
415000 -- (-1227.331) [-1226.116] (-1224.471) (-1225.631) * [-1223.866] (-1226.271) (-1224.407) (-1223.030) -- 0:01:49
Average standard deviation of split frequencies: 0.005099
415500 -- (-1235.917) (-1231.145) (-1226.508) [-1222.616] * [-1228.765] (-1226.979) (-1223.855) (-1223.555) -- 0:01:49
416000 -- (-1226.333) (-1226.054) [-1222.380] (-1225.670) * [-1232.261] (-1224.248) (-1227.097) (-1224.857) -- 0:01:49
416500 -- (-1230.252) [-1226.691] (-1226.440) (-1224.708) * (-1227.210) (-1229.083) (-1223.110) [-1228.414] -- 0:01:50
417000 -- (-1223.047) (-1221.178) (-1224.296) [-1223.037] * (-1232.498) (-1230.405) (-1229.174) [-1223.973] -- 0:01:50
417500 -- (-1230.754) [-1224.793] (-1223.000) (-1232.385) * (-1232.044) (-1232.494) [-1228.285] (-1226.864) -- 0:01:50
418000 -- (-1231.687) (-1227.394) [-1231.959] (-1229.163) * (-1228.083) (-1225.761) (-1227.999) [-1221.583] -- 0:01:49
418500 -- (-1230.690) (-1225.956) (-1227.952) [-1227.788] * (-1229.088) [-1225.411] (-1226.791) (-1226.085) -- 0:01:49
419000 -- (-1226.167) [-1223.883] (-1227.222) (-1232.595) * (-1223.011) (-1223.526) (-1225.373) [-1226.570] -- 0:01:49
419500 -- (-1220.818) (-1226.637) (-1226.217) [-1226.626] * (-1225.171) (-1226.460) (-1230.181) [-1226.447] -- 0:01:49
420000 -- [-1224.922] (-1234.798) (-1225.338) (-1223.028) * (-1227.848) (-1226.956) (-1228.335) [-1233.596] -- 0:01:49
Average standard deviation of split frequencies: 0.006724
420500 -- (-1229.074) (-1228.794) (-1230.411) [-1221.541] * (-1226.038) (-1224.245) [-1228.720] (-1225.152) -- 0:01:48
421000 -- [-1224.878] (-1227.630) (-1228.883) (-1222.264) * (-1228.138) [-1223.188] (-1225.414) (-1227.937) -- 0:01:48
421500 -- (-1227.379) [-1236.388] (-1233.318) (-1219.432) * (-1227.880) [-1224.028] (-1237.441) (-1233.862) -- 0:01:49
422000 -- (-1228.194) [-1230.160] (-1224.897) (-1226.460) * (-1226.901) (-1222.689) [-1233.147] (-1227.893) -- 0:01:49
422500 -- (-1230.684) (-1232.899) (-1223.137) [-1233.200] * (-1228.318) (-1231.792) (-1227.194) [-1222.800] -- 0:01:49
423000 -- (-1226.775) (-1227.204) [-1229.856] (-1226.685) * (-1230.764) (-1222.146) [-1225.254] (-1230.229) -- 0:01:49
423500 -- (-1228.181) [-1223.547] (-1223.659) (-1228.679) * (-1221.934) (-1232.139) (-1229.152) [-1228.586] -- 0:01:48
424000 -- [-1231.232] (-1233.015) (-1229.848) (-1226.470) * (-1230.590) (-1229.583) [-1225.007] (-1230.778) -- 0:01:48
424500 -- (-1227.850) (-1231.080) [-1229.339] (-1226.182) * (-1223.408) (-1225.682) (-1231.439) [-1226.721] -- 0:01:48
425000 -- (-1234.437) [-1225.770] (-1225.193) (-1229.669) * (-1227.732) [-1232.462] (-1230.031) (-1228.432) -- 0:01:48
Average standard deviation of split frequencies: 0.006640
425500 -- (-1227.115) (-1225.694) [-1223.036] (-1227.791) * [-1226.299] (-1228.375) (-1225.591) (-1227.532) -- 0:01:48
426000 -- (-1227.690) (-1222.728) [-1224.594] (-1228.877) * (-1225.911) (-1230.525) (-1225.863) [-1225.556] -- 0:01:47
426500 -- [-1225.899] (-1223.515) (-1230.627) (-1225.726) * (-1230.405) [-1226.183] (-1227.694) (-1225.229) -- 0:01:48
427000 -- (-1225.864) (-1226.166) (-1225.307) [-1227.274] * (-1227.108) [-1225.018] (-1227.579) (-1231.716) -- 0:01:48
427500 -- (-1222.253) [-1226.601] (-1224.611) (-1228.893) * (-1221.731) [-1223.672] (-1225.621) (-1227.214) -- 0:01:48
428000 -- (-1226.731) (-1225.984) (-1229.575) [-1235.219] * (-1230.285) [-1225.334] (-1222.571) (-1223.397) -- 0:01:48
428500 -- [-1224.508] (-1228.918) (-1228.686) (-1225.419) * [-1227.076] (-1225.353) (-1229.783) (-1225.894) -- 0:01:48
429000 -- (-1224.323) (-1233.751) (-1223.673) [-1225.702] * [-1228.164] (-1234.419) (-1223.303) (-1224.080) -- 0:01:47
429500 -- [-1233.421] (-1227.856) (-1230.036) (-1228.443) * (-1231.861) (-1227.567) (-1227.510) [-1229.939] -- 0:01:47
430000 -- (-1235.183) (-1233.046) [-1223.252] (-1225.440) * (-1225.470) (-1226.273) (-1231.703) [-1224.600] -- 0:01:47
Average standard deviation of split frequencies: 0.006568
430500 -- (-1230.408) (-1232.009) (-1227.556) [-1226.719] * (-1225.708) (-1230.874) (-1228.608) [-1221.609] -- 0:01:47
431000 -- [-1228.407] (-1241.099) (-1226.304) (-1226.762) * (-1225.204) (-1229.725) [-1225.947] (-1222.162) -- 0:01:46
431500 -- (-1224.351) (-1231.428) [-1220.152] (-1228.266) * (-1229.055) (-1233.126) [-1228.173] (-1225.047) -- 0:01:46
432000 -- (-1222.764) (-1230.267) (-1224.833) [-1224.541] * [-1227.739] (-1228.191) (-1220.422) (-1229.366) -- 0:01:47
432500 -- (-1229.719) [-1233.518] (-1231.171) (-1229.097) * (-1225.715) (-1224.048) [-1224.987] (-1231.913) -- 0:01:47
433000 -- (-1226.168) (-1224.905) [-1220.768] (-1227.182) * [-1223.101] (-1227.204) (-1230.873) (-1226.436) -- 0:01:47
433500 -- (-1226.513) (-1224.799) (-1223.180) [-1230.014] * (-1224.118) (-1222.988) (-1222.438) [-1225.942] -- 0:01:47
434000 -- (-1232.378) [-1226.905] (-1236.036) (-1227.221) * (-1223.799) [-1221.474] (-1231.616) (-1229.119) -- 0:01:46
434500 -- (-1221.731) (-1229.607) [-1230.858] (-1223.344) * (-1230.703) (-1227.561) (-1226.534) [-1223.355] -- 0:01:46
435000 -- (-1227.489) (-1223.141) (-1224.238) [-1222.393] * (-1228.287) (-1228.944) [-1227.111] (-1223.867) -- 0:01:46
Average standard deviation of split frequencies: 0.007028
435500 -- (-1230.273) (-1228.700) [-1229.533] (-1224.762) * (-1231.189) (-1229.783) (-1233.666) [-1225.735] -- 0:01:46
436000 -- (-1226.895) (-1227.024) (-1228.994) [-1225.481] * (-1229.868) (-1226.919) [-1223.480] (-1225.298) -- 0:01:46
436500 -- (-1234.149) (-1231.840) (-1227.378) [-1223.605] * (-1231.389) (-1228.023) [-1227.525] (-1230.625) -- 0:01:45
437000 -- [-1227.725] (-1228.315) (-1232.133) (-1223.370) * (-1228.448) (-1229.407) (-1225.813) [-1225.937] -- 0:01:45
437500 -- (-1224.304) (-1222.269) [-1226.205] (-1225.553) * [-1226.892] (-1228.532) (-1228.721) (-1226.770) -- 0:01:46
438000 -- (-1226.181) (-1230.940) (-1230.247) [-1223.442] * (-1226.604) (-1230.669) [-1224.596] (-1225.981) -- 0:01:46
438500 -- (-1229.052) (-1235.839) (-1232.922) [-1226.008] * (-1228.876) (-1229.209) (-1226.301) [-1225.778] -- 0:01:46
439000 -- (-1226.863) (-1221.129) [-1232.620] (-1230.436) * (-1231.464) (-1245.768) [-1220.713] (-1227.686) -- 0:01:46
439500 -- (-1225.550) (-1230.995) (-1232.434) [-1229.445] * (-1225.013) (-1234.276) [-1221.058] (-1224.814) -- 0:01:45
440000 -- (-1230.483) (-1225.912) (-1228.400) [-1220.729] * (-1227.981) [-1226.774] (-1221.733) (-1230.242) -- 0:01:45
Average standard deviation of split frequencies: 0.005349
440500 -- [-1226.927] (-1228.810) (-1224.352) (-1228.189) * (-1228.538) (-1223.448) [-1225.199] (-1233.431) -- 0:01:45
441000 -- (-1226.170) (-1224.621) [-1227.042] (-1229.331) * (-1228.257) [-1227.226] (-1230.943) (-1235.246) -- 0:01:45
441500 -- (-1234.294) (-1224.784) [-1227.201] (-1223.729) * (-1223.942) [-1227.987] (-1222.445) (-1228.204) -- 0:01:44
442000 -- (-1226.621) (-1224.709) [-1225.253] (-1228.710) * (-1226.121) (-1226.753) [-1225.197] (-1228.171) -- 0:01:44
442500 -- (-1227.653) (-1229.955) [-1225.124] (-1227.246) * (-1223.829) [-1228.045] (-1227.988) (-1225.517) -- 0:01:45
443000 -- (-1226.804) (-1229.450) [-1225.647] (-1231.210) * (-1228.785) [-1226.747] (-1227.524) (-1222.820) -- 0:01:45
443500 -- (-1230.409) [-1230.339] (-1236.363) (-1225.241) * [-1229.195] (-1232.520) (-1227.777) (-1223.288) -- 0:01:45
444000 -- (-1222.597) (-1236.517) (-1230.404) [-1226.866] * (-1227.787) (-1230.920) [-1223.226] (-1222.326) -- 0:01:45
444500 -- [-1223.136] (-1223.324) (-1226.547) (-1232.911) * (-1231.828) (-1230.578) (-1229.899) [-1231.119] -- 0:01:44
445000 -- [-1222.522] (-1226.519) (-1222.424) (-1224.539) * (-1234.083) (-1228.927) [-1230.639] (-1226.443) -- 0:01:44
Average standard deviation of split frequencies: 0.004492
445500 -- (-1223.553) (-1226.704) (-1225.816) [-1220.130] * [-1222.637] (-1228.874) (-1229.104) (-1223.139) -- 0:01:44
446000 -- (-1223.787) (-1226.018) [-1222.810] (-1224.143) * (-1229.439) (-1226.742) (-1228.455) [-1230.440] -- 0:01:44
446500 -- (-1224.149) [-1221.392] (-1229.006) (-1222.062) * (-1228.689) [-1227.640] (-1224.056) (-1226.408) -- 0:01:44
447000 -- (-1228.085) [-1221.808] (-1229.707) (-1228.561) * (-1230.232) (-1229.646) [-1225.777] (-1226.353) -- 0:01:43
447500 -- (-1225.178) [-1222.468] (-1227.107) (-1224.274) * (-1229.468) (-1227.729) [-1223.769] (-1224.281) -- 0:01:43
448000 -- (-1230.782) (-1224.968) (-1227.666) [-1221.349] * (-1226.148) (-1223.432) [-1225.912] (-1231.795) -- 0:01:44
448500 -- (-1228.313) (-1225.594) (-1236.807) [-1221.698] * (-1227.914) (-1228.993) [-1227.488] (-1227.030) -- 0:01:44
449000 -- (-1227.523) (-1224.109) (-1232.243) [-1222.284] * (-1226.276) (-1238.670) [-1228.906] (-1225.637) -- 0:01:44
449500 -- (-1227.303) [-1228.178] (-1232.481) (-1222.349) * (-1227.548) (-1225.217) [-1224.677] (-1228.010) -- 0:01:44
450000 -- (-1226.480) [-1225.327] (-1232.568) (-1237.405) * [-1228.991] (-1224.973) (-1226.673) (-1231.128) -- 0:01:43
Average standard deviation of split frequencies: 0.006015
450500 -- [-1223.431] (-1221.125) (-1230.896) (-1224.458) * (-1228.808) (-1228.965) [-1229.605] (-1227.797) -- 0:01:43
451000 -- [-1226.449] (-1224.376) (-1233.921) (-1231.413) * (-1227.058) [-1225.928] (-1231.344) (-1233.370) -- 0:01:43
451500 -- (-1226.227) (-1226.266) [-1225.964] (-1226.411) * (-1228.133) (-1230.015) (-1231.641) [-1223.190] -- 0:01:43
452000 -- [-1224.874] (-1229.053) (-1226.586) (-1231.526) * (-1225.839) (-1234.044) (-1224.953) [-1227.569] -- 0:01:43
452500 -- (-1226.115) (-1228.967) [-1226.820] (-1230.007) * (-1225.412) (-1225.321) (-1227.588) [-1223.614] -- 0:01:42
453000 -- (-1223.332) (-1232.078) [-1222.006] (-1224.783) * (-1228.758) (-1226.685) (-1228.305) [-1222.735] -- 0:01:42
453500 -- (-1225.997) (-1229.871) [-1227.786] (-1236.932) * (-1230.824) [-1227.788] (-1234.875) (-1227.003) -- 0:01:43
454000 -- (-1222.083) (-1229.754) (-1223.548) [-1225.032] * [-1229.252] (-1222.005) (-1233.100) (-1230.254) -- 0:01:43
454500 -- (-1226.795) (-1229.433) [-1229.578] (-1229.818) * (-1225.006) (-1224.753) [-1225.393] (-1225.082) -- 0:01:43
455000 -- (-1225.684) (-1234.846) (-1223.046) [-1225.091] * (-1229.071) (-1232.501) [-1221.405] (-1220.623) -- 0:01:43
Average standard deviation of split frequencies: 0.005427
455500 -- (-1222.135) [-1226.826] (-1224.384) (-1225.740) * [-1227.578] (-1226.596) (-1229.979) (-1223.872) -- 0:01:42
456000 -- [-1227.344] (-1232.166) (-1226.475) (-1226.466) * (-1228.353) (-1232.806) [-1229.707] (-1222.809) -- 0:01:42
456500 -- [-1227.055] (-1228.551) (-1220.561) (-1231.694) * (-1222.765) (-1228.173) [-1227.832] (-1228.449) -- 0:01:42
457000 -- (-1231.855) (-1227.671) [-1226.443] (-1228.252) * (-1225.763) (-1225.655) [-1223.275] (-1229.232) -- 0:01:42
457500 -- [-1224.981] (-1230.954) (-1230.002) (-1234.250) * (-1230.950) (-1227.337) (-1231.739) [-1224.121] -- 0:01:41
458000 -- (-1228.261) (-1230.847) [-1225.901] (-1227.329) * [-1234.737] (-1226.953) (-1236.291) (-1221.832) -- 0:01:41
458500 -- [-1230.888] (-1233.523) (-1221.591) (-1225.652) * (-1226.383) [-1228.610] (-1224.585) (-1223.366) -- 0:01:41
459000 -- (-1223.108) (-1227.569) [-1232.231] (-1227.406) * (-1225.169) [-1231.016] (-1227.017) (-1227.310) -- 0:01:42
459500 -- (-1224.629) (-1224.864) (-1222.840) [-1227.326] * (-1222.737) (-1225.982) [-1225.557] (-1234.014) -- 0:01:42
460000 -- (-1218.592) [-1227.880] (-1224.036) (-1231.095) * (-1224.509) (-1232.428) (-1224.064) [-1225.841] -- 0:01:42
Average standard deviation of split frequencies: 0.008442
460500 -- [-1222.586] (-1232.280) (-1224.236) (-1222.570) * (-1219.894) [-1228.593] (-1226.022) (-1230.805) -- 0:01:41
461000 -- [-1224.663] (-1227.666) (-1225.980) (-1225.424) * (-1225.765) [-1222.658] (-1234.896) (-1237.442) -- 0:01:41
461500 -- (-1225.588) (-1224.299) [-1223.515] (-1228.687) * [-1228.401] (-1228.721) (-1222.345) (-1228.561) -- 0:01:41
462000 -- (-1231.610) (-1225.781) (-1222.586) [-1226.744] * (-1230.788) (-1229.350) (-1231.164) [-1224.816] -- 0:01:41
462500 -- (-1227.166) [-1222.277] (-1230.570) (-1224.724) * (-1229.160) [-1222.006] (-1232.344) (-1224.529) -- 0:01:41
463000 -- [-1226.329] (-1231.243) (-1225.616) (-1223.557) * (-1226.610) [-1222.353] (-1233.736) (-1228.942) -- 0:01:40
463500 -- (-1228.301) (-1227.765) (-1229.186) [-1226.492] * (-1220.755) (-1224.472) (-1233.157) [-1218.562] -- 0:01:40
464000 -- (-1231.345) [-1225.862] (-1232.257) (-1221.957) * (-1223.018) [-1226.619] (-1225.050) (-1222.757) -- 0:01:41
464500 -- (-1231.287) (-1222.147) [-1225.350] (-1232.961) * (-1223.543) (-1227.512) [-1222.604] (-1227.813) -- 0:01:41
465000 -- (-1225.370) (-1225.231) (-1224.692) [-1223.373] * (-1226.261) (-1230.409) [-1219.744] (-1227.139) -- 0:01:41
Average standard deviation of split frequencies: 0.009357
465500 -- [-1224.501] (-1225.348) (-1228.159) (-1224.285) * (-1229.016) [-1226.187] (-1223.477) (-1227.383) -- 0:01:41
466000 -- [-1224.315] (-1226.057) (-1223.995) (-1227.374) * (-1233.947) (-1227.219) (-1227.241) [-1227.997] -- 0:01:40
466500 -- [-1225.070] (-1232.844) (-1228.649) (-1231.475) * [-1226.559] (-1223.739) (-1223.117) (-1227.901) -- 0:01:40
467000 -- [-1224.128] (-1225.902) (-1224.967) (-1226.903) * (-1225.296) (-1225.545) [-1226.071] (-1223.935) -- 0:01:40
467500 -- [-1229.427] (-1226.915) (-1225.871) (-1226.853) * (-1226.071) (-1229.291) [-1227.030] (-1229.607) -- 0:01:40
468000 -- (-1225.391) (-1222.723) (-1228.806) [-1225.120] * [-1230.236] (-1224.181) (-1228.605) (-1226.060) -- 0:01:40
468500 -- [-1226.467] (-1228.066) (-1223.739) (-1224.861) * (-1226.373) (-1225.311) [-1225.660] (-1228.094) -- 0:01:39
469000 -- [-1225.357] (-1224.491) (-1231.801) (-1224.539) * (-1237.323) (-1222.132) (-1223.531) [-1223.895] -- 0:01:39
469500 -- (-1225.745) (-1238.194) (-1229.272) [-1228.334] * (-1223.012) (-1226.705) (-1227.193) [-1230.736] -- 0:01:40
470000 -- (-1231.908) (-1225.893) (-1230.351) [-1224.123] * (-1221.772) [-1226.972] (-1233.973) (-1229.014) -- 0:01:40
Average standard deviation of split frequencies: 0.008764
470500 -- (-1229.951) [-1234.583] (-1229.653) (-1227.831) * [-1223.790] (-1221.855) (-1228.614) (-1230.531) -- 0:01:40
471000 -- [-1228.814] (-1233.095) (-1226.809) (-1226.437) * (-1228.698) (-1223.325) (-1232.648) [-1228.065] -- 0:01:39
471500 -- [-1229.882] (-1227.052) (-1227.472) (-1228.178) * (-1232.877) [-1221.408] (-1227.372) (-1225.859) -- 0:01:39
472000 -- (-1228.198) (-1221.717) [-1228.258] (-1227.387) * (-1228.338) (-1228.135) [-1223.506] (-1227.100) -- 0:01:39
472500 -- (-1223.532) [-1227.392] (-1227.737) (-1230.166) * (-1232.714) [-1222.109] (-1226.836) (-1229.381) -- 0:01:39
473000 -- (-1228.834) (-1224.233) [-1227.426] (-1226.600) * [-1233.750] (-1230.628) (-1223.774) (-1227.973) -- 0:01:39
473500 -- [-1223.761] (-1229.804) (-1227.935) (-1225.984) * (-1224.937) (-1229.038) [-1220.957] (-1232.651) -- 0:01:38
474000 -- [-1226.738] (-1230.293) (-1228.060) (-1223.445) * (-1229.065) (-1232.362) (-1224.407) [-1227.325] -- 0:01:38
474500 -- (-1226.342) (-1230.793) (-1236.765) [-1226.920] * (-1233.160) (-1226.623) [-1222.322] (-1221.163) -- 0:01:39
475000 -- (-1222.857) [-1225.013] (-1228.234) (-1227.119) * (-1236.860) (-1227.751) (-1225.188) [-1222.751] -- 0:01:39
Average standard deviation of split frequencies: 0.007180
475500 -- (-1238.590) (-1226.665) (-1226.697) [-1225.526] * (-1228.829) (-1224.731) (-1226.428) [-1223.099] -- 0:01:39
476000 -- (-1231.086) (-1224.973) [-1223.676] (-1231.033) * [-1225.464] (-1233.235) (-1225.862) (-1229.260) -- 0:01:39
476500 -- (-1234.305) (-1226.110) [-1225.109] (-1233.258) * (-1225.423) (-1233.605) [-1226.580] (-1227.230) -- 0:01:38
477000 -- (-1226.517) (-1230.907) [-1230.430] (-1228.910) * (-1227.377) (-1236.359) (-1232.340) [-1230.999] -- 0:01:38
477500 -- [-1223.798] (-1225.923) (-1226.116) (-1225.419) * [-1222.531] (-1228.655) (-1227.368) (-1221.808) -- 0:01:38
478000 -- (-1232.832) (-1227.273) (-1223.091) [-1230.137] * (-1222.622) [-1225.667] (-1224.615) (-1223.579) -- 0:01:38
478500 -- (-1231.782) (-1231.480) (-1225.287) [-1227.910] * (-1232.299) (-1227.359) [-1228.527] (-1228.791) -- 0:01:38
479000 -- [-1225.733] (-1226.734) (-1228.257) (-1230.960) * [-1227.952] (-1237.909) (-1230.630) (-1229.265) -- 0:01:37
479500 -- (-1230.357) (-1226.840) [-1223.698] (-1229.478) * (-1229.171) [-1227.838] (-1225.194) (-1234.296) -- 0:01:37
480000 -- [-1222.532] (-1225.136) (-1228.461) (-1225.645) * (-1225.834) (-1227.526) (-1226.688) [-1231.392] -- 0:01:38
Average standard deviation of split frequencies: 0.009072
480500 -- (-1230.400) (-1221.092) (-1226.234) [-1223.480] * (-1223.311) (-1227.380) [-1224.951] (-1229.802) -- 0:01:38
481000 -- (-1227.210) [-1226.883] (-1228.538) (-1233.277) * (-1225.807) [-1228.076] (-1229.641) (-1226.461) -- 0:01:38
481500 -- (-1227.493) (-1225.434) [-1229.104] (-1229.442) * (-1231.219) [-1233.485] (-1228.470) (-1226.893) -- 0:01:37
482000 -- [-1223.999] (-1224.596) (-1224.305) (-1229.210) * (-1224.491) (-1231.159) (-1236.946) [-1226.903] -- 0:01:37
482500 -- (-1224.054) (-1224.581) (-1228.340) [-1225.357] * [-1223.288] (-1222.443) (-1223.825) (-1230.527) -- 0:01:37
483000 -- (-1225.695) [-1227.011] (-1224.637) (-1225.626) * (-1229.734) (-1225.261) (-1226.895) [-1230.607] -- 0:01:37
483500 -- [-1221.691] (-1232.565) (-1221.634) (-1228.362) * [-1224.459] (-1229.057) (-1235.737) (-1222.101) -- 0:01:37
484000 -- (-1226.016) [-1225.647] (-1230.200) (-1228.405) * (-1228.799) [-1223.438] (-1231.773) (-1225.201) -- 0:01:37
484500 -- [-1226.153] (-1225.571) (-1226.327) (-1226.574) * (-1223.081) (-1225.891) (-1226.101) [-1229.415] -- 0:01:36
485000 -- (-1224.776) (-1229.801) (-1226.323) [-1224.904] * (-1223.343) (-1224.392) (-1222.872) [-1227.782] -- 0:01:36
Average standard deviation of split frequencies: 0.007517
485500 -- (-1227.591) [-1224.009] (-1226.288) (-1224.829) * (-1231.440) (-1222.665) (-1226.058) [-1228.433] -- 0:01:37
486000 -- (-1224.453) (-1226.823) [-1225.911] (-1227.176) * (-1230.522) (-1222.850) [-1224.332] (-1224.279) -- 0:01:37
486500 -- (-1228.925) [-1226.402] (-1225.327) (-1228.665) * (-1225.553) (-1219.852) [-1229.426] (-1233.988) -- 0:01:37
487000 -- (-1234.873) (-1224.692) [-1227.034] (-1231.858) * (-1223.545) [-1227.234] (-1227.786) (-1230.289) -- 0:01:36
487500 -- (-1226.194) (-1229.889) (-1224.910) [-1230.680] * (-1230.443) (-1233.749) (-1230.238) [-1224.174] -- 0:01:36
488000 -- (-1223.628) (-1226.549) [-1230.271] (-1226.130) * [-1227.393] (-1228.208) (-1223.295) (-1226.845) -- 0:01:36
488500 -- [-1222.794] (-1231.133) (-1233.675) (-1224.792) * (-1227.142) (-1228.143) (-1224.079) [-1224.295] -- 0:01:36
489000 -- (-1222.941) (-1228.936) (-1225.968) [-1225.551] * (-1227.171) (-1231.601) (-1227.130) [-1223.951] -- 0:01:36
489500 -- (-1226.660) (-1226.587) (-1227.807) [-1223.855] * (-1229.324) (-1227.717) (-1233.543) [-1222.074] -- 0:01:35
490000 -- (-1222.859) [-1225.687] (-1222.889) (-1232.943) * (-1230.443) (-1223.503) [-1223.471] (-1226.606) -- 0:01:35
Average standard deviation of split frequencies: 0.005764
490500 -- [-1223.121] (-1228.489) (-1224.862) (-1223.474) * (-1225.206) [-1228.478] (-1224.181) (-1227.525) -- 0:01:36
491000 -- (-1224.869) (-1225.541) (-1223.729) [-1226.929] * (-1222.128) (-1225.961) [-1223.943] (-1224.639) -- 0:01:36
491500 -- (-1230.763) (-1226.704) (-1232.621) [-1227.072] * (-1218.513) [-1226.451] (-1231.881) (-1222.581) -- 0:01:36
492000 -- (-1231.096) [-1220.144] (-1223.986) (-1228.295) * (-1227.288) (-1224.993) (-1227.392) [-1223.258] -- 0:01:36
492500 -- (-1228.049) [-1223.930] (-1238.327) (-1229.808) * (-1223.579) [-1227.653] (-1223.703) (-1230.877) -- 0:01:35
493000 -- [-1227.150] (-1227.164) (-1232.730) (-1227.772) * (-1227.071) (-1234.205) (-1229.108) [-1223.971] -- 0:01:35
493500 -- [-1225.507] (-1232.464) (-1223.159) (-1230.622) * (-1230.654) (-1233.148) (-1223.902) [-1230.550] -- 0:01:35
494000 -- [-1225.149] (-1228.901) (-1228.884) (-1231.111) * (-1226.079) (-1236.449) (-1222.382) [-1226.176] -- 0:01:35
494500 -- (-1229.820) (-1229.677) (-1230.734) [-1230.276] * [-1221.773] (-1230.973) (-1231.875) (-1224.705) -- 0:01:35
495000 -- (-1225.984) (-1231.151) (-1228.340) [-1230.759] * (-1227.080) (-1233.663) (-1220.397) [-1226.118] -- 0:01:34
Average standard deviation of split frequencies: 0.006653
495500 -- (-1226.388) [-1228.365] (-1228.970) (-1228.511) * (-1227.542) (-1225.050) [-1224.124] (-1224.890) -- 0:01:34
496000 -- [-1230.356] (-1228.795) (-1231.385) (-1233.831) * (-1225.640) (-1229.174) (-1227.326) [-1225.831] -- 0:01:35
496500 -- (-1221.839) (-1222.773) [-1230.417] (-1224.974) * (-1227.191) [-1229.652] (-1231.649) (-1220.456) -- 0:01:35
497000 -- (-1230.599) [-1228.143] (-1223.123) (-1231.984) * (-1235.038) [-1225.704] (-1221.753) (-1224.943) -- 0:01:35
497500 -- [-1230.002] (-1224.656) (-1225.314) (-1227.495) * (-1227.025) (-1220.680) (-1224.375) [-1226.148] -- 0:01:34
498000 -- (-1227.943) [-1223.910] (-1224.330) (-1225.592) * [-1226.174] (-1222.074) (-1229.940) (-1222.043) -- 0:01:34
498500 -- (-1225.930) (-1226.093) [-1223.062] (-1223.040) * (-1227.921) (-1230.595) [-1232.195] (-1223.767) -- 0:01:34
499000 -- (-1222.869) [-1222.791] (-1221.902) (-1227.685) * (-1225.817) (-1224.435) (-1239.947) [-1224.096] -- 0:01:34
499500 -- (-1231.089) (-1225.746) (-1234.766) [-1229.998] * (-1235.512) (-1228.130) (-1226.695) [-1223.891] -- 0:01:34
500000 -- (-1225.223) (-1222.001) (-1226.971) [-1228.072] * (-1224.844) (-1227.251) (-1231.018) [-1225.460] -- 0:01:34
Average standard deviation of split frequencies: 0.007062
500500 -- (-1228.513) (-1224.580) (-1226.867) [-1222.967] * (-1223.798) (-1223.459) [-1227.341] (-1223.205) -- 0:01:33
501000 -- (-1225.365) [-1223.067] (-1231.036) (-1223.863) * (-1222.910) (-1224.369) (-1229.001) [-1227.919] -- 0:01:33
501500 -- (-1223.689) (-1221.237) [-1225.832] (-1228.910) * [-1224.624] (-1226.891) (-1221.235) (-1226.595) -- 0:01:34
502000 -- (-1226.016) (-1226.149) (-1229.165) [-1223.758] * (-1229.513) (-1225.664) [-1229.599] (-1230.303) -- 0:01:34
502500 -- (-1225.615) (-1222.814) (-1229.668) [-1223.315] * (-1228.036) (-1230.919) (-1226.454) [-1227.656] -- 0:01:34
503000 -- (-1225.177) (-1231.415) (-1227.785) [-1223.887] * (-1228.346) [-1230.274] (-1229.607) (-1235.256) -- 0:01:33
503500 -- [-1223.480] (-1226.083) (-1227.031) (-1221.123) * [-1226.100] (-1226.341) (-1224.308) (-1224.606) -- 0:01:33
504000 -- (-1236.776) (-1232.100) [-1229.350] (-1228.055) * (-1232.306) (-1227.583) [-1222.535] (-1233.708) -- 0:01:33
504500 -- (-1227.173) (-1227.645) (-1224.433) [-1222.552] * (-1230.211) (-1221.538) [-1227.099] (-1235.575) -- 0:01:33
505000 -- (-1221.748) [-1230.141] (-1226.594) (-1222.209) * (-1227.621) (-1223.601) (-1226.438) [-1226.462] -- 0:01:33
Average standard deviation of split frequencies: 0.006987
505500 -- (-1230.901) [-1224.580] (-1229.332) (-1223.771) * [-1229.392] (-1229.298) (-1226.608) (-1229.178) -- 0:01:32
506000 -- (-1227.950) [-1226.267] (-1222.505) (-1229.407) * (-1230.030) (-1230.732) [-1222.082] (-1236.345) -- 0:01:32
506500 -- (-1224.024) (-1226.986) (-1227.852) [-1221.648] * [-1223.712] (-1235.000) (-1227.212) (-1232.479) -- 0:01:32
507000 -- (-1223.468) [-1222.571] (-1232.822) (-1225.926) * (-1225.943) [-1226.107] (-1225.001) (-1224.898) -- 0:01:33
507500 -- [-1222.248] (-1228.088) (-1227.480) (-1225.515) * (-1226.225) [-1227.622] (-1226.066) (-1236.200) -- 0:01:33
508000 -- [-1226.307] (-1226.445) (-1227.715) (-1226.956) * (-1224.344) (-1222.127) [-1227.277] (-1234.031) -- 0:01:32
508500 -- [-1223.983] (-1220.462) (-1226.360) (-1228.495) * [-1226.636] (-1225.657) (-1231.869) (-1232.740) -- 0:01:32
509000 -- (-1227.525) (-1235.532) (-1225.197) [-1220.266] * (-1226.205) (-1224.744) (-1225.469) [-1231.286] -- 0:01:32
509500 -- (-1223.655) (-1228.134) (-1230.385) [-1223.843] * (-1228.177) [-1224.074] (-1228.112) (-1223.972) -- 0:01:32
510000 -- (-1223.360) [-1224.214] (-1236.241) (-1228.769) * (-1228.724) (-1226.795) [-1225.740] (-1223.439) -- 0:01:32
Average standard deviation of split frequencies: 0.007846
510500 -- (-1222.861) (-1232.093) (-1231.385) [-1228.751] * [-1226.606] (-1222.870) (-1227.934) (-1230.369) -- 0:01:32
511000 -- [-1230.382] (-1234.016) (-1226.307) (-1222.744) * (-1230.745) (-1226.710) (-1226.206) [-1226.686] -- 0:01:31
511500 -- (-1228.181) [-1227.869] (-1227.504) (-1236.404) * (-1235.040) (-1226.842) [-1227.001] (-1224.412) -- 0:01:31
512000 -- (-1222.944) (-1225.944) (-1224.794) [-1234.975] * (-1225.590) (-1229.870) [-1220.899] (-1226.606) -- 0:01:32
512500 -- (-1223.854) (-1224.550) [-1221.887] (-1222.721) * (-1223.015) (-1228.118) (-1220.567) [-1222.230] -- 0:01:32
513000 -- [-1225.047] (-1226.155) (-1229.610) (-1224.683) * (-1226.401) [-1223.477] (-1224.403) (-1224.725) -- 0:01:32
513500 -- (-1221.251) (-1225.474) [-1223.287] (-1221.293) * (-1230.930) (-1229.760) (-1229.422) [-1223.844] -- 0:01:31
514000 -- (-1228.275) (-1224.409) (-1231.085) [-1225.805] * (-1231.656) (-1228.434) [-1226.465] (-1227.012) -- 0:01:31
514500 -- (-1224.725) [-1223.901] (-1224.368) (-1224.452) * (-1227.455) (-1233.128) (-1228.053) [-1227.118] -- 0:01:31
515000 -- [-1222.395] (-1222.681) (-1220.326) (-1225.068) * (-1226.188) (-1235.592) [-1227.996] (-1227.479) -- 0:01:31
Average standard deviation of split frequencies: 0.007765
515500 -- (-1227.426) (-1223.906) [-1219.775] (-1232.005) * (-1225.282) [-1221.120] (-1225.906) (-1222.603) -- 0:01:31
516000 -- [-1222.856] (-1222.013) (-1223.688) (-1229.083) * (-1223.343) [-1223.675] (-1222.389) (-1230.149) -- 0:01:30
516500 -- (-1229.737) (-1221.198) (-1233.914) [-1226.121] * (-1229.199) (-1222.606) [-1227.009] (-1232.188) -- 0:01:30
517000 -- (-1227.041) (-1229.582) (-1227.397) [-1224.821] * (-1221.195) (-1222.724) [-1222.711] (-1223.364) -- 0:01:30
517500 -- (-1224.073) [-1226.227] (-1227.741) (-1224.351) * (-1226.301) [-1229.155] (-1233.243) (-1225.968) -- 0:01:31
518000 -- (-1223.963) (-1238.703) [-1226.468] (-1227.737) * (-1222.440) [-1226.082] (-1231.691) (-1227.711) -- 0:01:31
518500 -- (-1223.495) (-1222.815) (-1231.811) [-1223.878] * (-1220.577) (-1233.248) [-1229.411] (-1226.073) -- 0:01:31
519000 -- (-1230.882) [-1223.980] (-1229.089) (-1222.150) * [-1224.363] (-1228.249) (-1224.295) (-1222.382) -- 0:01:30
519500 -- [-1233.823] (-1227.377) (-1232.024) (-1221.988) * [-1231.794] (-1224.585) (-1232.358) (-1223.096) -- 0:01:30
520000 -- (-1228.334) (-1226.168) (-1227.798) [-1221.446] * (-1223.375) (-1225.487) [-1228.266] (-1223.328) -- 0:01:30
Average standard deviation of split frequencies: 0.007696
520500 -- (-1222.939) (-1226.958) (-1226.359) [-1224.437] * (-1225.240) (-1226.758) [-1229.273] (-1224.454) -- 0:01:30
521000 -- (-1225.499) (-1231.018) [-1222.697] (-1221.580) * (-1229.419) [-1232.420] (-1234.267) (-1230.829) -- 0:01:30
521500 -- [-1226.685] (-1227.458) (-1227.227) (-1226.034) * (-1241.789) [-1224.179] (-1229.964) (-1226.221) -- 0:01:29
522000 -- [-1224.882] (-1226.137) (-1232.428) (-1232.519) * (-1226.519) (-1224.686) (-1224.352) [-1220.497] -- 0:01:29
522500 -- (-1223.423) [-1227.741] (-1237.148) (-1226.850) * (-1225.062) (-1224.478) (-1226.409) [-1229.049] -- 0:01:29
523000 -- [-1223.109] (-1236.803) (-1228.162) (-1228.345) * (-1228.321) (-1225.656) (-1223.888) [-1226.563] -- 0:01:30
523500 -- (-1224.605) [-1229.380] (-1239.298) (-1230.055) * (-1227.061) [-1227.465] (-1224.916) (-1232.730) -- 0:01:30
524000 -- (-1225.773) [-1226.940] (-1223.366) (-1224.525) * (-1227.339) (-1226.788) (-1224.455) [-1229.103] -- 0:01:29
524500 -- [-1228.931] (-1234.507) (-1224.524) (-1225.985) * (-1225.811) (-1228.387) [-1226.950] (-1226.301) -- 0:01:29
525000 -- (-1223.648) (-1229.806) [-1223.618] (-1224.588) * (-1226.444) (-1226.555) (-1224.817) [-1225.450] -- 0:01:29
Average standard deviation of split frequencies: 0.008066
525500 -- (-1227.512) (-1229.710) [-1227.144] (-1226.484) * (-1228.966) [-1227.154] (-1222.574) (-1226.564) -- 0:01:29
526000 -- (-1221.713) (-1227.489) [-1227.580] (-1229.841) * (-1227.157) (-1222.285) (-1229.607) [-1221.608] -- 0:01:29
526500 -- (-1222.873) (-1226.645) (-1222.168) [-1224.654] * (-1231.865) (-1226.015) [-1224.651] (-1232.318) -- 0:01:29
527000 -- (-1222.508) [-1226.639] (-1228.410) (-1226.455) * [-1229.457] (-1223.982) (-1224.342) (-1227.928) -- 0:01:28
527500 -- [-1226.493] (-1221.671) (-1224.394) (-1225.170) * (-1221.947) (-1230.022) [-1221.331] (-1236.291) -- 0:01:28
528000 -- (-1225.291) [-1223.533] (-1224.955) (-1225.285) * [-1227.915] (-1233.771) (-1224.042) (-1228.456) -- 0:01:29
528500 -- [-1225.861] (-1223.183) (-1226.359) (-1221.335) * (-1230.584) (-1224.676) [-1231.219] (-1237.979) -- 0:01:29
529000 -- (-1226.259) [-1226.243] (-1224.708) (-1222.604) * (-1225.029) (-1221.672) [-1228.050] (-1224.620) -- 0:01:29
529500 -- (-1232.879) [-1223.090] (-1225.260) (-1228.142) * (-1227.755) [-1224.911] (-1225.646) (-1234.573) -- 0:01:28
530000 -- (-1235.344) (-1223.688) (-1227.073) [-1223.987] * (-1229.454) [-1225.999] (-1222.773) (-1224.160) -- 0:01:28
Average standard deviation of split frequencies: 0.006662
530500 -- (-1224.312) (-1236.088) [-1223.857] (-1228.021) * [-1225.176] (-1229.477) (-1224.786) (-1228.325) -- 0:01:28
531000 -- [-1222.829] (-1223.738) (-1231.408) (-1227.163) * [-1232.097] (-1222.341) (-1225.437) (-1226.022) -- 0:01:28
531500 -- (-1223.717) (-1231.576) (-1226.026) [-1226.950] * (-1223.087) (-1223.711) [-1228.822] (-1229.724) -- 0:01:28
532000 -- (-1227.357) [-1229.316] (-1224.610) (-1223.945) * (-1229.972) [-1222.438] (-1226.557) (-1229.664) -- 0:01:27
532500 -- (-1231.243) (-1225.247) (-1228.010) [-1225.780] * (-1234.839) [-1224.531] (-1228.608) (-1222.629) -- 0:01:27
533000 -- (-1227.427) (-1229.712) (-1231.142) [-1227.233] * [-1232.928] (-1228.656) (-1227.073) (-1224.115) -- 0:01:27
533500 -- (-1227.623) (-1231.122) (-1229.733) [-1224.434] * (-1235.081) [-1226.464] (-1226.007) (-1224.755) -- 0:01:28
534000 -- [-1223.989] (-1223.669) (-1232.834) (-1224.023) * (-1230.275) (-1228.299) (-1222.751) [-1224.290] -- 0:01:28
534500 -- (-1230.321) [-1232.981] (-1227.986) (-1227.829) * (-1234.692) (-1227.320) (-1226.237) [-1225.480] -- 0:01:27
535000 -- [-1228.308] (-1230.224) (-1230.173) (-1223.272) * (-1226.272) (-1235.533) (-1225.840) [-1225.420] -- 0:01:27
Average standard deviation of split frequencies: 0.008355
535500 -- (-1221.486) (-1228.030) (-1221.837) [-1228.517] * (-1228.313) (-1228.428) [-1224.373] (-1232.200) -- 0:01:27
536000 -- [-1222.097] (-1226.100) (-1225.184) (-1227.460) * (-1226.087) (-1235.021) (-1222.190) [-1227.876] -- 0:01:27
536500 -- (-1224.891) (-1225.360) [-1222.980] (-1231.706) * (-1220.530) (-1234.822) [-1225.639] (-1222.140) -- 0:01:27
537000 -- (-1223.974) (-1228.532) [-1225.722] (-1226.428) * (-1226.825) (-1234.119) [-1223.659] (-1226.424) -- 0:01:27
537500 -- (-1226.599) (-1227.255) [-1225.235] (-1227.855) * (-1224.523) (-1226.502) (-1225.834) [-1225.044] -- 0:01:26
538000 -- [-1224.705] (-1234.567) (-1226.970) (-1222.529) * (-1224.051) (-1232.444) (-1227.908) [-1224.054] -- 0:01:26
538500 -- (-1235.904) [-1226.330] (-1224.037) (-1226.337) * (-1232.076) (-1226.121) [-1225.295] (-1222.445) -- 0:01:26
539000 -- (-1228.101) (-1226.932) (-1223.225) [-1224.116] * (-1226.758) [-1225.290] (-1230.657) (-1223.109) -- 0:01:27
539500 -- (-1224.235) (-1229.551) [-1225.877] (-1229.747) * (-1225.175) (-1220.895) (-1227.621) [-1222.100] -- 0:01:27
540000 -- (-1225.432) [-1226.109] (-1225.190) (-1224.459) * (-1235.809) [-1227.622] (-1227.660) (-1224.835) -- 0:01:26
Average standard deviation of split frequencies: 0.009591
540500 -- [-1224.093] (-1229.859) (-1231.438) (-1221.458) * (-1227.284) (-1223.688) [-1233.024] (-1225.554) -- 0:01:26
541000 -- (-1226.372) (-1230.791) (-1229.521) [-1224.183] * (-1225.068) (-1219.791) (-1221.091) [-1224.694] -- 0:01:26
541500 -- (-1227.646) (-1221.782) (-1234.298) [-1223.161] * (-1227.879) (-1224.204) [-1223.125] (-1222.072) -- 0:01:26
542000 -- (-1224.976) (-1224.627) (-1230.499) [-1223.990] * (-1237.498) [-1225.590] (-1224.177) (-1221.915) -- 0:01:26
542500 -- (-1224.810) (-1226.283) (-1224.416) [-1221.080] * (-1229.790) [-1226.489] (-1226.593) (-1226.383) -- 0:01:26
543000 -- (-1224.898) (-1232.159) (-1224.445) [-1234.493] * (-1230.657) [-1223.681] (-1224.360) (-1224.565) -- 0:01:25
543500 -- (-1242.508) (-1229.255) (-1229.228) [-1226.248] * (-1222.570) (-1228.825) (-1224.235) [-1226.067] -- 0:01:25
544000 -- (-1226.242) [-1225.556] (-1224.566) (-1223.393) * (-1224.129) [-1224.052] (-1225.133) (-1228.632) -- 0:01:25
544500 -- (-1224.694) (-1223.205) (-1230.336) [-1227.176] * (-1228.278) (-1226.536) [-1221.674] (-1224.156) -- 0:01:26
545000 -- (-1222.960) (-1228.637) [-1229.462] (-1227.175) * (-1235.529) [-1229.336] (-1224.465) (-1223.352) -- 0:01:25
Average standard deviation of split frequencies: 0.011008
545500 -- (-1230.283) (-1229.754) [-1227.344] (-1231.179) * (-1224.156) (-1229.859) [-1230.224] (-1225.860) -- 0:01:25
546000 -- (-1232.002) [-1223.812] (-1228.274) (-1231.950) * (-1228.134) [-1230.348] (-1226.023) (-1223.933) -- 0:01:25
546500 -- (-1228.640) [-1224.697] (-1226.072) (-1232.628) * (-1226.205) (-1233.101) [-1229.382] (-1234.090) -- 0:01:25
547000 -- (-1224.308) (-1226.395) (-1227.674) [-1227.389] * [-1225.114] (-1223.076) (-1225.938) (-1228.946) -- 0:01:25
547500 -- [-1226.458] (-1223.356) (-1225.116) (-1230.353) * [-1227.848] (-1226.848) (-1229.259) (-1227.088) -- 0:01:25
548000 -- (-1229.071) (-1225.808) [-1220.318] (-1225.728) * [-1230.273] (-1224.384) (-1233.228) (-1228.507) -- 0:01:24
548500 -- (-1224.109) [-1221.419] (-1225.098) (-1226.657) * (-1225.764) [-1228.751] (-1227.656) (-1227.432) -- 0:01:24
549000 -- (-1228.970) [-1230.105] (-1228.001) (-1223.140) * (-1227.352) (-1225.605) [-1221.616] (-1226.773) -- 0:01:24
549500 -- (-1225.891) (-1222.216) (-1228.496) [-1227.228] * (-1231.350) [-1223.408] (-1225.968) (-1225.748) -- 0:01:25
550000 -- (-1226.461) (-1226.856) (-1232.475) [-1223.508] * (-1231.320) [-1226.376] (-1223.595) (-1231.286) -- 0:01:25
Average standard deviation of split frequencies: 0.010487
550500 -- (-1228.387) (-1226.016) (-1227.882) [-1228.686] * (-1230.195) [-1230.587] (-1226.659) (-1233.634) -- 0:01:24
551000 -- [-1228.541] (-1230.956) (-1228.842) (-1225.240) * (-1244.112) (-1229.128) [-1224.511] (-1226.630) -- 0:01:24
551500 -- (-1227.139) (-1230.684) (-1231.186) [-1223.892] * (-1230.308) (-1226.980) (-1224.920) [-1223.101] -- 0:01:24
552000 -- (-1227.521) (-1225.662) (-1222.055) [-1227.588] * (-1224.174) (-1224.768) [-1226.060] (-1226.935) -- 0:01:24
552500 -- (-1224.432) (-1241.096) [-1224.196] (-1222.933) * [-1226.232] (-1225.090) (-1235.726) (-1233.685) -- 0:01:24
553000 -- (-1223.035) (-1236.598) [-1223.006] (-1230.786) * (-1230.274) (-1232.011) (-1228.545) [-1225.286] -- 0:01:24
553500 -- [-1227.161] (-1226.432) (-1229.036) (-1229.206) * [-1223.212] (-1229.359) (-1226.986) (-1229.225) -- 0:01:23
554000 -- (-1227.029) [-1223.614] (-1225.987) (-1223.146) * (-1228.305) [-1228.175] (-1226.573) (-1234.080) -- 0:01:23
554500 -- (-1226.295) (-1235.462) (-1229.967) [-1224.774] * [-1228.655] (-1226.666) (-1222.359) (-1237.119) -- 0:01:23
555000 -- (-1221.888) (-1230.654) (-1229.177) [-1228.783] * (-1230.739) [-1221.674] (-1222.233) (-1234.974) -- 0:01:24
Average standard deviation of split frequencies: 0.010386
555500 -- (-1228.745) [-1224.978] (-1235.069) (-1229.928) * (-1228.056) (-1228.743) [-1225.076] (-1224.882) -- 0:01:24
556000 -- (-1223.707) (-1227.252) [-1227.336] (-1234.781) * [-1228.991] (-1227.618) (-1225.145) (-1224.810) -- 0:01:23
556500 -- (-1228.898) (-1229.561) (-1230.262) [-1222.321] * (-1244.421) (-1225.034) [-1220.981] (-1222.922) -- 0:01:23
557000 -- (-1234.671) (-1228.485) (-1221.495) [-1224.936] * (-1232.247) (-1230.582) (-1222.702) [-1228.077] -- 0:01:23
557500 -- (-1235.032) [-1222.659] (-1226.252) (-1228.276) * (-1225.931) [-1236.693] (-1221.688) (-1227.627) -- 0:01:23
558000 -- (-1231.213) [-1228.208] (-1224.827) (-1225.330) * (-1222.497) [-1224.312] (-1226.331) (-1226.735) -- 0:01:23
558500 -- (-1229.028) (-1225.663) (-1228.827) [-1227.574] * [-1225.178] (-1223.447) (-1222.896) (-1228.242) -- 0:01:23
559000 -- (-1229.718) [-1230.408] (-1229.860) (-1223.105) * (-1226.819) (-1224.211) (-1229.737) [-1228.828] -- 0:01:22
559500 -- (-1226.039) (-1232.164) [-1224.906] (-1236.113) * (-1224.251) (-1233.525) [-1224.452] (-1223.173) -- 0:01:22
560000 -- (-1223.608) (-1232.507) [-1224.026] (-1226.954) * (-1231.835) (-1221.983) (-1222.505) [-1226.090] -- 0:01:22
Average standard deviation of split frequencies: 0.009879
560500 -- (-1226.794) (-1228.943) [-1228.838] (-1231.622) * (-1224.571) (-1231.204) (-1224.850) [-1226.446] -- 0:01:23
561000 -- (-1227.117) (-1239.362) (-1224.648) [-1227.431] * (-1229.401) [-1228.452] (-1229.378) (-1228.274) -- 0:01:22
561500 -- [-1221.988] (-1231.836) (-1224.684) (-1228.654) * (-1227.450) [-1222.796] (-1238.516) (-1223.413) -- 0:01:22
562000 -- (-1220.173) [-1229.701] (-1228.402) (-1231.295) * (-1236.884) [-1227.439] (-1221.273) (-1223.954) -- 0:01:22
562500 -- (-1226.670) (-1230.607) (-1227.909) [-1228.696] * (-1224.677) [-1226.949] (-1232.378) (-1223.553) -- 0:01:22
563000 -- [-1223.605] (-1226.662) (-1224.867) (-1231.838) * [-1222.723] (-1227.527) (-1225.615) (-1224.164) -- 0:01:22
563500 -- [-1227.285] (-1230.477) (-1233.897) (-1223.619) * (-1229.089) [-1222.838] (-1229.097) (-1226.224) -- 0:01:22
564000 -- [-1224.615] (-1228.021) (-1225.672) (-1227.042) * (-1226.079) (-1226.875) [-1227.724] (-1230.879) -- 0:01:21
564500 -- [-1223.574] (-1229.197) (-1225.538) (-1230.681) * (-1223.302) [-1221.323] (-1227.563) (-1227.787) -- 0:01:21
565000 -- [-1224.744] (-1226.167) (-1223.468) (-1222.022) * (-1223.914) (-1228.142) [-1222.384] (-1223.630) -- 0:01:21
Average standard deviation of split frequencies: 0.011452
565500 -- [-1226.930] (-1229.344) (-1225.917) (-1221.332) * (-1228.030) (-1227.330) [-1227.304] (-1237.150) -- 0:01:22
566000 -- (-1223.490) [-1226.823] (-1224.728) (-1222.237) * (-1226.065) [-1223.832] (-1227.523) (-1229.865) -- 0:01:22
566500 -- (-1226.619) (-1229.428) [-1220.960] (-1227.463) * [-1227.472] (-1230.041) (-1225.542) (-1226.088) -- 0:01:21
567000 -- (-1233.937) [-1229.049] (-1224.079) (-1228.395) * (-1225.579) (-1223.152) (-1230.598) [-1232.300] -- 0:01:21
567500 -- [-1229.135] (-1228.027) (-1230.919) (-1231.265) * (-1232.021) (-1224.808) [-1221.299] (-1234.891) -- 0:01:21
568000 -- (-1224.772) (-1224.819) [-1230.039] (-1226.081) * [-1225.047] (-1225.669) (-1223.447) (-1234.289) -- 0:01:21
568500 -- (-1235.337) [-1225.894] (-1227.503) (-1234.250) * (-1236.133) (-1225.331) [-1225.335] (-1226.878) -- 0:01:21
569000 -- (-1225.883) (-1227.819) [-1222.286] (-1234.297) * (-1246.016) (-1230.149) [-1225.458] (-1222.862) -- 0:01:21
569500 -- (-1234.916) [-1228.943] (-1231.006) (-1235.767) * (-1243.704) [-1221.101] (-1224.248) (-1223.066) -- 0:01:20
570000 -- (-1229.807) [-1225.110] (-1225.699) (-1241.854) * (-1229.065) (-1224.482) (-1230.722) [-1225.865] -- 0:01:20
Average standard deviation of split frequencies: 0.011771
570500 -- (-1225.349) [-1222.624] (-1225.633) (-1227.505) * (-1228.025) (-1224.643) [-1222.268] (-1223.524) -- 0:01:20
571000 -- (-1225.486) [-1225.196] (-1232.780) (-1230.970) * (-1225.341) (-1228.660) (-1235.219) [-1231.701] -- 0:01:21
571500 -- (-1227.286) [-1226.962] (-1223.182) (-1229.301) * [-1223.551] (-1239.420) (-1229.055) (-1231.724) -- 0:01:20
572000 -- [-1233.114] (-1230.660) (-1229.247) (-1233.090) * (-1224.376) (-1228.249) (-1225.710) [-1223.295] -- 0:01:20
572500 -- (-1226.798) [-1227.781] (-1227.155) (-1230.701) * [-1224.291] (-1227.469) (-1226.376) (-1227.516) -- 0:01:20
573000 -- (-1227.341) (-1220.826) (-1227.255) [-1226.258] * (-1232.485) (-1221.131) [-1231.066] (-1223.453) -- 0:01:20
573500 -- [-1231.903] (-1229.324) (-1227.897) (-1226.977) * (-1227.783) [-1227.743] (-1231.739) (-1224.898) -- 0:01:20
574000 -- (-1225.913) (-1224.266) [-1226.280] (-1231.102) * (-1228.539) (-1222.926) (-1227.299) [-1224.854] -- 0:01:20
574500 -- (-1227.420) (-1227.859) [-1225.984] (-1226.584) * [-1225.186] (-1223.619) (-1227.834) (-1225.618) -- 0:01:19
575000 -- (-1227.479) (-1225.537) [-1230.207] (-1224.581) * (-1227.185) [-1223.626] (-1228.148) (-1227.579) -- 0:01:19
Average standard deviation of split frequencies: 0.011049
575500 -- [-1228.616] (-1223.171) (-1238.371) (-1222.165) * (-1226.214) (-1223.296) (-1223.200) [-1223.329] -- 0:01:19
576000 -- (-1224.058) (-1222.887) (-1228.115) [-1224.574] * (-1232.294) (-1232.032) (-1222.174) [-1222.640] -- 0:01:19
576500 -- (-1231.287) [-1226.110] (-1234.597) (-1223.957) * (-1231.282) [-1229.048] (-1223.804) (-1229.776) -- 0:01:20
577000 -- (-1229.053) [-1225.897] (-1227.487) (-1228.898) * (-1225.813) [-1229.552] (-1225.835) (-1233.808) -- 0:01:19
577500 -- (-1232.258) (-1223.433) [-1224.017] (-1228.515) * [-1223.813] (-1230.934) (-1228.765) (-1225.638) -- 0:01:19
578000 -- (-1230.231) (-1222.909) [-1223.337] (-1224.408) * (-1233.203) (-1231.488) [-1232.064] (-1229.953) -- 0:01:19
578500 -- (-1227.205) (-1230.677) [-1231.184] (-1225.321) * (-1225.712) (-1230.878) [-1227.122] (-1222.886) -- 0:01:19
579000 -- (-1224.933) [-1222.363] (-1225.286) (-1222.638) * [-1229.458] (-1225.051) (-1230.655) (-1225.776) -- 0:01:19
579500 -- (-1231.067) [-1223.914] (-1224.355) (-1227.364) * [-1227.460] (-1230.321) (-1224.031) (-1227.938) -- 0:01:19
580000 -- (-1229.475) (-1228.384) [-1226.474] (-1230.387) * (-1227.365) (-1228.000) (-1223.157) [-1227.238] -- 0:01:18
Average standard deviation of split frequencies: 0.011366
580500 -- [-1226.991] (-1222.377) (-1225.249) (-1228.733) * (-1226.139) (-1233.869) (-1224.809) [-1228.935] -- 0:01:18
581000 -- (-1225.972) (-1224.183) [-1226.492] (-1226.907) * (-1233.713) (-1233.951) (-1233.491) [-1224.212] -- 0:01:18
581500 -- (-1224.622) [-1224.810] (-1224.426) (-1228.406) * (-1227.477) (-1235.693) [-1221.408] (-1225.562) -- 0:01:19
582000 -- (-1225.598) (-1234.544) [-1226.461] (-1223.951) * [-1229.643] (-1232.964) (-1236.754) (-1229.337) -- 0:01:19
582500 -- (-1226.567) [-1227.319] (-1225.642) (-1226.417) * [-1227.719] (-1229.677) (-1223.553) (-1227.876) -- 0:01:18
583000 -- (-1229.705) [-1226.121] (-1229.790) (-1224.740) * (-1225.379) [-1226.138] (-1223.041) (-1228.067) -- 0:01:18
583500 -- (-1226.296) (-1223.420) [-1223.284] (-1231.357) * (-1226.758) (-1229.310) [-1221.835] (-1226.950) -- 0:01:18
584000 -- (-1226.561) (-1223.956) (-1227.704) [-1226.431] * (-1231.476) (-1223.242) [-1224.022] (-1230.465) -- 0:01:18
584500 -- (-1227.225) [-1229.662] (-1224.744) (-1223.293) * (-1232.162) [-1230.745] (-1229.387) (-1226.280) -- 0:01:18
585000 -- [-1228.201] (-1226.963) (-1230.333) (-1233.931) * (-1228.741) (-1227.911) (-1224.253) [-1224.851] -- 0:01:18
Average standard deviation of split frequencies: 0.012067
585500 -- (-1232.251) [-1224.712] (-1224.362) (-1227.073) * [-1229.272] (-1226.596) (-1233.319) (-1225.261) -- 0:01:17
586000 -- (-1228.195) (-1222.636) (-1227.431) [-1230.048] * [-1222.941] (-1232.132) (-1223.453) (-1221.088) -- 0:01:17
586500 -- (-1224.026) (-1225.197) [-1224.759] (-1227.052) * (-1228.558) (-1223.641) (-1224.659) [-1226.589] -- 0:01:17
587000 -- (-1229.920) (-1229.025) [-1224.743] (-1227.541) * [-1221.688] (-1223.899) (-1226.180) (-1232.510) -- 0:01:18
587500 -- [-1227.277] (-1224.783) (-1229.797) (-1226.722) * (-1224.114) (-1225.420) [-1229.259] (-1230.682) -- 0:01:17
588000 -- [-1227.364] (-1224.374) (-1224.153) (-1232.644) * (-1228.810) (-1232.606) (-1223.533) [-1227.735] -- 0:01:17
588500 -- [-1222.954] (-1225.841) (-1232.355) (-1229.848) * (-1224.794) [-1225.350] (-1225.088) (-1224.230) -- 0:01:17
589000 -- (-1225.286) [-1224.963] (-1233.298) (-1230.059) * (-1228.648) [-1224.909] (-1226.363) (-1226.872) -- 0:01:17
589500 -- (-1224.109) (-1225.092) (-1229.065) [-1231.787] * (-1226.712) (-1225.910) (-1229.086) [-1232.874] -- 0:01:17
590000 -- [-1227.139] (-1230.708) (-1227.899) (-1220.737) * (-1229.974) (-1230.682) (-1226.328) [-1241.292] -- 0:01:17
Average standard deviation of split frequencies: 0.011173
590500 -- (-1227.609) (-1229.841) [-1219.568] (-1224.486) * (-1231.536) (-1229.759) (-1229.557) [-1230.490] -- 0:01:16
591000 -- [-1225.401] (-1226.563) (-1226.278) (-1222.699) * (-1224.392) (-1231.931) [-1229.543] (-1227.886) -- 0:01:16
591500 -- (-1228.299) (-1226.438) [-1227.159] (-1223.526) * (-1224.260) (-1234.591) [-1227.050] (-1221.867) -- 0:01:16
592000 -- (-1226.128) [-1226.851] (-1222.781) (-1227.896) * [-1227.433] (-1226.679) (-1223.539) (-1223.082) -- 0:01:16
592500 -- (-1230.315) (-1228.535) (-1227.561) [-1229.115] * (-1233.822) (-1222.528) (-1227.481) [-1224.730] -- 0:01:17
593000 -- (-1224.469) [-1226.259] (-1224.235) (-1224.973) * (-1226.896) (-1231.410) [-1223.346] (-1228.490) -- 0:01:16
593500 -- [-1228.720] (-1228.899) (-1227.648) (-1223.725) * (-1227.110) [-1221.368] (-1223.957) (-1223.400) -- 0:01:16
594000 -- [-1227.167] (-1228.901) (-1231.673) (-1224.229) * (-1230.707) (-1225.948) [-1230.055] (-1220.552) -- 0:01:16
594500 -- (-1226.758) (-1220.928) (-1226.002) [-1222.805] * (-1229.805) (-1223.054) (-1231.263) [-1223.234] -- 0:01:16
595000 -- (-1224.909) [-1225.696] (-1228.970) (-1223.775) * [-1224.463] (-1224.747) (-1228.011) (-1231.049) -- 0:01:16
Average standard deviation of split frequencies: 0.012260
595500 -- (-1227.789) (-1223.332) [-1231.541] (-1227.357) * (-1223.230) [-1220.997] (-1226.563) (-1227.994) -- 0:01:16
596000 -- [-1224.432] (-1224.929) (-1229.845) (-1228.002) * (-1230.419) (-1223.096) [-1230.001] (-1223.004) -- 0:01:15
596500 -- [-1228.785] (-1225.534) (-1228.360) (-1226.611) * (-1223.677) [-1222.563] (-1221.751) (-1224.770) -- 0:01:15
597000 -- [-1222.715] (-1230.642) (-1222.016) (-1227.112) * (-1226.718) [-1226.975] (-1223.027) (-1224.899) -- 0:01:15
597500 -- (-1222.370) (-1225.450) (-1227.214) [-1229.923] * (-1228.611) (-1222.716) [-1225.307] (-1225.670) -- 0:01:16
598000 -- (-1225.386) (-1225.643) (-1223.766) [-1224.390] * (-1224.573) [-1229.175] (-1225.792) (-1225.650) -- 0:01:15
598500 -- (-1228.059) (-1226.583) [-1226.686] (-1224.693) * (-1227.993) (-1228.337) [-1229.623] (-1223.028) -- 0:01:15
599000 -- (-1230.744) (-1235.431) (-1227.869) [-1225.685] * (-1236.914) (-1227.097) (-1227.361) [-1232.226] -- 0:01:15
599500 -- (-1228.047) (-1229.995) (-1228.230) [-1226.303] * (-1225.716) (-1224.937) (-1222.737) [-1222.949] -- 0:01:15
600000 -- (-1228.711) [-1226.266] (-1226.394) (-1230.299) * (-1231.547) [-1222.042] (-1229.981) (-1230.285) -- 0:01:15
Average standard deviation of split frequencies: 0.012949
600500 -- (-1232.792) [-1227.371] (-1223.962) (-1230.090) * (-1225.242) (-1221.513) [-1225.827] (-1228.641) -- 0:01:15
601000 -- (-1228.040) (-1226.807) (-1225.202) [-1223.986] * (-1230.140) [-1229.283] (-1222.755) (-1224.086) -- 0:01:15
601500 -- (-1238.912) (-1222.217) (-1233.906) [-1222.867] * (-1227.407) (-1229.051) (-1224.442) [-1224.643] -- 0:01:14
602000 -- (-1231.999) (-1230.666) (-1235.556) [-1229.553] * (-1237.061) (-1223.781) (-1224.770) [-1225.807] -- 0:01:14
602500 -- (-1229.225) (-1230.775) (-1231.267) [-1228.137] * [-1228.511] (-1230.160) (-1225.430) (-1235.386) -- 0:01:14
603000 -- (-1222.633) (-1235.563) (-1232.397) [-1220.627] * [-1234.255] (-1224.966) (-1227.661) (-1226.461) -- 0:01:15
603500 -- (-1224.205) (-1229.022) [-1225.676] (-1224.616) * (-1225.603) [-1234.486] (-1225.741) (-1228.146) -- 0:01:14
604000 -- (-1226.157) (-1233.168) [-1230.684] (-1225.715) * (-1224.023) (-1228.141) [-1226.719] (-1225.390) -- 0:01:14
604500 -- (-1227.580) (-1226.923) (-1229.402) [-1229.518] * (-1227.303) (-1230.379) [-1223.192] (-1223.557) -- 0:01:14
605000 -- [-1223.314] (-1228.595) (-1226.937) (-1229.832) * (-1224.367) [-1229.554] (-1226.941) (-1226.860) -- 0:01:14
Average standard deviation of split frequencies: 0.011279
605500 -- (-1227.253) (-1234.233) [-1224.723] (-1228.303) * (-1231.892) (-1229.136) (-1229.239) [-1227.936] -- 0:01:14
606000 -- [-1222.574] (-1223.999) (-1223.665) (-1226.667) * (-1227.922) [-1225.425] (-1221.831) (-1227.693) -- 0:01:14
606500 -- (-1225.273) (-1224.535) [-1222.285] (-1225.904) * [-1228.573] (-1229.913) (-1224.903) (-1222.783) -- 0:01:13
607000 -- [-1223.952] (-1231.046) (-1232.378) (-1224.196) * (-1225.270) (-1224.104) [-1229.437] (-1226.309) -- 0:01:13
607500 -- [-1226.463] (-1234.093) (-1226.622) (-1222.308) * [-1225.275] (-1232.975) (-1225.238) (-1224.524) -- 0:01:13
608000 -- [-1230.808] (-1224.419) (-1234.810) (-1223.844) * (-1228.782) (-1229.859) (-1231.780) [-1226.348] -- 0:01:13
608500 -- [-1228.261] (-1223.304) (-1225.626) (-1230.628) * (-1226.140) (-1227.532) (-1224.832) [-1224.989] -- 0:01:13
609000 -- (-1222.340) [-1227.126] (-1229.658) (-1227.507) * (-1234.605) (-1238.871) (-1223.377) [-1232.588] -- 0:01:13
609500 -- (-1224.763) (-1228.738) (-1224.411) [-1224.512] * (-1228.767) (-1238.243) [-1223.781] (-1226.645) -- 0:01:13
610000 -- (-1225.070) (-1226.996) (-1221.458) [-1228.115] * (-1233.968) [-1223.603] (-1226.894) (-1226.896) -- 0:01:13
Average standard deviation of split frequencies: 0.011000
610500 -- [-1222.432] (-1230.842) (-1225.491) (-1226.029) * (-1224.328) (-1228.270) [-1224.359] (-1231.045) -- 0:01:13
611000 -- [-1221.409] (-1230.247) (-1224.556) (-1228.019) * (-1228.464) (-1229.685) (-1227.582) [-1221.585] -- 0:01:13
611500 -- [-1222.852] (-1228.730) (-1227.939) (-1228.741) * (-1226.181) (-1226.988) (-1228.437) [-1227.472] -- 0:01:13
612000 -- (-1227.918) [-1233.253] (-1226.163) (-1229.599) * (-1225.513) (-1225.998) (-1231.930) [-1235.502] -- 0:01:12
612500 -- (-1227.347) [-1229.372] (-1225.069) (-1231.224) * (-1225.368) (-1225.437) [-1224.999] (-1226.314) -- 0:01:12
613000 -- (-1225.408) [-1224.910] (-1230.237) (-1230.788) * (-1236.018) (-1227.012) [-1222.578] (-1224.427) -- 0:01:12
613500 -- (-1224.812) (-1223.087) (-1225.525) [-1235.544] * (-1230.272) (-1230.368) [-1229.502] (-1226.615) -- 0:01:12
614000 -- (-1232.041) (-1220.767) (-1227.077) [-1226.901] * (-1226.695) (-1223.664) [-1222.093] (-1224.275) -- 0:01:12
614500 -- (-1225.154) (-1226.207) [-1218.244] (-1223.018) * (-1229.295) [-1226.263] (-1223.314) (-1225.773) -- 0:01:12
615000 -- (-1227.960) [-1224.122] (-1219.001) (-1222.822) * (-1223.178) (-1233.154) [-1222.080] (-1222.356) -- 0:01:12
Average standard deviation of split frequencies: 0.011670
615500 -- (-1221.810) [-1225.053] (-1232.724) (-1233.880) * (-1231.247) [-1226.013] (-1230.153) (-1224.791) -- 0:01:12
616000 -- (-1222.429) (-1230.691) (-1234.852) [-1225.999] * (-1221.620) (-1228.008) (-1228.177) [-1231.880] -- 0:01:12
616500 -- (-1225.843) (-1226.243) [-1227.050] (-1226.354) * [-1225.605] (-1226.224) (-1222.290) (-1226.722) -- 0:01:12
617000 -- [-1227.799] (-1227.614) (-1226.602) (-1230.883) * (-1229.958) [-1225.997] (-1221.932) (-1232.638) -- 0:01:12
617500 -- [-1224.614] (-1225.376) (-1226.948) (-1226.254) * (-1226.081) (-1228.345) [-1221.570] (-1226.415) -- 0:01:11
618000 -- (-1228.568) (-1225.775) [-1229.204] (-1232.573) * (-1227.312) (-1235.292) (-1222.902) [-1228.745] -- 0:01:11
618500 -- (-1230.266) [-1223.595] (-1223.645) (-1231.389) * [-1225.262] (-1225.979) (-1224.000) (-1228.546) -- 0:01:11
619000 -- (-1228.437) [-1222.562] (-1226.966) (-1224.661) * (-1230.417) (-1223.173) (-1224.075) [-1221.533] -- 0:01:12
619500 -- [-1223.286] (-1227.735) (-1222.639) (-1230.860) * (-1235.301) (-1226.029) (-1225.272) [-1225.227] -- 0:01:11
620000 -- (-1234.626) [-1225.005] (-1220.865) (-1238.527) * (-1230.227) (-1226.948) [-1227.911] (-1225.609) -- 0:01:11
Average standard deviation of split frequencies: 0.012722
620500 -- (-1231.624) (-1226.399) [-1227.289] (-1231.787) * (-1224.948) (-1223.158) (-1226.829) [-1226.036] -- 0:01:11
621000 -- (-1231.234) (-1228.632) (-1221.824) [-1223.009] * [-1235.589] (-1222.099) (-1226.561) (-1223.694) -- 0:01:11
621500 -- (-1229.891) (-1225.254) (-1223.883) [-1225.361] * (-1229.201) [-1221.744] (-1224.568) (-1226.326) -- 0:01:11
622000 -- [-1226.492] (-1225.606) (-1228.858) (-1225.561) * (-1223.252) (-1234.280) [-1223.152] (-1228.814) -- 0:01:11
622500 -- (-1232.163) [-1229.011] (-1232.602) (-1228.225) * (-1228.399) [-1224.363] (-1230.784) (-1234.824) -- 0:01:10
623000 -- (-1226.719) (-1231.919) [-1228.115] (-1228.431) * [-1226.026] (-1228.212) (-1227.838) (-1230.213) -- 0:01:10
623500 -- (-1227.995) [-1226.262] (-1223.685) (-1223.987) * (-1227.995) (-1226.970) [-1226.891] (-1227.934) -- 0:01:10
624000 -- (-1231.619) (-1225.657) [-1222.684] (-1230.336) * (-1238.425) (-1228.006) [-1224.605] (-1224.827) -- 0:01:10
624500 -- (-1229.874) (-1234.957) [-1223.827] (-1228.217) * (-1232.774) (-1225.709) [-1223.629] (-1225.078) -- 0:01:10
625000 -- (-1227.527) [-1227.433] (-1221.230) (-1232.129) * (-1233.475) [-1230.673] (-1226.356) (-1224.576) -- 0:01:10
Average standard deviation of split frequencies: 0.014120
625500 -- (-1230.258) [-1225.201] (-1221.533) (-1231.981) * (-1229.350) (-1229.957) [-1224.393] (-1223.975) -- 0:01:10
626000 -- (-1227.893) (-1225.234) [-1230.019] (-1222.290) * (-1232.501) (-1232.948) [-1230.594] (-1225.174) -- 0:01:10
626500 -- [-1227.718] (-1227.622) (-1238.327) (-1235.835) * (-1234.584) [-1234.013] (-1229.634) (-1220.346) -- 0:01:10
627000 -- (-1225.787) (-1228.657) (-1225.150) [-1225.004] * [-1223.946] (-1231.146) (-1227.863) (-1224.930) -- 0:01:10
627500 -- (-1234.068) (-1226.402) (-1228.607) [-1229.376] * (-1225.571) [-1225.209] (-1227.922) (-1231.921) -- 0:01:10
628000 -- (-1228.263) [-1224.324] (-1227.972) (-1226.074) * (-1229.256) [-1222.031] (-1225.222) (-1227.233) -- 0:01:09
628500 -- (-1226.967) (-1224.315) [-1230.352] (-1222.907) * (-1226.610) (-1224.874) (-1227.826) [-1228.902] -- 0:01:09
629000 -- (-1222.812) (-1228.167) (-1230.529) [-1225.906] * (-1230.526) (-1224.579) (-1228.446) [-1232.613] -- 0:01:09
629500 -- (-1226.767) [-1231.788] (-1225.709) (-1223.483) * (-1230.418) [-1228.893] (-1222.974) (-1228.310) -- 0:01:09
630000 -- (-1223.453) (-1237.933) [-1224.857] (-1223.945) * (-1232.606) (-1229.115) [-1223.247] (-1222.610) -- 0:01:09
Average standard deviation of split frequencies: 0.013641
630500 -- (-1226.939) [-1221.692] (-1222.206) (-1221.225) * (-1228.282) [-1229.126] (-1232.074) (-1227.903) -- 0:01:09
631000 -- (-1224.821) (-1225.624) [-1225.532] (-1235.190) * (-1233.694) (-1224.958) (-1228.677) [-1223.659] -- 0:01:09
631500 -- (-1224.970) [-1225.591] (-1219.843) (-1232.863) * [-1223.113] (-1233.239) (-1231.526) (-1224.752) -- 0:01:09
632000 -- (-1227.391) (-1222.431) (-1225.631) [-1224.489] * (-1229.725) (-1222.921) (-1229.758) [-1228.239] -- 0:01:09
632500 -- (-1235.018) (-1228.934) (-1223.433) [-1226.801] * (-1226.541) [-1224.742] (-1230.799) (-1225.937) -- 0:01:09
633000 -- (-1229.050) [-1223.896] (-1225.227) (-1233.857) * (-1225.236) [-1224.875] (-1224.163) (-1228.043) -- 0:01:08
633500 -- (-1222.051) (-1234.496) [-1227.630] (-1232.770) * (-1224.225) [-1225.617] (-1227.284) (-1230.152) -- 0:01:08
634000 -- (-1225.589) (-1229.245) [-1226.171] (-1225.313) * (-1228.611) [-1224.375] (-1228.174) (-1224.236) -- 0:01:08
634500 -- (-1226.685) (-1229.593) (-1229.153) [-1226.910] * (-1222.524) [-1230.887] (-1224.946) (-1225.611) -- 0:01:08
635000 -- (-1222.777) (-1229.370) [-1224.762] (-1227.184) * (-1223.878) (-1232.809) [-1227.172] (-1228.519) -- 0:01:08
Average standard deviation of split frequencies: 0.014639
635500 -- (-1223.190) (-1228.532) (-1222.880) [-1229.863] * (-1227.128) [-1230.352] (-1223.026) (-1223.132) -- 0:01:08
636000 -- [-1226.643] (-1226.116) (-1226.569) (-1229.471) * [-1223.786] (-1231.460) (-1223.077) (-1227.043) -- 0:01:08
636500 -- (-1227.734) [-1223.996] (-1224.651) (-1233.089) * [-1225.605] (-1231.603) (-1225.639) (-1221.791) -- 0:01:08
637000 -- (-1227.904) (-1223.288) [-1223.128] (-1229.035) * (-1228.610) (-1228.733) [-1226.070] (-1223.752) -- 0:01:08
637500 -- (-1226.858) (-1227.094) (-1225.296) [-1225.593] * [-1228.453] (-1237.452) (-1227.483) (-1223.965) -- 0:01:08
638000 -- (-1227.810) (-1221.045) (-1223.297) [-1228.851] * [-1227.839] (-1224.526) (-1226.675) (-1224.191) -- 0:01:08
638500 -- (-1232.977) (-1221.729) [-1222.464] (-1224.311) * (-1226.269) (-1223.032) [-1225.052] (-1225.177) -- 0:01:07
639000 -- (-1231.357) [-1228.962] (-1228.335) (-1236.123) * (-1220.770) [-1222.394] (-1231.799) (-1227.179) -- 0:01:07
639500 -- (-1228.595) (-1223.793) [-1223.303] (-1227.853) * (-1224.408) [-1235.195] (-1230.871) (-1225.570) -- 0:01:07
640000 -- [-1223.642] (-1225.090) (-1228.838) (-1225.361) * (-1226.104) (-1225.687) (-1234.149) [-1224.503] -- 0:01:07
Average standard deviation of split frequencies: 0.014532
640500 -- (-1223.804) [-1225.623] (-1233.506) (-1227.498) * (-1226.083) (-1228.388) (-1240.308) [-1230.918] -- 0:01:07
641000 -- [-1222.337] (-1227.279) (-1236.163) (-1229.764) * (-1227.974) [-1223.638] (-1236.619) (-1231.729) -- 0:01:07
641500 -- (-1224.209) (-1225.935) [-1234.908] (-1230.270) * (-1226.101) [-1224.394] (-1233.051) (-1231.291) -- 0:01:07
642000 -- [-1223.122] (-1227.705) (-1229.413) (-1228.881) * (-1221.220) (-1224.477) [-1231.335] (-1229.417) -- 0:01:07
642500 -- (-1223.269) (-1230.273) [-1223.387] (-1221.481) * [-1222.924] (-1224.404) (-1226.635) (-1230.158) -- 0:01:07
643000 -- (-1225.269) (-1231.446) [-1227.140] (-1227.742) * [-1223.232] (-1221.913) (-1223.720) (-1231.169) -- 0:01:07
643500 -- (-1224.358) (-1229.067) [-1223.598] (-1225.023) * (-1222.080) [-1227.279] (-1224.836) (-1230.949) -- 0:01:07
644000 -- (-1234.305) (-1226.726) (-1223.858) [-1225.984] * [-1224.626] (-1226.577) (-1227.502) (-1222.202) -- 0:01:06
644500 -- [-1227.452] (-1226.483) (-1234.952) (-1221.496) * (-1229.392) (-1228.026) (-1232.588) [-1224.739] -- 0:01:06
645000 -- (-1226.604) [-1223.206] (-1222.204) (-1225.012) * (-1224.133) [-1228.444] (-1233.806) (-1227.637) -- 0:01:06
Average standard deviation of split frequencies: 0.013318
645500 -- (-1228.074) [-1224.911] (-1223.186) (-1231.059) * (-1229.983) (-1229.215) [-1230.217] (-1227.782) -- 0:01:06
646000 -- (-1228.342) (-1224.275) [-1228.532] (-1226.956) * (-1229.157) [-1225.289] (-1234.391) (-1226.159) -- 0:01:06
646500 -- (-1232.346) [-1222.893] (-1224.404) (-1227.648) * (-1221.568) [-1222.090] (-1230.555) (-1230.270) -- 0:01:06
647000 -- [-1229.550] (-1228.001) (-1227.751) (-1246.224) * (-1229.992) (-1224.299) [-1223.692] (-1232.822) -- 0:01:06
647500 -- (-1226.352) (-1230.717) [-1231.172] (-1223.835) * (-1234.242) [-1229.408] (-1227.688) (-1230.403) -- 0:01:06
648000 -- (-1228.664) (-1228.157) (-1227.068) [-1222.911] * (-1225.899) [-1223.918] (-1237.802) (-1222.118) -- 0:01:06
648500 -- [-1229.972] (-1226.275) (-1222.600) (-1225.162) * (-1226.216) (-1225.293) (-1227.676) [-1222.952] -- 0:01:06
649000 -- (-1227.067) (-1225.216) (-1227.821) [-1224.900] * (-1228.464) (-1230.415) [-1228.244] (-1221.437) -- 0:01:05
649500 -- (-1237.738) [-1222.870] (-1227.707) (-1233.118) * (-1222.789) (-1223.475) (-1225.741) [-1227.610] -- 0:01:05
650000 -- (-1228.502) [-1223.311] (-1228.886) (-1229.299) * [-1228.478] (-1224.135) (-1227.489) (-1225.272) -- 0:01:05
Average standard deviation of split frequencies: 0.013403
650500 -- (-1222.276) (-1225.665) (-1227.776) [-1224.401] * [-1228.335] (-1224.524) (-1228.221) (-1234.455) -- 0:01:05
651000 -- (-1224.100) [-1225.632] (-1225.303) (-1236.984) * (-1228.404) (-1228.435) [-1226.337] (-1229.883) -- 0:01:05
651500 -- (-1224.369) (-1230.601) [-1230.602] (-1231.779) * (-1230.273) [-1225.334] (-1230.996) (-1232.950) -- 0:01:05
652000 -- [-1223.226] (-1228.629) (-1225.278) (-1227.623) * [-1227.118] (-1223.562) (-1224.624) (-1226.073) -- 0:01:05
652500 -- (-1226.054) (-1227.152) [-1226.538] (-1227.893) * (-1226.243) [-1223.131] (-1222.789) (-1223.483) -- 0:01:05
653000 -- (-1230.262) [-1222.830] (-1226.659) (-1222.657) * (-1225.357) (-1223.615) [-1222.113] (-1223.647) -- 0:01:05
653500 -- (-1224.405) (-1228.268) (-1227.303) [-1224.640] * (-1223.448) (-1225.414) [-1223.515] (-1221.393) -- 0:01:05
654000 -- (-1235.315) [-1231.198] (-1229.199) (-1233.030) * (-1224.385) (-1225.115) (-1230.331) [-1225.561] -- 0:01:05
654500 -- [-1226.136] (-1223.313) (-1224.219) (-1225.116) * (-1228.038) [-1222.736] (-1228.353) (-1224.519) -- 0:01:04
655000 -- (-1227.514) (-1230.401) [-1229.007] (-1223.726) * (-1232.923) (-1221.919) [-1229.005] (-1224.241) -- 0:01:04
Average standard deviation of split frequencies: 0.013474
655500 -- (-1230.329) (-1232.482) (-1224.825) [-1223.595] * (-1227.794) (-1229.793) [-1223.486] (-1222.586) -- 0:01:04
656000 -- (-1231.924) (-1230.114) [-1221.582] (-1222.485) * (-1236.748) [-1227.559] (-1229.952) (-1223.423) -- 0:01:04
656500 -- [-1226.561] (-1222.868) (-1227.311) (-1223.942) * (-1231.504) (-1223.921) [-1231.497] (-1222.972) -- 0:01:04
657000 -- [-1228.431] (-1227.074) (-1228.110) (-1227.455) * (-1231.817) (-1226.568) (-1226.294) [-1234.622] -- 0:01:04
657500 -- (-1227.746) (-1225.541) [-1228.153] (-1221.568) * (-1224.732) (-1226.566) (-1230.355) [-1228.749] -- 0:01:04
658000 -- (-1222.500) [-1226.747] (-1231.372) (-1234.790) * [-1227.352] (-1230.759) (-1224.459) (-1224.506) -- 0:01:04
658500 -- (-1222.275) (-1228.624) [-1225.351] (-1232.062) * [-1229.028] (-1225.374) (-1229.495) (-1224.634) -- 0:01:04
659000 -- [-1227.263] (-1223.433) (-1229.127) (-1232.859) * (-1225.136) [-1222.342] (-1224.421) (-1228.039) -- 0:01:04
659500 -- [-1223.885] (-1223.566) (-1227.483) (-1237.377) * (-1226.646) (-1227.554) (-1223.430) [-1225.479] -- 0:01:04
660000 -- (-1225.994) (-1223.731) [-1226.889] (-1231.561) * (-1227.916) (-1223.690) [-1229.247] (-1229.266) -- 0:01:03
Average standard deviation of split frequencies: 0.011773
660500 -- (-1228.064) (-1227.415) [-1225.137] (-1230.463) * (-1230.766) (-1228.281) (-1226.104) [-1225.632] -- 0:01:03
661000 -- (-1223.977) (-1229.399) (-1231.904) [-1222.663] * (-1229.102) (-1226.398) [-1225.256] (-1229.717) -- 0:01:03
661500 -- (-1225.860) (-1232.930) (-1222.790) [-1224.015] * (-1234.661) [-1229.221] (-1222.942) (-1225.617) -- 0:01:03
662000 -- (-1227.119) (-1229.404) (-1228.136) [-1222.486] * (-1228.429) [-1223.153] (-1228.818) (-1225.935) -- 0:01:03
662500 -- (-1229.456) (-1226.610) [-1231.266] (-1221.373) * [-1226.734] (-1229.716) (-1224.031) (-1229.699) -- 0:01:03
663000 -- (-1232.117) (-1230.054) (-1227.989) [-1224.119] * (-1226.150) (-1229.022) [-1226.647] (-1224.766) -- 0:01:03
663500 -- [-1232.603] (-1234.568) (-1228.413) (-1229.064) * [-1227.546] (-1231.734) (-1228.468) (-1227.990) -- 0:01:03
664000 -- [-1224.959] (-1231.285) (-1228.553) (-1224.491) * (-1228.504) (-1224.923) (-1226.198) [-1221.738] -- 0:01:03
664500 -- [-1226.835] (-1226.790) (-1227.869) (-1226.247) * (-1225.713) (-1224.395) [-1226.013] (-1224.289) -- 0:01:03
665000 -- (-1232.765) (-1230.742) [-1227.413] (-1226.323) * (-1224.862) (-1224.020) (-1226.519) [-1222.603] -- 0:01:02
Average standard deviation of split frequencies: 0.011325
665500 -- (-1226.138) (-1224.475) (-1226.033) [-1227.666] * (-1232.196) [-1222.097] (-1231.344) (-1228.874) -- 0:01:02
666000 -- (-1228.352) (-1223.020) (-1224.339) [-1226.931] * (-1230.727) [-1220.423] (-1227.511) (-1224.796) -- 0:01:02
666500 -- (-1225.459) (-1227.906) [-1226.497] (-1225.099) * (-1231.607) [-1221.333] (-1223.647) (-1228.668) -- 0:01:02
667000 -- [-1225.854] (-1225.700) (-1226.597) (-1226.796) * [-1225.441] (-1221.441) (-1224.480) (-1229.727) -- 0:01:02
667500 -- (-1229.667) (-1235.244) (-1229.329) [-1224.650] * (-1228.684) [-1223.372] (-1225.330) (-1236.481) -- 0:01:02
668000 -- [-1222.030] (-1224.447) (-1230.354) (-1220.397) * (-1225.819) (-1225.125) [-1224.828] (-1225.615) -- 0:01:02
668500 -- [-1222.316] (-1231.067) (-1224.756) (-1223.718) * (-1225.483) (-1232.871) [-1231.227] (-1225.971) -- 0:01:02
669000 -- (-1223.235) (-1227.488) [-1227.254] (-1229.335) * [-1224.249] (-1230.200) (-1234.954) (-1225.523) -- 0:01:02
669500 -- (-1225.838) (-1231.478) (-1227.618) [-1223.463] * (-1227.425) (-1228.104) [-1227.884] (-1225.873) -- 0:01:02
670000 -- (-1222.963) (-1223.518) [-1226.639] (-1232.899) * [-1225.889] (-1226.883) (-1228.442) (-1223.302) -- 0:01:02
Average standard deviation of split frequencies: 0.010895
670500 -- (-1231.058) (-1227.777) (-1226.888) [-1222.997] * [-1222.361] (-1226.527) (-1228.328) (-1225.974) -- 0:01:01
671000 -- [-1227.552] (-1223.688) (-1230.854) (-1222.172) * (-1224.445) [-1227.978] (-1225.919) (-1224.167) -- 0:01:01
671500 -- [-1220.462] (-1222.435) (-1226.303) (-1233.635) * (-1221.708) (-1226.145) (-1223.844) [-1228.915] -- 0:01:01
672000 -- [-1224.657] (-1223.988) (-1224.704) (-1223.622) * (-1228.742) (-1225.464) [-1224.084] (-1227.978) -- 0:01:01
672500 -- [-1221.770] (-1224.336) (-1221.351) (-1222.298) * (-1222.555) [-1225.125] (-1227.281) (-1225.124) -- 0:01:01
673000 -- (-1226.833) [-1224.715] (-1225.145) (-1225.784) * [-1224.424] (-1228.614) (-1226.467) (-1222.609) -- 0:01:01
673500 -- [-1225.955] (-1227.033) (-1231.852) (-1228.178) * (-1220.591) [-1223.134] (-1224.796) (-1222.567) -- 0:01:01
674000 -- (-1230.877) [-1228.196] (-1228.709) (-1223.422) * (-1232.361) (-1227.442) (-1233.854) [-1227.248] -- 0:01:01
674500 -- (-1230.681) (-1223.066) [-1226.834] (-1226.277) * (-1224.673) [-1224.564] (-1232.540) (-1228.056) -- 0:01:01
675000 -- [-1225.151] (-1229.921) (-1225.806) (-1230.109) * [-1223.548] (-1231.728) (-1224.269) (-1224.196) -- 0:01:01
Average standard deviation of split frequencies: 0.012204
675500 -- (-1230.862) (-1225.763) [-1230.334] (-1229.371) * (-1225.922) (-1229.085) [-1222.795] (-1228.119) -- 0:01:01
676000 -- (-1226.511) (-1225.348) [-1226.148] (-1226.951) * (-1228.687) (-1224.738) (-1224.796) [-1222.412] -- 0:01:00
676500 -- (-1236.469) (-1222.055) [-1223.889] (-1223.945) * (-1230.784) [-1225.534] (-1234.004) (-1225.560) -- 0:01:00
677000 -- (-1232.458) (-1224.951) [-1221.984] (-1228.450) * [-1226.776] (-1225.020) (-1230.765) (-1228.911) -- 0:01:00
677500 -- (-1225.837) (-1222.003) [-1226.823] (-1225.859) * [-1228.494] (-1227.408) (-1233.973) (-1227.417) -- 0:01:00
678000 -- (-1225.765) (-1228.098) [-1222.797] (-1231.434) * [-1223.440] (-1224.738) (-1223.721) (-1231.839) -- 0:01:00
678500 -- (-1225.931) (-1223.106) (-1222.863) [-1228.585] * (-1228.936) (-1228.893) [-1226.843] (-1227.892) -- 0:01:00
679000 -- (-1227.845) (-1229.472) [-1225.110] (-1224.991) * (-1231.231) [-1225.941] (-1230.562) (-1228.216) -- 0:01:00
679500 -- (-1222.707) (-1231.974) (-1225.780) [-1229.983] * [-1225.000] (-1227.246) (-1225.157) (-1223.401) -- 0:01:00
680000 -- (-1235.601) (-1227.692) (-1225.241) [-1224.999] * (-1221.979) (-1228.547) [-1226.749] (-1225.246) -- 0:01:00
Average standard deviation of split frequencies: 0.012293
680500 -- (-1229.179) (-1230.189) (-1226.373) [-1222.090] * [-1230.682] (-1223.669) (-1227.784) (-1229.925) -- 0:01:00
681000 -- (-1231.356) (-1229.807) (-1227.836) [-1225.728] * (-1229.392) (-1226.244) (-1231.545) [-1226.915] -- 0:00:59
681500 -- [-1225.140] (-1231.327) (-1227.488) (-1222.377) * (-1224.004) (-1223.075) (-1226.255) [-1224.698] -- 0:00:59
682000 -- (-1223.554) [-1229.969] (-1222.573) (-1222.482) * [-1225.073] (-1219.491) (-1234.312) (-1223.359) -- 0:00:59
682500 -- (-1228.692) (-1231.902) [-1227.640] (-1227.495) * (-1229.085) (-1222.629) [-1224.266] (-1227.236) -- 0:00:59
683000 -- [-1228.070] (-1223.597) (-1224.111) (-1233.747) * (-1227.648) [-1226.495] (-1228.485) (-1224.449) -- 0:00:59
683500 -- (-1225.993) (-1223.456) [-1227.222] (-1229.136) * (-1227.122) (-1224.555) [-1224.311] (-1231.630) -- 0:00:59
684000 -- (-1230.303) (-1224.729) (-1232.372) [-1224.926] * (-1222.574) [-1221.652] (-1224.595) (-1228.673) -- 0:00:59
684500 -- (-1227.246) (-1219.520) (-1229.330) [-1224.140] * (-1222.566) (-1225.724) [-1226.637] (-1226.280) -- 0:00:59
685000 -- (-1238.833) (-1224.918) (-1222.098) [-1227.580] * (-1227.333) (-1234.603) [-1224.045] (-1224.855) -- 0:00:59
Average standard deviation of split frequencies: 0.012197
685500 -- (-1233.627) (-1227.163) [-1221.762] (-1225.057) * [-1225.607] (-1234.672) (-1232.464) (-1227.748) -- 0:00:59
686000 -- (-1230.213) [-1228.115] (-1232.921) (-1222.293) * [-1222.367] (-1228.411) (-1222.755) (-1226.700) -- 0:00:59
686500 -- (-1228.909) (-1221.053) [-1225.566] (-1226.511) * (-1232.623) [-1222.381] (-1229.421) (-1228.282) -- 0:00:58
687000 -- [-1228.029] (-1233.131) (-1225.618) (-1231.615) * (-1229.261) [-1220.370] (-1228.885) (-1225.294) -- 0:00:58
687500 -- (-1228.123) (-1225.698) [-1222.946] (-1227.039) * (-1226.587) (-1220.983) [-1224.705] (-1233.708) -- 0:00:58
688000 -- (-1224.264) (-1229.033) (-1227.475) [-1221.190] * [-1224.653] (-1224.480) (-1226.431) (-1232.640) -- 0:00:58
688500 -- [-1225.499] (-1222.479) (-1232.242) (-1224.514) * (-1226.985) (-1225.397) (-1226.975) [-1222.068] -- 0:00:58
689000 -- (-1230.312) (-1224.947) (-1232.660) [-1226.936] * (-1227.243) (-1224.751) [-1230.267] (-1230.321) -- 0:00:58
689500 -- (-1224.351) (-1226.058) (-1229.151) [-1224.741] * (-1222.596) (-1227.826) [-1226.064] (-1225.467) -- 0:00:58
690000 -- (-1223.796) (-1228.678) [-1226.691] (-1228.892) * (-1225.478) (-1230.663) (-1227.432) [-1229.281] -- 0:00:58
Average standard deviation of split frequencies: 0.013139
690500 -- (-1221.768) (-1229.830) (-1223.464) [-1228.657] * (-1229.909) (-1228.160) [-1224.293] (-1227.771) -- 0:00:58
691000 -- (-1227.740) (-1230.815) [-1223.766] (-1226.029) * (-1226.328) (-1236.703) [-1222.963] (-1225.494) -- 0:00:58
691500 -- [-1222.530] (-1234.652) (-1227.537) (-1222.886) * (-1229.134) (-1227.741) [-1224.684] (-1232.054) -- 0:00:57
692000 -- [-1228.171] (-1240.626) (-1227.225) (-1225.868) * (-1228.959) [-1226.154] (-1221.822) (-1228.983) -- 0:00:57
692500 -- (-1224.142) (-1228.210) [-1226.707] (-1226.631) * [-1225.448] (-1226.081) (-1225.133) (-1230.256) -- 0:00:57
693000 -- [-1223.979] (-1221.979) (-1232.335) (-1224.213) * (-1228.453) (-1230.710) (-1226.798) [-1229.758] -- 0:00:57
693500 -- [-1225.028] (-1226.963) (-1230.008) (-1221.193) * (-1225.721) [-1224.374] (-1229.058) (-1225.782) -- 0:00:57
694000 -- (-1227.063) [-1227.993] (-1236.854) (-1223.044) * (-1230.460) [-1221.213] (-1226.739) (-1231.763) -- 0:00:57
694500 -- (-1227.945) [-1224.917] (-1225.218) (-1224.830) * (-1226.546) (-1229.907) (-1230.203) [-1222.516] -- 0:00:57
695000 -- (-1227.357) (-1227.591) [-1229.713] (-1227.761) * (-1227.423) [-1226.916] (-1227.183) (-1225.191) -- 0:00:57
Average standard deviation of split frequencies: 0.012699
695500 -- [-1225.970] (-1225.756) (-1229.726) (-1221.969) * [-1223.347] (-1225.029) (-1234.775) (-1227.264) -- 0:00:57
696000 -- (-1226.204) (-1229.878) (-1225.424) [-1227.432] * (-1229.415) [-1224.936] (-1226.983) (-1225.555) -- 0:00:57
696500 -- (-1227.168) (-1224.404) [-1228.428] (-1228.723) * (-1224.473) (-1228.594) [-1221.437] (-1227.932) -- 0:00:57
697000 -- (-1221.250) (-1222.518) [-1226.489] (-1228.224) * [-1220.507] (-1226.394) (-1232.799) (-1224.853) -- 0:00:56
697500 -- (-1234.032) [-1226.668] (-1222.877) (-1224.045) * (-1229.299) (-1226.549) (-1222.094) [-1225.633] -- 0:00:56
698000 -- (-1226.140) (-1229.102) (-1223.147) [-1226.316] * (-1226.779) [-1224.505] (-1229.536) (-1231.211) -- 0:00:56
698500 -- (-1232.601) [-1223.815] (-1226.539) (-1224.820) * (-1225.975) (-1233.826) (-1232.982) [-1226.684] -- 0:00:56
699000 -- (-1224.789) [-1223.271] (-1229.035) (-1226.616) * (-1224.896) (-1234.985) (-1225.112) [-1227.351] -- 0:00:56
699500 -- (-1219.501) (-1230.224) (-1225.166) [-1224.732] * (-1225.974) (-1222.642) (-1228.134) [-1223.851] -- 0:00:56
700000 -- (-1225.600) [-1221.982] (-1230.069) (-1233.383) * (-1223.440) [-1225.754] (-1227.208) (-1227.660) -- 0:00:56
Average standard deviation of split frequencies: 0.011942
700500 -- (-1226.566) (-1224.125) [-1225.302] (-1226.190) * (-1224.148) (-1227.711) (-1228.416) [-1229.608] -- 0:00:56
701000 -- [-1228.856] (-1223.288) (-1227.090) (-1226.125) * (-1232.725) [-1227.358] (-1225.822) (-1223.260) -- 0:00:56
701500 -- (-1225.364) [-1223.734] (-1227.439) (-1226.239) * (-1229.240) [-1226.698] (-1236.400) (-1225.716) -- 0:00:56
702000 -- (-1231.474) [-1224.140] (-1234.975) (-1227.819) * (-1229.856) (-1227.674) [-1224.050] (-1227.542) -- 0:00:56
702500 -- (-1227.616) (-1231.669) [-1229.684] (-1229.200) * (-1232.410) (-1223.305) [-1226.206] (-1225.682) -- 0:00:55
703000 -- (-1231.692) (-1224.689) [-1224.526] (-1222.243) * (-1224.611) (-1221.491) (-1225.809) [-1224.572] -- 0:00:55
703500 -- (-1225.690) (-1227.936) (-1229.425) [-1226.827] * (-1225.721) (-1228.238) (-1226.536) [-1227.515] -- 0:00:55
704000 -- (-1223.492) (-1238.417) (-1223.979) [-1225.402] * (-1227.099) [-1225.521] (-1223.867) (-1225.197) -- 0:00:55
704500 -- (-1225.721) (-1231.221) (-1228.265) [-1220.338] * (-1224.501) (-1221.943) [-1229.345] (-1220.067) -- 0:00:55
705000 -- (-1223.337) (-1229.501) (-1226.482) [-1227.442] * (-1229.013) [-1225.199] (-1226.050) (-1228.693) -- 0:00:55
Average standard deviation of split frequencies: 0.011852
705500 -- (-1221.076) [-1227.919] (-1222.537) (-1225.222) * [-1224.970] (-1229.235) (-1221.832) (-1225.342) -- 0:00:55
706000 -- [-1221.824] (-1227.796) (-1228.417) (-1222.430) * (-1222.343) [-1221.203] (-1227.178) (-1226.318) -- 0:00:55
706500 -- [-1227.418] (-1222.715) (-1232.864) (-1228.310) * (-1227.836) (-1227.587) [-1223.393] (-1227.614) -- 0:00:55
707000 -- (-1223.781) [-1226.168] (-1227.357) (-1224.513) * [-1227.709] (-1230.977) (-1226.663) (-1231.002) -- 0:00:55
707500 -- (-1226.617) (-1225.295) [-1222.072] (-1225.799) * (-1229.171) (-1222.561) [-1227.869] (-1236.367) -- 0:00:54
708000 -- (-1222.523) [-1224.318] (-1222.714) (-1231.994) * (-1228.192) (-1232.006) [-1222.700] (-1227.248) -- 0:00:54
708500 -- [-1221.944] (-1227.646) (-1231.821) (-1224.420) * (-1231.442) (-1233.729) [-1221.575] (-1228.344) -- 0:00:54
709000 -- (-1225.581) (-1225.945) [-1227.275] (-1226.192) * (-1228.366) (-1222.174) (-1222.371) [-1227.316] -- 0:00:54
709500 -- (-1238.041) [-1224.691] (-1226.837) (-1224.453) * (-1237.365) (-1223.095) [-1224.508] (-1231.137) -- 0:00:54
710000 -- (-1226.749) (-1227.605) [-1225.571] (-1230.394) * [-1224.158] (-1228.779) (-1232.489) (-1227.891) -- 0:00:54
Average standard deviation of split frequencies: 0.011442
710500 -- (-1228.786) [-1225.538] (-1225.135) (-1224.461) * (-1226.810) (-1229.579) [-1235.124] (-1226.348) -- 0:00:54
711000 -- (-1227.153) [-1226.193] (-1224.084) (-1225.770) * (-1229.392) (-1222.260) (-1226.655) [-1223.877] -- 0:00:54
711500 -- (-1227.797) (-1226.142) [-1222.680] (-1229.573) * (-1230.284) (-1227.872) [-1224.144] (-1224.639) -- 0:00:54
712000 -- (-1222.774) (-1227.984) [-1224.510] (-1230.311) * (-1225.795) (-1232.230) (-1222.345) [-1224.280] -- 0:00:54
712500 -- [-1222.229] (-1227.544) (-1223.334) (-1225.432) * (-1231.254) (-1228.509) (-1224.412) [-1222.123] -- 0:00:54
713000 -- (-1228.734) [-1223.982] (-1236.277) (-1222.981) * (-1227.137) (-1226.492) [-1222.511] (-1235.844) -- 0:00:53
713500 -- (-1226.661) (-1223.500) (-1224.376) [-1225.888] * (-1231.223) [-1232.303] (-1222.321) (-1231.768) -- 0:00:53
714000 -- (-1229.533) (-1227.154) [-1224.718] (-1233.585) * (-1232.413) (-1230.818) (-1226.752) [-1225.830] -- 0:00:53
714500 -- (-1228.217) (-1222.018) (-1224.087) [-1228.696] * (-1232.128) [-1226.987] (-1226.943) (-1225.529) -- 0:00:53
715000 -- (-1227.712) (-1224.852) [-1224.895] (-1238.495) * (-1237.561) [-1222.522] (-1223.130) (-1225.700) -- 0:00:53
Average standard deviation of split frequencies: 0.012016
715500 -- (-1224.506) (-1223.140) (-1220.439) [-1226.198] * (-1228.797) [-1224.955] (-1228.063) (-1226.648) -- 0:00:53
716000 -- (-1230.119) (-1222.558) [-1227.237] (-1230.722) * (-1226.468) (-1226.854) [-1225.689] (-1226.094) -- 0:00:53
716500 -- [-1223.690] (-1225.343) (-1229.071) (-1231.649) * (-1228.505) (-1224.389) [-1232.678] (-1225.839) -- 0:00:53
717000 -- [-1226.522] (-1223.842) (-1228.130) (-1225.658) * (-1226.327) (-1227.406) (-1232.428) [-1223.984] -- 0:00:53
717500 -- [-1221.814] (-1227.947) (-1227.684) (-1229.766) * (-1224.546) (-1225.559) (-1230.169) [-1226.658] -- 0:00:53
718000 -- [-1226.811] (-1229.413) (-1232.370) (-1229.600) * (-1224.797) (-1224.971) (-1237.266) [-1232.581] -- 0:00:53
718500 -- (-1229.825) (-1230.370) (-1227.341) [-1221.210] * (-1233.680) (-1236.391) [-1229.801] (-1227.449) -- 0:00:52
719000 -- [-1225.188] (-1228.026) (-1230.064) (-1232.534) * (-1233.400) (-1223.464) [-1225.401] (-1223.066) -- 0:00:52
719500 -- [-1224.635] (-1227.237) (-1233.064) (-1226.305) * (-1229.528) (-1224.620) (-1224.852) [-1223.191] -- 0:00:53
720000 -- [-1224.343] (-1232.871) (-1223.337) (-1232.520) * (-1232.770) (-1224.843) (-1226.594) [-1225.485] -- 0:00:52
Average standard deviation of split frequencies: 0.011611
720500 -- (-1227.677) (-1225.955) [-1224.196] (-1232.985) * (-1228.422) [-1236.055] (-1227.116) (-1230.790) -- 0:00:52
721000 -- (-1228.328) (-1226.911) [-1221.685] (-1224.717) * (-1226.964) (-1226.570) (-1229.560) [-1223.523] -- 0:00:52
721500 -- (-1225.288) (-1231.885) [-1221.297] (-1227.486) * (-1238.543) (-1223.988) [-1222.993] (-1226.702) -- 0:00:52
722000 -- [-1227.876] (-1223.730) (-1225.274) (-1234.677) * (-1231.297) (-1223.468) [-1227.950] (-1236.549) -- 0:00:52
722500 -- (-1236.940) (-1227.522) [-1224.906] (-1230.152) * [-1224.771] (-1225.333) (-1222.601) (-1241.212) -- 0:00:52
723000 -- (-1223.235) (-1226.112) [-1221.139] (-1226.894) * [-1226.622] (-1222.357) (-1228.082) (-1234.429) -- 0:00:52
723500 -- (-1227.084) [-1225.520] (-1224.695) (-1229.039) * [-1232.200] (-1228.212) (-1237.445) (-1229.425) -- 0:00:51
724000 -- (-1224.896) (-1226.821) [-1224.539] (-1226.446) * [-1226.912] (-1223.392) (-1226.022) (-1234.413) -- 0:00:51
724500 -- (-1228.750) (-1226.989) [-1224.070] (-1227.785) * [-1223.096] (-1227.544) (-1223.042) (-1231.069) -- 0:00:51
725000 -- (-1227.287) (-1223.308) [-1224.618] (-1227.097) * (-1230.000) (-1224.004) [-1226.566] (-1232.269) -- 0:00:51
Average standard deviation of split frequencies: 0.011038
725500 -- (-1231.836) [-1225.301] (-1224.863) (-1231.575) * [-1226.249] (-1224.066) (-1228.097) (-1227.598) -- 0:00:51
726000 -- (-1225.308) [-1223.154] (-1223.508) (-1225.384) * (-1227.774) [-1225.595] (-1223.739) (-1222.881) -- 0:00:51
726500 -- (-1226.202) [-1224.117] (-1230.243) (-1227.486) * (-1225.614) (-1227.457) (-1226.385) [-1222.551] -- 0:00:51
727000 -- [-1226.657] (-1225.591) (-1227.960) (-1228.276) * (-1224.378) (-1222.481) [-1230.340] (-1223.637) -- 0:00:51
727500 -- (-1228.153) [-1228.857] (-1231.411) (-1224.754) * (-1227.347) (-1223.324) (-1221.292) [-1227.769] -- 0:00:51
728000 -- (-1222.020) (-1225.857) [-1229.602] (-1227.128) * (-1232.106) (-1224.967) [-1224.948] (-1229.420) -- 0:00:51
728500 -- (-1228.004) [-1222.160] (-1230.004) (-1228.464) * [-1226.561] (-1228.673) (-1224.397) (-1228.160) -- 0:00:51
729000 -- (-1224.119) (-1225.663) [-1230.461] (-1229.234) * (-1230.019) [-1226.486] (-1230.107) (-1221.988) -- 0:00:50
729500 -- (-1223.670) [-1224.663] (-1226.851) (-1226.178) * [-1224.002] (-1225.087) (-1226.058) (-1223.934) -- 0:00:50
730000 -- (-1230.098) (-1229.761) [-1222.558] (-1225.130) * [-1226.105] (-1226.006) (-1228.730) (-1236.266) -- 0:00:51
Average standard deviation of split frequencies: 0.010645
730500 -- [-1223.779] (-1225.557) (-1226.733) (-1229.940) * (-1224.171) (-1227.807) [-1227.713] (-1233.291) -- 0:00:50
731000 -- (-1228.459) (-1220.173) (-1225.785) [-1223.848] * (-1224.958) [-1225.446] (-1224.118) (-1224.401) -- 0:00:50
731500 -- [-1226.594] (-1222.015) (-1222.918) (-1225.626) * (-1221.341) (-1224.024) (-1223.905) [-1230.226] -- 0:00:50
732000 -- (-1229.478) (-1221.109) [-1223.055] (-1224.489) * (-1230.429) (-1224.518) (-1225.172) [-1222.700] -- 0:00:50
732500 -- (-1229.461) (-1224.870) [-1226.366] (-1232.545) * (-1233.113) (-1225.561) (-1225.798) [-1224.164] -- 0:00:50
733000 -- (-1226.556) (-1237.539) [-1223.261] (-1230.142) * (-1228.073) (-1227.734) (-1233.216) [-1223.978] -- 0:00:50
733500 -- (-1227.630) (-1226.140) (-1224.997) [-1226.231] * (-1223.871) (-1223.726) (-1228.835) [-1227.042] -- 0:00:50
734000 -- (-1227.515) [-1224.440] (-1221.624) (-1230.303) * (-1222.309) [-1226.197] (-1231.147) (-1224.309) -- 0:00:50
734500 -- (-1227.077) [-1223.781] (-1222.693) (-1224.958) * (-1224.587) (-1228.910) [-1227.254] (-1229.815) -- 0:00:49
735000 -- (-1220.979) (-1226.132) (-1231.826) [-1224.226] * (-1226.020) (-1221.335) [-1228.015] (-1231.132) -- 0:00:49
Average standard deviation of split frequencies: 0.010728
735500 -- [-1220.500] (-1231.654) (-1234.307) (-1227.292) * (-1232.313) [-1223.868] (-1226.974) (-1221.762) -- 0:00:49
736000 -- (-1223.282) (-1222.952) [-1223.697] (-1224.959) * (-1227.341) (-1229.115) (-1227.170) [-1227.051] -- 0:00:49
736500 -- (-1227.267) [-1223.470] (-1228.307) (-1222.374) * [-1229.823] (-1228.483) (-1226.981) (-1224.198) -- 0:00:49
737000 -- (-1220.853) (-1227.686) (-1224.591) [-1225.028] * (-1224.077) (-1231.989) (-1228.830) [-1225.124] -- 0:00:49
737500 -- (-1222.553) (-1228.694) (-1228.108) [-1231.027] * (-1226.704) [-1224.297] (-1232.628) (-1227.774) -- 0:00:49
738000 -- [-1222.909] (-1229.256) (-1229.544) (-1228.919) * (-1222.929) (-1230.019) [-1223.713] (-1231.564) -- 0:00:49
738500 -- (-1228.075) [-1223.745] (-1220.033) (-1224.262) * (-1232.724) (-1228.800) [-1234.586] (-1226.229) -- 0:00:49
739000 -- (-1229.664) (-1224.084) [-1233.463] (-1222.394) * (-1234.874) [-1224.238] (-1225.325) (-1226.585) -- 0:00:49
739500 -- (-1225.598) (-1225.124) (-1228.243) [-1225.678] * (-1225.644) (-1226.568) [-1222.027] (-1228.368) -- 0:00:48
740000 -- (-1221.479) (-1222.233) [-1234.786] (-1224.370) * (-1226.106) [-1225.812] (-1224.843) (-1229.785) -- 0:00:48
Average standard deviation of split frequencies: 0.010183
740500 -- [-1227.425] (-1227.847) (-1233.298) (-1236.243) * (-1229.645) [-1222.021] (-1225.998) (-1230.147) -- 0:00:49
741000 -- (-1230.723) (-1225.562) (-1224.848) [-1227.326] * (-1226.060) (-1226.287) [-1228.455] (-1227.631) -- 0:00:48
741500 -- (-1235.084) (-1229.768) [-1226.964] (-1226.492) * [-1229.758] (-1228.249) (-1227.797) (-1226.623) -- 0:00:48
742000 -- (-1230.023) (-1229.179) [-1222.016] (-1232.787) * [-1231.895] (-1225.972) (-1230.254) (-1235.442) -- 0:00:48
742500 -- [-1226.423] (-1229.690) (-1225.963) (-1229.385) * (-1227.202) (-1231.883) [-1227.241] (-1228.548) -- 0:00:48
743000 -- (-1230.134) [-1225.474] (-1224.457) (-1229.832) * (-1227.720) [-1229.557] (-1224.287) (-1225.844) -- 0:00:48
743500 -- [-1229.426] (-1231.628) (-1229.716) (-1225.602) * (-1226.095) (-1225.032) [-1224.901] (-1225.596) -- 0:00:48
744000 -- (-1234.826) (-1226.625) [-1229.377] (-1228.534) * (-1224.421) [-1221.023] (-1224.816) (-1226.707) -- 0:00:48
744500 -- (-1229.353) (-1225.147) (-1225.489) [-1234.603] * (-1224.401) [-1225.901] (-1227.105) (-1227.846) -- 0:00:48
745000 -- (-1225.371) (-1228.332) (-1227.255) [-1232.841] * (-1230.922) (-1228.312) (-1229.445) [-1223.995] -- 0:00:47
Average standard deviation of split frequencies: 0.009953
745500 -- (-1230.721) (-1221.854) [-1225.961] (-1234.527) * (-1232.213) (-1224.280) [-1224.176] (-1223.977) -- 0:00:47
746000 -- (-1226.775) (-1225.311) [-1221.637] (-1229.957) * (-1236.406) [-1224.251] (-1224.041) (-1222.169) -- 0:00:48
746500 -- (-1229.366) [-1228.931] (-1222.251) (-1227.448) * [-1224.192] (-1223.406) (-1226.358) (-1225.420) -- 0:00:47
747000 -- (-1226.585) (-1224.393) (-1223.818) [-1225.837] * (-1230.611) (-1228.356) (-1232.752) [-1227.128] -- 0:00:47
747500 -- (-1226.138) (-1227.474) (-1225.329) [-1224.942] * (-1231.428) (-1224.647) [-1228.581] (-1228.790) -- 0:00:47
748000 -- (-1224.230) [-1231.120] (-1223.785) (-1224.345) * [-1227.584] (-1228.547) (-1235.038) (-1227.511) -- 0:00:47
748500 -- [-1225.623] (-1231.059) (-1224.081) (-1219.694) * [-1224.267] (-1221.013) (-1222.266) (-1222.604) -- 0:00:47
749000 -- (-1227.199) [-1225.185] (-1225.845) (-1222.292) * [-1230.028] (-1234.825) (-1225.860) (-1230.338) -- 0:00:47
749500 -- [-1229.567] (-1232.855) (-1226.255) (-1228.602) * (-1221.953) (-1238.442) [-1230.095] (-1231.605) -- 0:00:47
750000 -- (-1226.558) [-1229.283] (-1224.725) (-1224.675) * (-1225.368) (-1227.173) [-1223.068] (-1231.319) -- 0:00:47
Average standard deviation of split frequencies: 0.010519
750500 -- [-1225.928] (-1231.046) (-1226.787) (-1232.651) * (-1224.505) (-1239.739) [-1223.800] (-1224.714) -- 0:00:46
751000 -- (-1225.198) [-1228.623] (-1228.924) (-1226.520) * (-1225.594) (-1238.385) [-1225.718] (-1228.515) -- 0:00:47
751500 -- (-1231.232) (-1225.682) [-1228.436] (-1224.243) * (-1223.933) (-1229.627) [-1222.949] (-1225.746) -- 0:00:46
752000 -- (-1224.159) [-1230.737] (-1224.089) (-1226.362) * (-1223.739) (-1228.393) [-1220.384] (-1229.540) -- 0:00:46
752500 -- (-1223.589) (-1227.888) (-1232.175) [-1224.095] * (-1229.152) (-1224.321) [-1221.311] (-1224.910) -- 0:00:46
753000 -- (-1237.690) (-1230.249) [-1224.591] (-1225.204) * (-1225.111) (-1225.180) [-1228.414] (-1223.048) -- 0:00:46
753500 -- (-1225.904) (-1225.965) [-1236.420] (-1225.711) * (-1224.462) (-1222.956) [-1226.981] (-1227.127) -- 0:00:46
754000 -- (-1226.774) (-1228.574) (-1231.240) [-1225.516] * [-1229.209] (-1223.983) (-1227.426) (-1225.440) -- 0:00:46
754500 -- (-1225.693) (-1229.166) [-1233.711] (-1223.427) * (-1229.058) (-1226.859) (-1232.654) [-1224.143] -- 0:00:46
755000 -- (-1230.824) [-1223.632] (-1226.973) (-1223.098) * (-1221.437) (-1240.624) (-1230.773) [-1225.069] -- 0:00:46
Average standard deviation of split frequencies: 0.010912
755500 -- (-1222.527) (-1228.511) (-1222.052) [-1226.747] * (-1228.014) (-1222.380) (-1223.794) [-1226.684] -- 0:00:45
756000 -- [-1224.460] (-1227.685) (-1227.199) (-1222.344) * [-1230.755] (-1230.466) (-1225.574) (-1231.633) -- 0:00:45
756500 -- [-1222.788] (-1224.946) (-1222.198) (-1232.435) * [-1225.568] (-1222.299) (-1230.057) (-1247.897) -- 0:00:46
757000 -- (-1222.435) (-1227.252) (-1226.281) [-1227.357] * (-1227.335) (-1221.776) [-1229.361] (-1230.317) -- 0:00:45
757500 -- (-1228.524) (-1221.467) (-1233.281) [-1227.301] * [-1227.640] (-1231.136) (-1226.226) (-1226.767) -- 0:00:45
758000 -- [-1230.133] (-1223.996) (-1225.318) (-1225.707) * [-1224.777] (-1226.578) (-1228.760) (-1229.261) -- 0:00:45
758500 -- (-1228.130) (-1230.373) [-1224.182] (-1225.642) * (-1222.886) [-1225.431] (-1227.504) (-1229.128) -- 0:00:45
759000 -- (-1230.870) [-1224.131] (-1227.959) (-1227.424) * (-1219.878) [-1221.579] (-1230.022) (-1224.424) -- 0:00:45
759500 -- (-1228.439) (-1224.089) [-1228.150] (-1224.550) * (-1227.308) [-1229.784] (-1227.042) (-1225.136) -- 0:00:45
760000 -- (-1225.536) (-1222.998) (-1228.742) [-1233.907] * (-1223.893) (-1233.038) (-1222.588) [-1227.288] -- 0:00:45
Average standard deviation of split frequencies: 0.010845
760500 -- (-1226.439) (-1228.936) (-1227.624) [-1224.906] * (-1223.461) (-1237.218) [-1225.655] (-1228.274) -- 0:00:45
761000 -- [-1220.544] (-1231.018) (-1229.119) (-1228.254) * (-1223.613) (-1236.323) [-1223.907] (-1225.522) -- 0:00:44
761500 -- (-1221.999) (-1234.781) [-1226.420] (-1228.092) * (-1225.744) (-1228.222) (-1227.811) [-1222.807] -- 0:00:45
762000 -- (-1223.761) (-1233.131) (-1226.084) [-1226.722] * (-1221.873) (-1222.920) [-1227.972] (-1230.114) -- 0:00:44
762500 -- (-1226.966) (-1230.163) (-1228.108) [-1227.115] * [-1222.410] (-1223.461) (-1225.871) (-1226.924) -- 0:00:44
763000 -- (-1230.843) (-1227.562) (-1226.718) [-1226.289] * (-1229.221) [-1220.932] (-1233.598) (-1224.084) -- 0:00:44
763500 -- (-1221.942) (-1224.114) (-1233.089) [-1228.301] * (-1227.130) (-1221.054) (-1226.220) [-1231.979] -- 0:00:44
764000 -- (-1223.932) (-1232.502) [-1223.444] (-1224.409) * [-1232.431] (-1229.905) (-1234.876) (-1233.530) -- 0:00:44
764500 -- (-1224.785) [-1229.228] (-1229.418) (-1234.065) * (-1222.887) (-1224.654) (-1229.466) [-1231.763] -- 0:00:44
765000 -- [-1226.813] (-1225.589) (-1230.876) (-1234.314) * [-1227.243] (-1223.496) (-1224.277) (-1232.865) -- 0:00:44
Average standard deviation of split frequencies: 0.011385
765500 -- (-1226.454) [-1227.250] (-1230.403) (-1229.970) * [-1229.405] (-1220.942) (-1229.836) (-1232.448) -- 0:00:44
766000 -- [-1229.169] (-1228.513) (-1232.326) (-1226.082) * (-1230.943) (-1225.865) [-1221.167] (-1238.137) -- 0:00:43
766500 -- (-1230.127) [-1222.829] (-1224.363) (-1227.815) * (-1225.312) (-1224.485) [-1232.715] (-1227.821) -- 0:00:43
767000 -- (-1226.383) (-1225.241) [-1221.223] (-1232.410) * (-1227.417) [-1224.116] (-1230.206) (-1224.423) -- 0:00:44
767500 -- (-1224.180) (-1232.355) (-1227.433) [-1224.646] * (-1232.921) [-1224.868] (-1227.784) (-1230.303) -- 0:00:43
768000 -- [-1224.441] (-1228.482) (-1221.170) (-1228.329) * (-1228.343) (-1228.485) [-1227.704] (-1236.411) -- 0:00:43
768500 -- (-1223.151) (-1225.434) [-1228.300] (-1226.328) * (-1223.895) [-1225.452] (-1226.417) (-1226.318) -- 0:00:43
769000 -- [-1225.420] (-1231.490) (-1230.764) (-1228.969) * (-1224.975) [-1223.066] (-1226.534) (-1225.933) -- 0:00:43
769500 -- (-1222.046) (-1223.832) [-1224.630] (-1233.940) * (-1227.317) [-1223.056] (-1229.852) (-1228.790) -- 0:00:43
770000 -- (-1224.399) (-1226.611) [-1224.774] (-1237.836) * (-1225.718) (-1226.063) (-1227.169) [-1228.538] -- 0:00:43
Average standard deviation of split frequencies: 0.010552
770500 -- (-1223.899) [-1229.620] (-1225.363) (-1229.626) * [-1224.409] (-1230.113) (-1234.068) (-1223.321) -- 0:00:43
771000 -- (-1223.976) (-1225.202) (-1224.361) [-1230.072] * [-1223.747] (-1224.547) (-1230.567) (-1238.933) -- 0:00:43
771500 -- (-1223.223) (-1225.106) (-1225.454) [-1227.401] * (-1224.278) (-1226.998) (-1229.769) [-1221.976] -- 0:00:43
772000 -- (-1222.671) (-1225.837) (-1230.653) [-1227.923] * (-1232.867) (-1230.441) (-1222.471) [-1223.849] -- 0:00:43
772500 -- (-1222.086) (-1224.331) [-1225.044] (-1229.075) * [-1227.622] (-1231.722) (-1224.342) (-1224.539) -- 0:00:42
773000 -- (-1221.573) (-1225.293) (-1224.111) [-1228.588] * (-1222.149) [-1229.122] (-1229.159) (-1231.477) -- 0:00:42
773500 -- [-1227.726] (-1236.589) (-1225.374) (-1226.094) * [-1224.549] (-1229.434) (-1226.499) (-1233.871) -- 0:00:42
774000 -- (-1223.714) (-1225.990) (-1226.474) [-1227.473] * (-1228.205) [-1227.119] (-1239.336) (-1229.833) -- 0:00:42
774500 -- (-1230.824) [-1221.780] (-1224.017) (-1228.827) * [-1222.827] (-1223.837) (-1238.363) (-1228.010) -- 0:00:42
775000 -- (-1233.634) [-1229.423] (-1227.169) (-1225.654) * [-1228.806] (-1221.971) (-1232.275) (-1231.812) -- 0:00:42
Average standard deviation of split frequencies: 0.010023
775500 -- (-1225.096) (-1223.683) [-1224.872] (-1221.109) * (-1221.440) (-1228.098) (-1231.604) [-1227.096] -- 0:00:42
776000 -- (-1227.439) (-1220.642) (-1230.304) [-1224.715] * (-1231.074) (-1229.764) (-1227.863) [-1224.127] -- 0:00:42
776500 -- (-1227.258) [-1221.193] (-1230.166) (-1225.193) * [-1229.935] (-1224.853) (-1226.758) (-1225.603) -- 0:00:42
777000 -- (-1229.663) (-1225.774) [-1224.859] (-1223.256) * (-1230.614) [-1222.333] (-1223.696) (-1227.318) -- 0:00:42
777500 -- (-1226.039) (-1227.272) [-1220.946] (-1230.931) * (-1228.769) (-1222.722) [-1227.864] (-1227.682) -- 0:00:42
778000 -- (-1229.738) (-1230.579) (-1229.947) [-1225.748] * (-1223.279) [-1220.328] (-1228.438) (-1226.992) -- 0:00:41
778500 -- (-1227.359) (-1225.997) [-1222.323] (-1224.038) * (-1222.312) (-1234.713) (-1226.785) [-1226.207] -- 0:00:41
779000 -- (-1228.372) (-1224.220) (-1227.818) [-1231.082] * (-1234.558) (-1230.852) [-1229.681] (-1228.549) -- 0:00:41
779500 -- (-1223.926) (-1234.002) [-1227.804] (-1229.729) * (-1224.627) [-1224.460] (-1223.244) (-1226.151) -- 0:00:41
780000 -- (-1221.378) (-1232.066) (-1226.186) [-1224.877] * (-1225.944) [-1238.883] (-1228.987) (-1221.952) -- 0:00:41
Average standard deviation of split frequencies: 0.009662
780500 -- (-1229.595) (-1226.266) (-1223.206) [-1227.776] * (-1232.019) (-1232.555) [-1231.102] (-1228.285) -- 0:00:41
781000 -- [-1227.740] (-1223.846) (-1228.359) (-1232.101) * [-1233.473] (-1230.607) (-1227.357) (-1221.990) -- 0:00:41
781500 -- (-1229.563) (-1221.164) (-1227.528) [-1233.252] * (-1227.819) (-1227.147) (-1225.536) [-1226.205] -- 0:00:41
782000 -- [-1223.755] (-1230.844) (-1224.028) (-1242.829) * (-1230.180) (-1223.619) [-1229.449] (-1224.999) -- 0:00:40
782500 -- (-1225.942) [-1225.346] (-1221.486) (-1228.352) * (-1228.333) [-1224.924] (-1232.923) (-1225.620) -- 0:00:41
783000 -- (-1224.788) (-1226.072) [-1225.140] (-1227.698) * (-1230.111) (-1226.623) (-1224.832) [-1229.534] -- 0:00:41
783500 -- (-1223.960) [-1226.356] (-1231.060) (-1227.462) * [-1226.612] (-1228.180) (-1226.551) (-1225.184) -- 0:00:40
784000 -- (-1227.354) (-1225.759) [-1223.907] (-1228.388) * (-1229.967) (-1226.402) [-1227.163] (-1227.566) -- 0:00:40
784500 -- [-1228.103] (-1227.906) (-1222.016) (-1228.366) * (-1230.767) [-1228.002] (-1226.006) (-1226.184) -- 0:00:40
785000 -- (-1230.475) (-1232.614) [-1221.270] (-1224.019) * [-1222.472] (-1227.662) (-1232.870) (-1230.006) -- 0:00:40
Average standard deviation of split frequencies: 0.009296
785500 -- (-1227.487) (-1225.448) (-1224.204) [-1230.151] * (-1225.674) (-1229.772) [-1223.571] (-1221.818) -- 0:00:40
786000 -- (-1223.369) (-1227.479) (-1233.579) [-1227.921] * (-1226.408) (-1224.157) [-1225.626] (-1221.500) -- 0:00:40
786500 -- (-1228.108) [-1229.445] (-1234.931) (-1229.355) * (-1226.838) (-1225.472) (-1228.252) [-1222.579] -- 0:00:40
787000 -- [-1227.210] (-1226.563) (-1225.298) (-1237.949) * (-1229.851) (-1224.147) (-1231.368) [-1228.530] -- 0:00:40
787500 -- [-1228.443] (-1225.993) (-1233.108) (-1232.099) * (-1227.610) (-1230.004) (-1228.207) [-1224.157] -- 0:00:40
788000 -- (-1227.594) (-1229.932) [-1223.725] (-1227.703) * (-1220.550) (-1221.950) [-1223.608] (-1227.058) -- 0:00:40
788500 -- (-1231.157) [-1238.044] (-1229.971) (-1227.898) * [-1223.306] (-1226.405) (-1223.717) (-1227.193) -- 0:00:39
789000 -- (-1226.583) (-1234.232) [-1226.486] (-1225.827) * (-1229.257) (-1226.399) (-1230.167) [-1227.393] -- 0:00:39
789500 -- (-1225.015) (-1225.770) (-1233.428) [-1225.992] * (-1226.911) [-1225.021] (-1225.336) (-1227.929) -- 0:00:39
790000 -- (-1233.807) (-1231.448) [-1227.935] (-1228.466) * (-1233.269) [-1221.107] (-1234.594) (-1225.004) -- 0:00:39
Average standard deviation of split frequencies: 0.008943
790500 -- (-1230.595) (-1224.812) (-1225.856) [-1232.978] * (-1229.785) [-1221.210] (-1223.080) (-1223.938) -- 0:00:39
791000 -- [-1225.270] (-1222.707) (-1223.748) (-1226.932) * (-1229.051) [-1229.450] (-1231.955) (-1225.136) -- 0:00:39
791500 -- (-1226.015) [-1222.769] (-1225.610) (-1230.465) * (-1226.786) (-1227.153) (-1223.547) [-1223.445] -- 0:00:39
792000 -- (-1225.405) [-1223.826] (-1226.296) (-1234.903) * [-1228.138] (-1229.793) (-1229.329) (-1224.344) -- 0:00:39
792500 -- (-1232.495) [-1221.899] (-1223.042) (-1236.030) * [-1220.288] (-1227.105) (-1230.455) (-1222.389) -- 0:00:39
793000 -- (-1229.447) (-1221.715) (-1224.676) [-1226.161] * (-1228.190) (-1228.655) [-1224.598] (-1226.834) -- 0:00:39
793500 -- (-1231.127) [-1223.417] (-1223.966) (-1222.962) * (-1234.128) (-1224.271) [-1221.469] (-1224.579) -- 0:00:39
794000 -- (-1226.481) [-1225.260] (-1221.259) (-1222.230) * [-1222.471] (-1224.596) (-1225.645) (-1230.271) -- 0:00:38
794500 -- (-1225.681) [-1226.516] (-1226.151) (-1223.628) * (-1227.098) (-1225.080) (-1225.253) [-1224.515] -- 0:00:38
795000 -- (-1221.581) (-1227.026) [-1221.556] (-1227.450) * (-1231.777) (-1231.166) [-1222.583] (-1222.500) -- 0:00:38
Average standard deviation of split frequencies: 0.009475
795500 -- (-1225.489) (-1221.586) [-1222.716] (-1227.016) * (-1233.394) [-1222.192] (-1227.568) (-1226.163) -- 0:00:38
796000 -- [-1223.614] (-1229.688) (-1228.812) (-1228.686) * [-1229.470] (-1223.668) (-1226.817) (-1224.662) -- 0:00:38
796500 -- (-1226.557) (-1223.823) (-1227.397) [-1224.123] * (-1224.035) (-1231.173) [-1221.881] (-1222.216) -- 0:00:38
797000 -- (-1227.309) (-1223.855) [-1230.379] (-1223.686) * (-1232.473) (-1230.987) (-1222.785) [-1229.425] -- 0:00:38
797500 -- (-1225.514) (-1227.131) [-1225.642] (-1221.744) * (-1226.540) [-1223.947] (-1219.794) (-1224.241) -- 0:00:38
798000 -- (-1228.197) (-1224.501) (-1227.021) [-1224.691] * [-1225.968] (-1227.189) (-1223.050) (-1228.106) -- 0:00:37
798500 -- [-1227.650] (-1226.074) (-1228.755) (-1223.026) * (-1223.250) (-1226.407) [-1223.142] (-1229.326) -- 0:00:38
799000 -- (-1228.543) (-1230.457) (-1231.198) [-1229.050] * (-1230.395) (-1228.664) [-1224.256] (-1228.850) -- 0:00:37
799500 -- (-1224.453) (-1227.644) (-1231.328) [-1226.879] * [-1221.579] (-1226.709) (-1223.610) (-1230.712) -- 0:00:37
800000 -- [-1222.000] (-1232.114) (-1230.275) (-1228.306) * (-1228.759) [-1223.284] (-1225.745) (-1227.379) -- 0:00:37
Average standard deviation of split frequencies: 0.008831
800500 -- [-1224.618] (-1230.078) (-1230.717) (-1241.770) * (-1226.357) (-1235.006) (-1222.425) [-1227.771] -- 0:00:37
801000 -- (-1227.220) (-1227.745) [-1228.508] (-1231.126) * [-1227.145] (-1228.895) (-1222.101) (-1229.972) -- 0:00:37
801500 -- (-1226.895) [-1232.057] (-1227.998) (-1231.029) * (-1228.765) (-1240.260) [-1227.917] (-1231.544) -- 0:00:37
802000 -- (-1228.851) (-1232.900) [-1225.087] (-1222.197) * [-1225.369] (-1229.039) (-1228.517) (-1235.258) -- 0:00:37
802500 -- (-1225.865) (-1228.192) [-1224.498] (-1226.015) * (-1233.913) (-1227.873) (-1223.495) [-1225.945] -- 0:00:37
803000 -- (-1231.132) (-1232.301) [-1225.162] (-1226.609) * (-1224.040) (-1229.151) (-1233.108) [-1224.529] -- 0:00:37
803500 -- [-1224.789] (-1223.386) (-1225.664) (-1230.237) * (-1230.793) (-1235.998) (-1231.648) [-1230.696] -- 0:00:36
804000 -- (-1223.468) (-1224.669) (-1231.597) [-1230.016] * (-1228.207) (-1233.808) [-1225.182] (-1228.385) -- 0:00:37
804500 -- [-1223.256] (-1224.793) (-1220.895) (-1232.594) * [-1222.972] (-1231.724) (-1226.975) (-1226.872) -- 0:00:36
805000 -- (-1226.855) (-1227.646) [-1223.365] (-1222.513) * [-1219.946] (-1226.494) (-1233.099) (-1229.353) -- 0:00:36
Average standard deviation of split frequencies: 0.008627
805500 -- (-1227.296) [-1222.781] (-1227.406) (-1223.765) * (-1226.528) [-1225.192] (-1231.462) (-1222.493) -- 0:00:36
806000 -- [-1224.973] (-1230.316) (-1222.631) (-1230.382) * [-1225.526] (-1225.159) (-1227.907) (-1224.344) -- 0:00:36
806500 -- (-1225.317) (-1233.351) [-1226.266] (-1228.967) * (-1222.495) [-1226.947] (-1230.597) (-1227.081) -- 0:00:36
807000 -- (-1229.482) [-1225.077] (-1232.175) (-1222.529) * [-1224.743] (-1224.043) (-1233.716) (-1225.483) -- 0:00:36
807500 -- (-1230.037) (-1222.745) (-1225.061) [-1226.368] * [-1224.593] (-1228.823) (-1231.950) (-1223.815) -- 0:00:36
808000 -- (-1226.312) (-1226.632) [-1225.504] (-1227.682) * [-1224.548] (-1226.109) (-1231.189) (-1224.454) -- 0:00:36
808500 -- [-1225.830] (-1223.733) (-1226.517) (-1224.887) * (-1225.801) (-1226.454) (-1226.785) [-1228.514] -- 0:00:36
809000 -- (-1226.663) [-1226.739] (-1223.035) (-1236.639) * (-1222.436) (-1226.881) (-1223.785) [-1223.514] -- 0:00:36
809500 -- (-1225.055) (-1230.597) [-1224.749] (-1227.026) * (-1227.658) [-1221.473] (-1221.913) (-1221.330) -- 0:00:36
810000 -- (-1227.509) (-1222.717) [-1224.115] (-1229.951) * [-1229.621] (-1222.715) (-1227.564) (-1223.820) -- 0:00:35
Average standard deviation of split frequencies: 0.008577
810500 -- (-1226.250) [-1222.560] (-1230.344) (-1231.536) * (-1227.067) (-1223.938) [-1229.774] (-1222.909) -- 0:00:35
811000 -- (-1228.967) (-1226.966) [-1228.792] (-1225.748) * (-1228.592) [-1225.440] (-1228.525) (-1228.900) -- 0:00:35
811500 -- [-1227.715] (-1223.619) (-1224.079) (-1224.889) * (-1224.751) (-1227.135) [-1230.626] (-1226.489) -- 0:00:35
812000 -- (-1228.677) (-1227.889) (-1224.717) [-1221.835] * (-1229.737) [-1233.199] (-1226.869) (-1221.674) -- 0:00:35
812500 -- (-1225.338) (-1227.636) [-1226.568] (-1230.506) * (-1222.959) [-1227.170] (-1228.847) (-1232.521) -- 0:00:35
813000 -- (-1223.707) [-1227.947] (-1226.557) (-1222.406) * [-1219.582] (-1224.372) (-1226.464) (-1232.936) -- 0:00:35
813500 -- (-1227.592) (-1229.791) [-1224.371] (-1231.875) * [-1218.801] (-1225.257) (-1223.079) (-1231.707) -- 0:00:35
814000 -- [-1228.931] (-1229.158) (-1232.475) (-1227.892) * [-1220.330] (-1230.074) (-1224.035) (-1227.478) -- 0:00:34
814500 -- [-1226.313] (-1225.625) (-1231.708) (-1226.088) * (-1226.233) (-1222.392) (-1224.075) [-1224.188] -- 0:00:35
815000 -- [-1222.367] (-1221.770) (-1230.079) (-1231.708) * (-1235.228) (-1230.058) (-1227.664) [-1220.917] -- 0:00:34
Average standard deviation of split frequencies: 0.009677
815500 -- (-1225.217) (-1220.757) (-1232.053) [-1226.969] * (-1221.714) [-1229.209] (-1233.047) (-1226.096) -- 0:00:34
816000 -- (-1227.307) (-1225.441) [-1226.207] (-1232.339) * (-1221.460) (-1226.719) [-1229.422] (-1230.615) -- 0:00:34
816500 -- (-1230.636) (-1225.052) (-1223.708) [-1230.698] * (-1225.221) [-1226.047] (-1222.633) (-1226.214) -- 0:00:34
817000 -- (-1236.106) [-1221.952] (-1230.471) (-1229.333) * [-1224.159] (-1226.160) (-1229.503) (-1229.426) -- 0:00:34
817500 -- (-1228.841) (-1230.892) [-1229.110] (-1226.031) * (-1222.978) [-1226.307] (-1231.745) (-1234.847) -- 0:00:34
818000 -- (-1224.638) [-1223.608] (-1235.109) (-1231.239) * (-1223.706) (-1229.835) [-1224.536] (-1231.645) -- 0:00:34
818500 -- (-1225.813) (-1226.469) (-1223.129) [-1224.939] * (-1229.414) (-1224.021) [-1224.123] (-1232.612) -- 0:00:34
819000 -- [-1231.605] (-1230.075) (-1227.862) (-1224.596) * (-1229.292) [-1224.568] (-1226.411) (-1222.351) -- 0:00:34
819500 -- [-1230.549] (-1228.808) (-1225.837) (-1228.284) * (-1230.121) (-1230.006) (-1224.590) [-1226.910] -- 0:00:33
820000 -- (-1222.746) (-1228.919) (-1224.700) [-1220.413] * (-1232.931) (-1234.680) (-1223.888) [-1222.933] -- 0:00:34
Average standard deviation of split frequencies: 0.009621
820500 -- (-1223.796) [-1220.812] (-1232.271) (-1223.308) * (-1230.656) (-1230.295) (-1225.123) [-1223.571] -- 0:00:33
821000 -- (-1226.149) (-1230.965) [-1228.087] (-1227.103) * (-1235.322) (-1230.830) [-1223.798] (-1230.237) -- 0:00:33
821500 -- (-1228.173) (-1227.167) (-1221.950) [-1228.441] * (-1236.536) (-1231.169) (-1225.194) [-1230.506] -- 0:00:33
822000 -- [-1224.216] (-1221.246) (-1231.230) (-1237.535) * (-1236.782) [-1221.501] (-1230.075) (-1228.768) -- 0:00:33
822500 -- [-1228.577] (-1227.347) (-1225.655) (-1228.494) * (-1229.633) [-1223.521] (-1226.325) (-1226.404) -- 0:00:33
823000 -- (-1228.353) [-1233.633] (-1226.354) (-1228.359) * (-1228.076) (-1222.761) [-1223.689] (-1229.482) -- 0:00:33
823500 -- [-1229.302] (-1225.829) (-1225.579) (-1225.511) * (-1231.901) (-1228.535) [-1221.817] (-1232.236) -- 0:00:33
824000 -- (-1226.055) (-1232.478) (-1231.461) [-1225.072] * (-1229.807) (-1229.656) (-1222.997) [-1232.906] -- 0:00:33
824500 -- (-1237.014) [-1226.185] (-1228.599) (-1232.965) * [-1223.362] (-1229.206) (-1228.580) (-1220.668) -- 0:00:32
825000 -- (-1230.858) [-1222.908] (-1229.466) (-1227.217) * (-1227.535) (-1224.850) (-1229.551) [-1224.593] -- 0:00:32
Average standard deviation of split frequencies: 0.009559
825500 -- (-1224.255) (-1222.240) [-1222.956] (-1234.250) * (-1234.679) [-1224.690] (-1232.342) (-1223.924) -- 0:00:32
826000 -- (-1222.451) (-1224.991) (-1227.389) [-1227.520] * (-1227.327) [-1221.956] (-1228.571) (-1225.437) -- 0:00:32
826500 -- (-1225.661) [-1223.095] (-1232.265) (-1221.803) * (-1226.829) [-1224.816] (-1226.105) (-1224.749) -- 0:00:32
827000 -- (-1222.624) (-1234.841) (-1225.462) [-1221.523] * [-1228.847] (-1227.156) (-1225.719) (-1228.180) -- 0:00:32
827500 -- (-1226.682) (-1237.997) [-1225.622] (-1221.963) * (-1228.501) (-1231.779) (-1222.383) [-1223.222] -- 0:00:32
828000 -- (-1229.693) (-1229.318) [-1222.105] (-1226.424) * (-1227.241) (-1224.781) (-1230.507) [-1220.106] -- 0:00:32
828500 -- (-1223.205) (-1228.240) (-1223.395) [-1221.181] * (-1228.424) [-1228.400] (-1223.888) (-1228.557) -- 0:00:32
829000 -- (-1225.324) [-1225.548] (-1224.855) (-1236.702) * (-1229.047) (-1227.216) [-1225.645] (-1223.981) -- 0:00:32
829500 -- [-1224.648] (-1227.530) (-1225.603) (-1232.540) * (-1230.160) (-1230.873) (-1222.630) [-1224.876] -- 0:00:32
830000 -- (-1226.726) (-1229.781) (-1222.037) [-1222.715] * (-1222.449) [-1231.931] (-1224.313) (-1223.979) -- 0:00:31
Average standard deviation of split frequencies: 0.008087
830500 -- (-1221.050) (-1227.023) [-1222.677] (-1225.108) * [-1229.283] (-1226.176) (-1230.754) (-1226.161) -- 0:00:32
831000 -- [-1220.214] (-1229.846) (-1226.666) (-1222.553) * (-1228.296) (-1228.755) (-1225.020) [-1222.297] -- 0:00:31
831500 -- (-1224.636) (-1241.625) (-1226.045) [-1225.396] * (-1223.837) (-1225.640) (-1229.301) [-1226.117] -- 0:00:31
832000 -- (-1224.360) (-1236.465) (-1224.936) [-1231.995] * (-1223.643) (-1234.421) [-1220.690] (-1227.266) -- 0:00:31
832500 -- (-1223.984) (-1229.563) (-1225.749) [-1228.880] * (-1230.585) [-1228.965] (-1220.610) (-1228.669) -- 0:00:31
833000 -- (-1227.650) [-1227.223] (-1223.413) (-1232.226) * (-1232.407) (-1227.568) [-1226.997] (-1224.741) -- 0:00:31
833500 -- (-1230.934) (-1224.934) [-1227.129] (-1234.661) * (-1229.205) [-1227.061] (-1225.094) (-1230.819) -- 0:00:31
834000 -- (-1226.960) (-1228.628) [-1221.148] (-1234.838) * [-1232.587] (-1230.661) (-1226.869) (-1235.588) -- 0:00:31
834500 -- [-1224.295] (-1234.935) (-1228.474) (-1233.959) * (-1227.636) [-1229.333] (-1239.713) (-1229.547) -- 0:00:31
835000 -- (-1231.203) (-1235.456) (-1224.494) [-1227.263] * (-1230.997) (-1227.693) (-1223.908) [-1226.620] -- 0:00:31
Average standard deviation of split frequencies: 0.007471
835500 -- (-1230.895) (-1230.966) [-1224.902] (-1228.340) * (-1227.262) (-1231.798) [-1225.346] (-1222.380) -- 0:00:30
836000 -- (-1235.086) (-1228.147) (-1223.398) [-1226.929] * (-1223.164) (-1230.176) (-1229.742) [-1224.634] -- 0:00:30
836500 -- (-1229.730) (-1238.811) (-1226.128) [-1227.218] * (-1224.966) (-1232.761) [-1225.212] (-1232.081) -- 0:00:30
837000 -- (-1236.767) (-1227.694) [-1223.616] (-1227.021) * (-1227.404) (-1224.875) [-1224.413] (-1240.530) -- 0:00:30
837500 -- (-1229.432) [-1223.606] (-1227.336) (-1226.578) * (-1228.850) [-1224.244] (-1226.219) (-1229.222) -- 0:00:30
838000 -- [-1221.828] (-1225.572) (-1227.483) (-1227.473) * (-1232.325) (-1230.505) (-1228.887) [-1225.459] -- 0:00:30
838500 -- (-1229.512) (-1232.973) (-1225.506) [-1225.169] * (-1224.845) (-1228.590) (-1229.746) [-1228.114] -- 0:00:30
839000 -- (-1225.769) (-1224.877) (-1226.550) [-1225.311] * (-1230.854) (-1227.147) (-1222.446) [-1226.614] -- 0:00:30
839500 -- (-1235.270) [-1223.796] (-1231.182) (-1227.179) * [-1226.276] (-1224.650) (-1224.805) (-1228.267) -- 0:00:30
840000 -- [-1227.821] (-1231.044) (-1226.842) (-1228.369) * (-1228.102) [-1226.848] (-1230.997) (-1222.798) -- 0:00:30
Average standard deviation of split frequencies: 0.008131
840500 -- (-1223.692) [-1235.498] (-1231.821) (-1227.598) * (-1230.227) (-1228.857) (-1225.302) [-1226.299] -- 0:00:29
841000 -- (-1227.930) [-1229.206] (-1225.538) (-1239.582) * (-1226.454) (-1223.977) (-1223.159) [-1226.864] -- 0:00:29
841500 -- (-1226.330) (-1227.911) (-1230.843) [-1233.085] * [-1223.260] (-1223.198) (-1226.018) (-1226.137) -- 0:00:29
842000 -- (-1226.443) [-1226.530] (-1230.674) (-1229.265) * (-1226.227) (-1225.449) [-1224.268] (-1223.684) -- 0:00:29
842500 -- (-1227.226) (-1223.881) [-1226.338] (-1229.280) * [-1225.405] (-1231.803) (-1223.710) (-1227.582) -- 0:00:29
843000 -- (-1224.697) (-1228.227) (-1230.397) [-1229.234] * (-1225.107) (-1231.244) [-1223.342] (-1221.643) -- 0:00:29
843500 -- (-1225.135) (-1225.933) [-1226.671] (-1225.151) * (-1225.630) [-1229.900] (-1228.689) (-1227.261) -- 0:00:29
844000 -- (-1227.269) (-1223.707) [-1224.479] (-1227.983) * (-1229.128) [-1225.965] (-1240.668) (-1223.539) -- 0:00:29
844500 -- (-1223.492) [-1225.038] (-1229.378) (-1233.706) * (-1228.689) (-1233.787) (-1225.035) [-1223.396] -- 0:00:29
845000 -- (-1229.560) [-1226.353] (-1227.322) (-1224.809) * (-1232.114) [-1223.779] (-1232.828) (-1222.905) -- 0:00:29
Average standard deviation of split frequencies: 0.007244
845500 -- [-1223.705] (-1225.093) (-1232.858) (-1230.319) * (-1229.088) (-1222.339) [-1225.047] (-1231.605) -- 0:00:29
846000 -- [-1233.558] (-1233.606) (-1231.689) (-1226.807) * [-1224.582] (-1225.408) (-1221.638) (-1222.772) -- 0:00:28
846500 -- (-1224.573) [-1224.591] (-1233.625) (-1226.531) * (-1223.771) [-1226.224] (-1227.434) (-1229.269) -- 0:00:29
847000 -- (-1229.053) (-1228.347) [-1234.246] (-1223.711) * (-1227.022) [-1227.872] (-1228.355) (-1226.392) -- 0:00:28
847500 -- [-1223.100] (-1231.903) (-1222.907) (-1223.085) * (-1222.526) (-1225.211) (-1225.714) [-1224.819] -- 0:00:28
848000 -- (-1220.888) (-1230.352) [-1226.834] (-1231.463) * (-1221.840) (-1229.886) (-1225.251) [-1225.228] -- 0:00:28
848500 -- (-1223.808) (-1220.833) [-1223.298] (-1222.223) * [-1225.827] (-1226.972) (-1228.295) (-1223.995) -- 0:00:28
849000 -- (-1224.875) [-1224.111] (-1231.924) (-1229.915) * (-1226.176) [-1226.763] (-1222.307) (-1224.172) -- 0:00:28
849500 -- [-1224.992] (-1224.352) (-1227.878) (-1235.446) * (-1226.115) (-1229.245) [-1228.723] (-1222.682) -- 0:00:28
850000 -- (-1227.428) (-1226.429) (-1231.708) [-1225.887] * [-1226.989] (-1228.922) (-1226.424) (-1223.192) -- 0:00:28
Average standard deviation of split frequencies: 0.006096
850500 -- (-1221.991) [-1225.846] (-1227.880) (-1231.871) * [-1223.897] (-1229.302) (-1223.640) (-1225.807) -- 0:00:28
851000 -- (-1226.825) (-1231.228) [-1224.786] (-1230.614) * [-1221.786] (-1225.409) (-1219.828) (-1225.735) -- 0:00:28
851500 -- (-1229.208) (-1230.087) (-1225.942) [-1225.895] * (-1224.718) (-1228.965) (-1224.127) [-1223.912] -- 0:00:27
852000 -- [-1227.388] (-1229.746) (-1228.573) (-1226.120) * (-1233.028) [-1230.298] (-1225.267) (-1228.573) -- 0:00:27
852500 -- (-1223.390) (-1225.789) (-1226.725) [-1222.912] * (-1229.814) [-1224.265] (-1223.182) (-1220.226) -- 0:00:27
853000 -- (-1225.101) (-1224.232) (-1238.615) [-1226.428] * [-1230.190] (-1222.393) (-1228.782) (-1225.066) -- 0:00:27
853500 -- (-1229.044) (-1227.026) [-1223.059] (-1226.132) * (-1226.812) (-1231.376) [-1223.230] (-1226.866) -- 0:00:27
854000 -- (-1221.575) (-1223.829) (-1232.253) [-1231.139] * (-1226.526) (-1228.475) [-1224.926] (-1230.623) -- 0:00:27
854500 -- [-1226.446] (-1231.184) (-1223.098) (-1225.404) * (-1226.619) (-1224.341) [-1230.676] (-1229.348) -- 0:00:27
855000 -- (-1230.050) [-1223.170] (-1230.959) (-1230.211) * (-1231.841) [-1222.078] (-1231.984) (-1224.741) -- 0:00:27
Average standard deviation of split frequencies: 0.006058
855500 -- (-1227.631) (-1223.233) [-1230.831] (-1231.288) * (-1229.337) (-1223.409) (-1225.942) [-1224.540] -- 0:00:27
856000 -- (-1229.281) [-1219.057] (-1222.463) (-1227.802) * [-1223.499] (-1229.407) (-1228.010) (-1222.804) -- 0:00:27
856500 -- (-1223.852) [-1226.323] (-1235.008) (-1234.017) * [-1223.480] (-1223.389) (-1223.947) (-1234.576) -- 0:00:26
857000 -- [-1225.280] (-1231.008) (-1224.209) (-1238.221) * (-1228.205) (-1227.397) [-1227.082] (-1235.874) -- 0:00:27
857500 -- [-1222.504] (-1223.388) (-1228.195) (-1228.421) * (-1225.215) [-1230.505] (-1222.075) (-1229.371) -- 0:00:26
858000 -- [-1226.579] (-1222.367) (-1230.678) (-1231.124) * (-1226.516) (-1232.121) (-1226.214) [-1226.245] -- 0:00:26
858500 -- [-1227.065] (-1222.480) (-1226.915) (-1226.707) * [-1226.595] (-1234.379) (-1226.980) (-1229.345) -- 0:00:26
859000 -- (-1225.234) [-1219.907] (-1231.145) (-1230.496) * (-1227.855) (-1226.670) [-1226.105] (-1231.752) -- 0:00:26
859500 -- [-1226.904] (-1229.058) (-1224.956) (-1230.781) * (-1229.461) (-1229.720) (-1233.287) [-1230.102] -- 0:00:26
860000 -- (-1233.120) (-1224.642) [-1222.086] (-1229.425) * (-1233.498) (-1226.180) (-1224.836) [-1228.854] -- 0:00:26
Average standard deviation of split frequencies: 0.006299
860500 -- (-1228.558) (-1227.770) [-1226.357] (-1227.976) * (-1228.744) [-1225.902] (-1231.532) (-1226.440) -- 0:00:26
861000 -- (-1226.577) (-1224.645) (-1223.786) [-1223.621] * (-1223.759) [-1223.833] (-1228.164) (-1224.826) -- 0:00:26
861500 -- (-1221.909) (-1228.786) [-1223.868] (-1222.076) * [-1222.885] (-1226.674) (-1227.611) (-1226.359) -- 0:00:26
862000 -- (-1225.609) (-1235.162) (-1226.223) [-1228.628] * (-1228.092) [-1226.673] (-1221.179) (-1231.201) -- 0:00:25
862500 -- (-1228.293) [-1222.887] (-1232.810) (-1223.138) * [-1223.700] (-1226.815) (-1227.450) (-1225.715) -- 0:00:25
863000 -- (-1231.435) (-1224.843) (-1226.302) [-1226.370] * [-1225.559] (-1224.292) (-1230.873) (-1224.294) -- 0:00:25
863500 -- (-1226.049) (-1224.559) (-1222.536) [-1223.251] * [-1225.729] (-1226.623) (-1228.945) (-1224.879) -- 0:00:25
864000 -- (-1229.100) [-1227.867] (-1225.086) (-1227.139) * (-1225.811) (-1225.999) (-1232.304) [-1223.478] -- 0:00:25
864500 -- (-1233.442) (-1228.641) [-1225.774] (-1228.554) * (-1224.843) (-1222.038) [-1227.120] (-1223.886) -- 0:00:25
865000 -- (-1222.903) (-1226.932) [-1224.227] (-1230.000) * (-1230.512) (-1227.255) [-1227.966] (-1231.348) -- 0:00:25
Average standard deviation of split frequencies: 0.005716
865500 -- (-1227.345) (-1223.593) (-1227.041) [-1236.775] * (-1224.554) [-1224.761] (-1230.364) (-1229.708) -- 0:00:25
866000 -- (-1235.091) [-1229.871] (-1228.939) (-1222.551) * [-1229.765] (-1227.749) (-1228.368) (-1227.279) -- 0:00:25
866500 -- (-1228.035) [-1230.410] (-1227.991) (-1223.241) * (-1226.103) (-1229.076) (-1225.027) [-1227.950] -- 0:00:25
867000 -- (-1231.238) (-1239.082) [-1228.831] (-1224.814) * (-1226.117) (-1234.298) [-1224.618] (-1229.340) -- 0:00:25
867500 -- (-1226.541) (-1225.701) (-1234.874) [-1225.292] * [-1228.023] (-1223.359) (-1225.069) (-1229.521) -- 0:00:25
868000 -- [-1227.293] (-1231.966) (-1225.207) (-1226.356) * [-1224.177] (-1227.883) (-1226.687) (-1224.052) -- 0:00:24
868500 -- [-1225.259] (-1227.830) (-1225.504) (-1225.875) * (-1232.660) (-1233.986) (-1226.601) [-1225.481] -- 0:00:24
869000 -- (-1228.737) (-1228.417) [-1224.156] (-1221.467) * (-1230.585) [-1225.248] (-1227.158) (-1227.157) -- 0:00:24
869500 -- (-1229.649) (-1231.388) (-1223.878) [-1221.607] * (-1232.086) (-1229.613) [-1221.916] (-1223.571) -- 0:00:24
870000 -- (-1229.076) (-1224.739) (-1228.388) [-1223.939] * (-1233.515) [-1225.785] (-1223.918) (-1230.930) -- 0:00:24
Average standard deviation of split frequencies: 0.006497
870500 -- (-1226.385) (-1228.700) [-1224.758] (-1230.508) * (-1229.815) [-1229.613] (-1226.738) (-1227.961) -- 0:00:24
871000 -- (-1235.993) [-1224.713] (-1225.882) (-1225.371) * (-1226.964) [-1220.400] (-1225.706) (-1222.456) -- 0:00:24
871500 -- [-1227.073] (-1227.749) (-1232.554) (-1231.641) * (-1229.399) (-1224.752) (-1222.633) [-1223.633] -- 0:00:24
872000 -- (-1230.584) [-1225.347] (-1227.330) (-1225.474) * [-1229.312] (-1223.208) (-1231.734) (-1233.091) -- 0:00:24
872500 -- (-1229.452) (-1223.877) (-1220.952) [-1224.865] * (-1226.670) (-1224.807) [-1224.236] (-1229.923) -- 0:00:23
873000 -- (-1225.484) (-1225.697) [-1227.212] (-1222.764) * [-1224.333] (-1223.024) (-1224.116) (-1225.416) -- 0:00:24
873500 -- [-1228.752] (-1226.325) (-1227.526) (-1223.983) * [-1224.903] (-1223.371) (-1232.819) (-1227.802) -- 0:00:23
874000 -- (-1225.410) (-1232.843) [-1228.396] (-1228.029) * (-1225.948) [-1226.852] (-1221.863) (-1231.872) -- 0:00:23
874500 -- (-1228.994) [-1227.220] (-1221.346) (-1229.139) * (-1225.138) (-1229.713) (-1228.359) [-1228.164] -- 0:00:23
875000 -- (-1237.783) [-1220.932] (-1230.864) (-1226.648) * (-1228.881) (-1228.547) [-1226.029] (-1227.968) -- 0:00:23
Average standard deviation of split frequencies: 0.006592
875500 -- (-1234.604) (-1219.566) (-1225.805) [-1227.470] * (-1229.980) [-1230.952] (-1224.985) (-1226.987) -- 0:00:23
876000 -- (-1231.665) (-1223.992) (-1225.263) [-1225.106] * (-1227.272) (-1231.042) (-1224.007) [-1225.796] -- 0:00:23
876500 -- [-1225.201] (-1230.486) (-1231.132) (-1224.220) * (-1230.952) [-1228.814] (-1227.237) (-1228.305) -- 0:00:23
877000 -- (-1226.607) (-1228.098) [-1223.109] (-1230.718) * (-1229.543) [-1227.702] (-1230.642) (-1224.333) -- 0:00:23
877500 -- (-1223.321) (-1231.918) [-1222.320] (-1224.168) * (-1228.156) (-1226.547) [-1221.572] (-1224.135) -- 0:00:23
878000 -- (-1223.915) [-1231.430] (-1223.015) (-1232.211) * (-1222.923) [-1223.338] (-1229.296) (-1224.731) -- 0:00:22
878500 -- (-1229.310) (-1227.948) (-1229.977) [-1232.352] * (-1225.620) (-1231.626) [-1228.090] (-1222.710) -- 0:00:22
879000 -- [-1224.323] (-1227.015) (-1235.303) (-1228.602) * (-1221.360) (-1228.455) (-1233.759) [-1227.193] -- 0:00:22
879500 -- (-1223.939) [-1225.754] (-1223.684) (-1227.488) * (-1223.955) (-1226.744) (-1229.582) [-1226.399] -- 0:00:22
880000 -- (-1226.405) (-1223.812) [-1224.305] (-1231.041) * (-1230.750) (-1229.490) [-1237.660] (-1229.808) -- 0:00:22
Average standard deviation of split frequencies: 0.006691
880500 -- [-1223.721] (-1228.287) (-1228.558) (-1227.071) * (-1225.252) (-1227.129) [-1224.632] (-1226.505) -- 0:00:22
881000 -- (-1228.953) (-1223.496) [-1226.210] (-1235.922) * (-1223.206) [-1225.491] (-1225.326) (-1225.969) -- 0:00:22
881500 -- (-1226.045) (-1224.310) (-1223.436) [-1222.782] * (-1236.564) (-1221.458) [-1231.381] (-1225.495) -- 0:00:22
882000 -- (-1230.955) (-1224.329) [-1221.088] (-1223.311) * [-1229.581] (-1222.526) (-1226.672) (-1223.937) -- 0:00:22
882500 -- (-1223.557) (-1227.245) (-1225.922) [-1224.845] * (-1226.886) (-1224.155) [-1226.829] (-1226.355) -- 0:00:22
883000 -- (-1221.657) (-1227.319) (-1225.840) [-1228.439] * (-1223.785) (-1227.718) (-1228.688) [-1225.959] -- 0:00:21
883500 -- [-1223.182] (-1225.988) (-1225.071) (-1226.376) * (-1230.637) (-1232.126) (-1224.788) [-1223.592] -- 0:00:22
884000 -- [-1225.992] (-1237.467) (-1233.835) (-1224.340) * (-1227.075) (-1225.806) (-1224.513) [-1225.718] -- 0:00:21
884500 -- (-1224.606) (-1227.830) [-1225.019] (-1230.529) * [-1223.630] (-1225.979) (-1224.373) (-1222.168) -- 0:00:21
885000 -- (-1223.649) (-1233.333) (-1228.067) [-1222.731] * (-1224.633) [-1231.758] (-1223.441) (-1229.139) -- 0:00:21
Average standard deviation of split frequencies: 0.006651
885500 -- (-1228.977) (-1228.881) (-1224.100) [-1222.073] * (-1222.344) [-1223.890] (-1224.244) (-1228.671) -- 0:00:21
886000 -- (-1234.043) [-1232.197] (-1229.821) (-1231.645) * [-1222.562] (-1227.586) (-1223.602) (-1226.784) -- 0:00:21
886500 -- [-1232.462] (-1228.137) (-1233.787) (-1231.660) * (-1225.420) (-1231.370) (-1230.280) [-1222.718] -- 0:00:21
887000 -- (-1227.941) [-1231.889] (-1222.703) (-1225.357) * [-1224.707] (-1229.759) (-1228.683) (-1226.290) -- 0:00:21
887500 -- [-1225.664] (-1235.127) (-1223.314) (-1229.272) * (-1222.271) (-1237.729) [-1224.687] (-1228.988) -- 0:00:21
888000 -- [-1223.732] (-1236.867) (-1228.747) (-1225.808) * (-1224.945) (-1234.439) [-1227.371] (-1221.648) -- 0:00:21
888500 -- (-1221.062) (-1230.932) (-1228.118) [-1227.068] * (-1232.297) (-1229.594) [-1226.259] (-1226.370) -- 0:00:21
889000 -- (-1227.288) [-1227.081] (-1230.842) (-1226.019) * (-1242.067) (-1224.462) (-1234.096) [-1225.440] -- 0:00:20
889500 -- (-1225.410) (-1230.226) [-1233.267] (-1234.443) * (-1233.527) [-1224.211] (-1236.034) (-1232.241) -- 0:00:20
890000 -- [-1225.830] (-1223.685) (-1230.682) (-1227.948) * (-1222.681) (-1221.370) [-1226.099] (-1221.890) -- 0:00:20
Average standard deviation of split frequencies: 0.005822
890500 -- (-1234.534) (-1226.031) [-1224.706] (-1223.045) * (-1226.804) (-1236.896) [-1221.994] (-1227.335) -- 0:00:20
891000 -- (-1236.784) [-1229.307] (-1228.770) (-1221.618) * [-1225.969] (-1225.356) (-1224.631) (-1223.456) -- 0:00:20
891500 -- (-1227.094) (-1232.144) (-1234.589) [-1224.431] * (-1228.299) (-1223.637) [-1224.702] (-1231.221) -- 0:00:20
892000 -- (-1226.470) (-1222.509) (-1228.024) [-1225.186] * (-1224.089) (-1228.289) [-1227.076] (-1222.466) -- 0:00:20
892500 -- (-1228.092) (-1224.139) [-1226.579] (-1230.663) * [-1224.751] (-1236.056) (-1227.865) (-1231.772) -- 0:00:20
893000 -- (-1228.933) [-1221.203] (-1233.416) (-1220.867) * [-1224.623] (-1228.312) (-1229.999) (-1232.344) -- 0:00:20
893500 -- [-1223.596] (-1223.091) (-1230.539) (-1226.559) * [-1229.575] (-1226.693) (-1226.428) (-1230.004) -- 0:00:20
894000 -- (-1228.718) [-1222.917] (-1224.241) (-1228.197) * [-1224.592] (-1232.267) (-1231.968) (-1225.066) -- 0:00:20
894500 -- (-1225.992) (-1223.434) [-1224.893] (-1233.678) * [-1225.990] (-1226.546) (-1224.570) (-1230.049) -- 0:00:19
895000 -- (-1233.023) (-1228.915) (-1223.836) [-1227.117] * [-1231.364] (-1220.996) (-1227.668) (-1227.381) -- 0:00:19
Average standard deviation of split frequencies: 0.004998
895500 -- (-1228.816) [-1222.025] (-1222.572) (-1226.028) * (-1227.336) [-1230.142] (-1229.248) (-1227.903) -- 0:00:19
896000 -- (-1226.351) [-1228.583] (-1225.856) (-1236.414) * (-1224.997) [-1226.926] (-1237.860) (-1225.365) -- 0:00:19
896500 -- (-1224.526) (-1224.876) (-1231.563) [-1228.656] * (-1224.535) (-1224.893) [-1222.822] (-1233.024) -- 0:00:19
897000 -- (-1224.697) (-1223.825) (-1231.478) [-1229.977] * (-1225.840) (-1224.357) (-1228.473) [-1226.186] -- 0:00:19
897500 -- (-1227.153) (-1232.067) [-1224.691] (-1232.157) * (-1226.357) [-1227.978] (-1231.379) (-1227.429) -- 0:00:19
898000 -- (-1229.117) (-1228.153) (-1228.195) [-1223.766] * [-1223.692] (-1229.967) (-1236.401) (-1227.307) -- 0:00:19
898500 -- (-1221.034) [-1224.110] (-1223.974) (-1221.545) * (-1225.977) (-1223.210) [-1231.491] (-1236.548) -- 0:00:19
899000 -- (-1224.105) (-1226.070) [-1225.836] (-1224.813) * (-1237.782) (-1232.963) [-1225.447] (-1230.564) -- 0:00:18
899500 -- (-1222.096) (-1225.413) (-1233.135) [-1225.306] * (-1226.253) (-1223.836) [-1223.921] (-1225.907) -- 0:00:18
900000 -- (-1227.359) (-1229.901) (-1226.482) [-1224.363] * (-1230.612) [-1221.590] (-1226.696) (-1233.837) -- 0:00:18
Average standard deviation of split frequencies: 0.005234
900500 -- (-1224.334) [-1227.618] (-1220.371) (-1231.292) * (-1227.020) [-1228.060] (-1226.074) (-1233.282) -- 0:00:18
901000 -- (-1227.339) (-1226.467) [-1231.262] (-1225.807) * (-1224.500) [-1227.921] (-1225.284) (-1237.519) -- 0:00:18
901500 -- [-1225.000] (-1230.189) (-1223.072) (-1226.221) * (-1225.012) (-1225.997) [-1224.568] (-1234.746) -- 0:00:18
902000 -- [-1220.871] (-1227.634) (-1227.806) (-1225.643) * (-1225.166) [-1225.173] (-1225.668) (-1233.645) -- 0:00:18
902500 -- (-1226.793) (-1228.860) (-1227.675) [-1226.365] * (-1224.370) [-1225.010] (-1222.680) (-1227.421) -- 0:00:18
903000 -- (-1228.160) (-1228.807) (-1222.623) [-1222.406] * (-1225.271) (-1223.527) (-1227.435) [-1226.138] -- 0:00:18
903500 -- [-1226.120] (-1220.988) (-1226.267) (-1223.664) * (-1221.938) [-1228.062] (-1228.932) (-1231.235) -- 0:00:18
904000 -- (-1227.390) (-1228.267) [-1222.517] (-1225.991) * (-1226.386) (-1226.337) (-1225.353) [-1224.856] -- 0:00:18
904500 -- (-1222.426) (-1224.911) [-1227.694] (-1224.580) * (-1224.975) [-1227.190] (-1227.605) (-1220.500) -- 0:00:18
905000 -- (-1227.337) (-1225.348) (-1224.987) [-1222.538] * (-1225.069) [-1225.721] (-1225.183) (-1221.516) -- 0:00:17
Average standard deviation of split frequencies: 0.005203
905500 -- [-1224.173] (-1224.490) (-1225.806) (-1221.815) * (-1228.927) (-1230.215) [-1221.711] (-1228.466) -- 0:00:17
906000 -- [-1228.167] (-1223.969) (-1229.906) (-1228.553) * (-1224.541) [-1224.430] (-1230.549) (-1226.129) -- 0:00:17
906500 -- (-1229.331) [-1220.492] (-1229.965) (-1227.174) * [-1227.461] (-1227.316) (-1223.723) (-1229.616) -- 0:00:17
907000 -- [-1223.801] (-1228.667) (-1230.319) (-1227.037) * (-1227.273) (-1229.906) (-1225.218) [-1224.866] -- 0:00:17
907500 -- (-1221.719) (-1221.815) (-1231.754) [-1222.726] * (-1229.572) (-1230.912) [-1226.415] (-1229.229) -- 0:00:17
908000 -- (-1234.569) (-1228.018) (-1226.045) [-1225.608] * (-1228.881) [-1222.780] (-1225.700) (-1222.934) -- 0:00:17
908500 -- (-1228.322) (-1224.806) [-1229.614] (-1224.795) * (-1227.492) (-1225.729) [-1222.814] (-1235.634) -- 0:00:17
909000 -- (-1228.509) (-1227.426) [-1226.286] (-1227.069) * (-1230.021) (-1225.244) (-1235.731) [-1234.910] -- 0:00:17
909500 -- (-1235.320) [-1229.555] (-1228.061) (-1227.346) * [-1221.990] (-1229.484) (-1226.710) (-1230.035) -- 0:00:17
910000 -- [-1228.878] (-1232.300) (-1227.857) (-1224.693) * [-1226.079] (-1225.881) (-1228.627) (-1232.491) -- 0:00:17
Average standard deviation of split frequencies: 0.004659
910500 -- [-1225.422] (-1227.865) (-1231.081) (-1222.190) * (-1228.670) (-1224.236) (-1222.657) [-1219.784] -- 0:00:16
911000 -- (-1220.156) [-1225.575] (-1228.683) (-1224.922) * (-1223.732) [-1222.780] (-1226.084) (-1226.962) -- 0:00:16
911500 -- [-1220.633] (-1224.154) (-1232.938) (-1222.726) * (-1221.951) [-1230.555] (-1227.316) (-1226.419) -- 0:00:16
912000 -- (-1222.591) (-1226.821) (-1224.791) [-1223.603] * [-1222.651] (-1231.198) (-1228.962) (-1229.623) -- 0:00:16
912500 -- (-1226.872) (-1230.837) (-1224.120) [-1225.851] * (-1226.209) (-1223.576) [-1228.078] (-1230.140) -- 0:00:16
913000 -- (-1225.810) (-1225.310) (-1221.509) [-1223.203] * [-1224.393] (-1225.857) (-1232.933) (-1224.907) -- 0:00:16
913500 -- (-1230.024) [-1223.954] (-1223.009) (-1221.988) * (-1222.988) (-1227.716) [-1226.232] (-1230.791) -- 0:00:16
914000 -- (-1225.625) [-1222.702] (-1229.199) (-1224.921) * (-1225.839) (-1229.334) [-1224.856] (-1225.420) -- 0:00:16
914500 -- (-1225.376) (-1223.629) [-1223.853] (-1225.314) * (-1226.189) [-1227.249] (-1225.210) (-1228.511) -- 0:00:16
915000 -- (-1225.479) [-1227.108] (-1223.186) (-1222.704) * (-1227.702) (-1224.869) (-1228.235) [-1223.399] -- 0:00:16
Average standard deviation of split frequencies: 0.004632
915500 -- (-1226.241) (-1225.365) (-1224.339) [-1224.640] * [-1222.545] (-1224.510) (-1234.218) (-1223.569) -- 0:00:15
916000 -- (-1230.905) [-1223.482] (-1233.746) (-1226.900) * (-1228.382) (-1227.240) (-1234.952) [-1225.084] -- 0:00:15
916500 -- [-1230.474] (-1236.600) (-1225.137) (-1225.449) * (-1238.016) (-1231.866) [-1225.055] (-1225.058) -- 0:00:15
917000 -- [-1222.639] (-1228.320) (-1225.056) (-1228.954) * (-1227.309) [-1226.977] (-1225.967) (-1223.027) -- 0:00:15
917500 -- (-1227.787) (-1230.336) (-1223.563) [-1229.949] * (-1229.779) (-1224.584) (-1232.868) [-1225.662] -- 0:00:15
918000 -- [-1225.042] (-1234.158) (-1234.504) (-1231.209) * (-1228.759) (-1230.877) (-1229.862) [-1232.938] -- 0:00:15
918500 -- (-1225.739) [-1226.908] (-1229.375) (-1223.421) * [-1226.223] (-1223.242) (-1226.944) (-1230.910) -- 0:00:15
919000 -- (-1226.666) (-1232.122) (-1224.552) [-1227.747] * (-1225.022) (-1223.424) (-1225.048) [-1226.936] -- 0:00:15
919500 -- (-1224.276) [-1227.025] (-1226.684) (-1226.303) * (-1224.278) [-1223.280] (-1228.055) (-1226.498) -- 0:00:15
920000 -- [-1224.776] (-1226.332) (-1226.600) (-1227.612) * [-1222.306] (-1224.197) (-1224.511) (-1225.541) -- 0:00:15
Average standard deviation of split frequencies: 0.005120
920500 -- (-1221.121) (-1226.970) (-1220.794) [-1227.877] * (-1227.232) (-1226.526) (-1227.945) [-1233.042] -- 0:00:15
921000 -- (-1225.265) (-1227.722) (-1224.906) [-1226.355] * (-1228.439) [-1224.605] (-1229.818) (-1231.329) -- 0:00:14
921500 -- (-1222.234) (-1230.231) (-1220.708) [-1223.949] * [-1226.260] (-1231.839) (-1223.279) (-1231.875) -- 0:00:14
922000 -- (-1230.060) (-1224.785) (-1224.741) [-1224.595] * (-1234.016) (-1226.142) (-1231.748) [-1227.442] -- 0:00:14
922500 -- [-1223.589] (-1221.561) (-1227.908) (-1228.387) * (-1230.347) [-1228.148] (-1228.030) (-1226.086) -- 0:00:14
923000 -- (-1225.457) (-1226.709) [-1228.491] (-1231.995) * (-1221.325) (-1231.109) [-1224.900] (-1226.163) -- 0:00:14
923500 -- (-1226.596) [-1224.784] (-1230.176) (-1227.615) * [-1223.745] (-1231.360) (-1226.489) (-1221.836) -- 0:00:14
924000 -- (-1231.605) (-1220.921) (-1228.649) [-1223.855] * [-1226.457] (-1226.166) (-1226.766) (-1227.443) -- 0:00:14
924500 -- (-1225.401) (-1233.931) [-1225.390] (-1224.091) * [-1229.194] (-1224.214) (-1235.807) (-1224.200) -- 0:00:14
925000 -- (-1235.883) [-1224.526] (-1225.346) (-1231.444) * (-1234.977) [-1221.351] (-1230.318) (-1225.631) -- 0:00:14
Average standard deviation of split frequencies: 0.005345
925500 -- [-1232.192] (-1226.724) (-1227.766) (-1224.409) * (-1230.798) (-1223.768) [-1222.830] (-1224.804) -- 0:00:14
926000 -- (-1223.013) (-1227.249) [-1228.942] (-1219.924) * (-1226.277) (-1228.083) [-1231.439] (-1229.664) -- 0:00:13
926500 -- [-1225.035] (-1227.730) (-1230.743) (-1217.874) * (-1225.914) [-1227.013] (-1227.227) (-1223.642) -- 0:00:13
927000 -- (-1226.724) [-1226.619] (-1228.462) (-1233.067) * (-1232.932) (-1228.465) [-1222.719] (-1227.930) -- 0:00:13
927500 -- (-1227.873) (-1226.252) [-1228.708] (-1224.320) * (-1228.273) (-1222.503) (-1228.559) [-1224.700] -- 0:00:13
928000 -- [-1228.858] (-1226.582) (-1222.065) (-1228.845) * (-1228.687) (-1225.135) [-1228.913] (-1229.842) -- 0:00:13
928500 -- [-1221.541] (-1230.901) (-1220.366) (-1230.880) * (-1229.902) (-1228.547) [-1219.971] (-1228.587) -- 0:00:13
929000 -- (-1224.060) (-1230.462) (-1225.798) [-1227.566] * (-1227.564) [-1231.894] (-1230.796) (-1221.458) -- 0:00:13
929500 -- (-1230.353) (-1231.392) [-1225.720] (-1230.455) * (-1229.139) (-1230.761) (-1228.493) [-1223.098] -- 0:00:13
930000 -- [-1231.327] (-1230.719) (-1231.788) (-1224.677) * [-1229.061] (-1235.211) (-1225.475) (-1229.609) -- 0:00:13
Average standard deviation of split frequencies: 0.005825
930500 -- [-1230.783] (-1224.459) (-1230.197) (-1227.228) * (-1230.267) [-1227.803] (-1226.140) (-1227.562) -- 0:00:13
931000 -- (-1232.744) (-1230.334) (-1236.669) [-1224.357] * (-1224.317) (-1225.928) (-1227.490) [-1223.438] -- 0:00:13
931500 -- [-1223.320] (-1224.040) (-1229.609) (-1230.934) * (-1227.162) (-1235.307) (-1221.816) [-1224.322] -- 0:00:12
932000 -- (-1226.815) (-1227.539) (-1230.285) [-1227.690] * (-1225.892) [-1232.157] (-1226.595) (-1223.410) -- 0:00:12
932500 -- (-1226.093) (-1224.927) [-1226.162] (-1225.132) * (-1227.449) (-1222.112) (-1225.525) [-1226.317] -- 0:00:12
933000 -- (-1232.161) (-1234.107) (-1227.775) [-1227.166] * (-1223.061) [-1224.866] (-1224.732) (-1228.448) -- 0:00:12
933500 -- (-1226.311) [-1224.207] (-1232.176) (-1230.941) * (-1224.911) [-1225.513] (-1222.743) (-1226.475) -- 0:00:12
934000 -- (-1227.318) (-1228.393) [-1225.015] (-1222.823) * (-1227.241) (-1229.786) (-1228.185) [-1226.241] -- 0:00:12
934500 -- (-1229.303) (-1230.432) [-1222.811] (-1225.387) * [-1222.164] (-1231.964) (-1227.013) (-1222.918) -- 0:00:12
935000 -- (-1229.157) (-1225.296) (-1226.613) [-1227.510] * [-1225.706] (-1224.633) (-1221.326) (-1230.805) -- 0:00:12
Average standard deviation of split frequencies: 0.005792
935500 -- (-1225.552) [-1232.501] (-1227.297) (-1230.210) * (-1238.586) [-1230.300] (-1227.677) (-1233.727) -- 0:00:12
936000 -- (-1244.688) [-1227.430] (-1228.260) (-1221.528) * (-1236.499) (-1228.616) [-1230.615] (-1226.481) -- 0:00:12
936500 -- (-1221.618) [-1228.133] (-1226.098) (-1222.508) * (-1227.082) (-1229.153) (-1225.011) [-1227.577] -- 0:00:12
937000 -- (-1222.986) (-1226.729) (-1230.257) [-1229.170] * [-1239.817] (-1233.871) (-1232.452) (-1229.462) -- 0:00:11
937500 -- (-1222.590) (-1226.387) [-1228.559] (-1227.408) * (-1229.917) [-1228.857] (-1225.601) (-1227.241) -- 0:00:11
938000 -- [-1225.692] (-1229.985) (-1228.153) (-1226.073) * (-1224.381) (-1223.976) [-1225.449] (-1224.113) -- 0:00:11
938500 -- (-1235.967) [-1225.370] (-1229.923) (-1229.990) * (-1230.378) (-1224.306) [-1223.595] (-1230.775) -- 0:00:11
939000 -- (-1227.711) (-1229.944) [-1226.828] (-1228.899) * (-1225.751) [-1221.283] (-1223.732) (-1232.134) -- 0:00:11
939500 -- (-1227.474) [-1233.636] (-1225.742) (-1225.415) * (-1227.330) [-1225.566] (-1221.665) (-1224.236) -- 0:00:11
940000 -- (-1221.331) (-1231.320) [-1229.709] (-1224.562) * [-1227.175] (-1223.643) (-1233.339) (-1221.330) -- 0:00:11
Average standard deviation of split frequencies: 0.006891
940500 -- (-1228.980) (-1229.965) (-1227.616) [-1221.347] * (-1230.889) [-1224.093] (-1226.885) (-1225.828) -- 0:00:11
941000 -- (-1223.671) (-1236.676) (-1231.938) [-1228.727] * (-1238.344) (-1229.785) (-1235.294) [-1224.820] -- 0:00:11
941500 -- (-1227.561) (-1226.230) (-1228.810) [-1231.513] * [-1233.529] (-1223.538) (-1234.170) (-1221.524) -- 0:00:11
942000 -- [-1225.536] (-1226.452) (-1226.523) (-1223.274) * (-1226.050) [-1226.398] (-1228.996) (-1224.768) -- 0:00:10
942500 -- (-1228.455) [-1224.211] (-1227.216) (-1231.021) * (-1231.139) (-1237.573) [-1220.829] (-1228.061) -- 0:00:10
943000 -- (-1225.034) (-1224.677) (-1221.838) [-1227.162] * (-1231.313) (-1232.729) [-1223.861] (-1223.736) -- 0:00:10
943500 -- (-1227.450) (-1228.909) [-1221.412] (-1235.020) * (-1234.412) (-1227.778) (-1222.672) [-1225.552] -- 0:00:10
944000 -- [-1227.774] (-1231.516) (-1223.660) (-1224.242) * (-1222.267) [-1224.400] (-1225.884) (-1226.251) -- 0:00:10
944500 -- (-1230.586) (-1228.732) [-1220.971] (-1225.343) * [-1226.690] (-1225.678) (-1230.575) (-1230.155) -- 0:00:10
945000 -- (-1222.641) (-1227.723) (-1227.978) [-1222.750] * (-1225.746) [-1225.994] (-1226.044) (-1228.937) -- 0:00:10
Average standard deviation of split frequencies: 0.006976
945500 -- (-1226.158) (-1223.761) (-1226.434) [-1227.083] * (-1225.822) [-1227.472] (-1231.618) (-1233.586) -- 0:00:10
946000 -- (-1223.359) (-1223.455) (-1223.003) [-1228.765] * (-1227.642) (-1224.851) [-1229.457] (-1224.337) -- 0:00:10
946500 -- (-1232.052) (-1225.068) [-1224.975] (-1221.918) * (-1226.936) (-1235.507) (-1226.247) [-1239.854] -- 0:00:10
947000 -- [-1225.849] (-1226.115) (-1223.769) (-1224.431) * (-1226.330) [-1219.623] (-1227.697) (-1229.622) -- 0:00:10
947500 -- (-1222.156) [-1221.822] (-1222.012) (-1223.072) * (-1226.200) (-1228.959) [-1225.054] (-1230.629) -- 0:00:09
948000 -- (-1228.277) (-1225.410) [-1227.604] (-1221.271) * (-1223.219) (-1225.075) (-1227.695) [-1226.873] -- 0:00:09
948500 -- (-1224.413) (-1227.889) [-1223.660] (-1226.396) * (-1228.940) [-1221.518] (-1230.427) (-1223.065) -- 0:00:09
949000 -- [-1223.585] (-1223.120) (-1224.026) (-1226.169) * (-1229.843) (-1226.860) (-1228.402) [-1232.352] -- 0:00:09
949500 -- (-1227.194) (-1227.191) [-1222.015] (-1232.826) * (-1233.966) [-1224.562] (-1239.803) (-1230.730) -- 0:00:09
950000 -- (-1234.041) (-1220.644) (-1223.466) [-1224.853] * (-1219.777) [-1232.061] (-1230.479) (-1225.250) -- 0:00:09
Average standard deviation of split frequencies: 0.006818
950500 -- (-1225.054) (-1225.443) [-1225.491] (-1226.494) * (-1225.919) [-1230.053] (-1224.517) (-1223.579) -- 0:00:09
951000 -- (-1222.376) (-1227.069) [-1220.435] (-1223.793) * (-1229.514) (-1222.785) [-1229.465] (-1222.642) -- 0:00:09
951500 -- (-1226.589) (-1222.896) [-1224.436] (-1227.779) * [-1225.481] (-1227.497) (-1228.983) (-1226.223) -- 0:00:09
952000 -- [-1221.414] (-1225.759) (-1225.474) (-1233.582) * [-1226.339] (-1226.457) (-1228.964) (-1229.702) -- 0:00:09
952500 -- [-1228.088] (-1223.538) (-1219.810) (-1232.447) * (-1225.282) [-1227.140] (-1224.104) (-1233.269) -- 0:00:08
953000 -- (-1229.245) (-1226.311) [-1222.944] (-1222.679) * (-1225.958) [-1229.522] (-1229.602) (-1229.448) -- 0:00:08
953500 -- (-1228.801) (-1226.713) (-1233.483) [-1224.508] * [-1225.292] (-1229.307) (-1227.444) (-1234.260) -- 0:00:08
954000 -- [-1227.266] (-1227.939) (-1230.431) (-1230.108) * (-1228.554) (-1228.720) (-1233.612) [-1220.954] -- 0:00:08
954500 -- (-1227.806) [-1227.145] (-1225.090) (-1225.521) * (-1228.314) [-1226.134] (-1230.167) (-1225.325) -- 0:00:08
955000 -- (-1225.098) [-1231.569] (-1227.650) (-1225.303) * (-1232.513) (-1224.143) [-1231.855] (-1231.275) -- 0:00:08
Average standard deviation of split frequencies: 0.007766
955500 -- (-1225.213) [-1224.481] (-1226.181) (-1225.001) * (-1230.302) (-1229.280) [-1228.978] (-1227.030) -- 0:00:08
956000 -- [-1224.960] (-1227.022) (-1229.214) (-1223.223) * (-1225.107) (-1222.378) [-1227.845] (-1230.343) -- 0:00:08
956500 -- [-1229.244] (-1229.322) (-1228.778) (-1231.678) * [-1229.876] (-1227.727) (-1224.694) (-1234.957) -- 0:00:08
957000 -- (-1226.880) [-1228.506] (-1235.181) (-1224.230) * (-1231.042) [-1222.234] (-1225.666) (-1224.606) -- 0:00:08
957500 -- [-1228.414] (-1225.151) (-1227.525) (-1225.881) * [-1226.271] (-1227.232) (-1231.543) (-1221.989) -- 0:00:08
958000 -- (-1231.276) (-1233.437) [-1223.776] (-1227.454) * (-1231.417) [-1226.336] (-1225.042) (-1224.058) -- 0:00:07
958500 -- (-1226.775) (-1237.713) (-1225.787) [-1224.441] * (-1228.797) [-1221.929] (-1231.086) (-1241.149) -- 0:00:07
959000 -- (-1227.185) [-1225.017] (-1224.190) (-1231.289) * (-1224.967) [-1220.208] (-1228.150) (-1228.141) -- 0:00:07
959500 -- [-1223.506] (-1230.248) (-1231.055) (-1231.845) * [-1231.642] (-1225.336) (-1226.359) (-1231.857) -- 0:00:07
960000 -- [-1229.454] (-1224.722) (-1227.320) (-1226.495) * [-1223.641] (-1224.213) (-1223.574) (-1234.191) -- 0:00:07
Average standard deviation of split frequencies: 0.007974
960500 -- (-1227.213) (-1232.209) (-1226.652) [-1224.490] * (-1228.026) (-1223.247) (-1231.874) [-1228.926] -- 0:00:07
961000 -- [-1222.403] (-1233.500) (-1228.249) (-1231.495) * [-1233.144] (-1222.001) (-1224.255) (-1226.283) -- 0:00:07
961500 -- (-1227.162) (-1241.616) [-1225.527] (-1230.761) * (-1219.469) [-1232.976] (-1225.795) (-1227.836) -- 0:00:07
962000 -- [-1226.095] (-1235.437) (-1227.088) (-1222.055) * (-1222.572) (-1232.230) (-1231.878) [-1226.000] -- 0:00:07
962500 -- (-1231.395) (-1227.044) (-1227.255) [-1227.264] * (-1227.670) (-1235.513) [-1224.874] (-1225.754) -- 0:00:07
963000 -- (-1237.396) [-1229.476] (-1229.069) (-1225.550) * (-1222.390) (-1228.470) (-1223.455) [-1227.251] -- 0:00:06
963500 -- (-1230.594) (-1229.237) [-1225.124] (-1231.254) * [-1225.519] (-1235.779) (-1228.011) (-1222.700) -- 0:00:06
964000 -- [-1226.577] (-1231.371) (-1236.288) (-1228.002) * [-1224.646] (-1234.041) (-1222.262) (-1226.298) -- 0:00:06
964500 -- (-1229.806) [-1223.145] (-1228.677) (-1224.320) * (-1228.049) [-1228.910] (-1232.379) (-1228.910) -- 0:00:06
965000 -- (-1228.517) (-1223.258) (-1234.771) [-1222.482] * [-1221.217] (-1225.895) (-1224.236) (-1227.376) -- 0:00:06
Average standard deviation of split frequencies: 0.008174
965500 -- (-1226.598) [-1221.819] (-1232.686) (-1232.112) * (-1231.819) (-1231.052) (-1226.921) [-1222.750] -- 0:00:06
966000 -- (-1227.892) (-1229.652) (-1227.428) [-1226.641] * [-1230.259] (-1232.775) (-1231.619) (-1225.103) -- 0:00:06
966500 -- (-1233.704) (-1228.076) (-1223.847) [-1229.551] * (-1226.535) (-1234.887) (-1222.323) [-1222.101] -- 0:00:06
967000 -- (-1231.004) [-1228.482] (-1220.965) (-1228.285) * (-1227.600) (-1231.806) (-1228.964) [-1225.543] -- 0:00:06
967500 -- (-1228.745) (-1229.655) (-1231.583) [-1223.432] * (-1229.475) (-1238.198) [-1222.595] (-1226.210) -- 0:00:06
968000 -- [-1225.760] (-1227.770) (-1228.359) (-1226.752) * (-1224.939) (-1236.748) (-1226.574) [-1227.865] -- 0:00:06
968500 -- [-1227.587] (-1231.002) (-1232.334) (-1221.448) * (-1226.486) (-1238.051) [-1224.781] (-1225.889) -- 0:00:05
969000 -- [-1228.842] (-1232.110) (-1226.431) (-1225.742) * [-1225.860] (-1228.146) (-1232.490) (-1226.099) -- 0:00:05
969500 -- (-1235.854) [-1220.617] (-1225.559) (-1225.634) * (-1227.161) (-1227.772) (-1225.483) [-1223.399] -- 0:00:05
970000 -- (-1224.354) (-1226.225) (-1227.245) [-1221.350] * (-1229.002) [-1228.604] (-1228.234) (-1222.815) -- 0:00:05
Average standard deviation of split frequencies: 0.008256
970500 -- (-1223.100) [-1226.516] (-1229.424) (-1221.985) * (-1224.941) (-1224.330) (-1224.035) [-1234.353] -- 0:00:05
971000 -- (-1223.867) [-1223.660] (-1231.072) (-1228.074) * (-1222.254) (-1225.883) [-1227.548] (-1228.137) -- 0:00:05
971500 -- [-1226.932] (-1225.292) (-1230.512) (-1225.366) * (-1229.647) (-1226.478) (-1222.228) [-1225.293] -- 0:00:05
972000 -- (-1229.002) [-1225.344] (-1228.615) (-1227.689) * [-1228.534] (-1234.085) (-1224.010) (-1228.659) -- 0:00:05
972500 -- [-1221.851] (-1228.353) (-1227.880) (-1222.522) * (-1237.846) [-1226.117] (-1232.629) (-1227.820) -- 0:00:05
973000 -- [-1223.488] (-1225.394) (-1222.460) (-1238.170) * (-1235.632) [-1224.466] (-1228.692) (-1225.108) -- 0:00:05
973500 -- [-1228.364] (-1227.678) (-1228.760) (-1229.711) * [-1227.281] (-1224.852) (-1223.990) (-1222.607) -- 0:00:05
974000 -- [-1226.128] (-1229.665) (-1226.242) (-1229.731) * (-1228.456) (-1229.320) [-1228.344] (-1223.849) -- 0:00:04
974500 -- (-1228.564) (-1229.225) (-1230.191) [-1223.617] * (-1232.290) (-1226.483) [-1226.074] (-1222.664) -- 0:00:04
975000 -- (-1232.377) (-1222.908) (-1222.973) [-1229.377] * (-1233.212) (-1225.570) (-1230.431) [-1222.788] -- 0:00:04
Average standard deviation of split frequencies: 0.008211
975500 -- (-1235.799) (-1223.064) [-1225.154] (-1225.655) * [-1230.558] (-1225.067) (-1226.149) (-1228.266) -- 0:00:04
976000 -- (-1223.670) (-1231.289) [-1223.970] (-1230.507) * (-1231.328) (-1223.994) [-1228.224] (-1224.875) -- 0:00:04
976500 -- [-1224.873] (-1227.024) (-1228.452) (-1225.410) * (-1231.759) [-1224.468] (-1227.467) (-1229.062) -- 0:00:04
977000 -- (-1233.863) (-1223.201) (-1223.772) [-1221.637] * (-1230.220) [-1223.925] (-1229.185) (-1226.850) -- 0:00:04
977500 -- [-1225.513] (-1227.389) (-1227.993) (-1229.754) * [-1230.916] (-1224.550) (-1234.078) (-1230.770) -- 0:00:04
978000 -- (-1234.485) (-1234.494) [-1226.554] (-1235.062) * (-1225.194) [-1223.060] (-1232.010) (-1222.341) -- 0:00:04
978500 -- [-1228.432] (-1233.584) (-1222.143) (-1227.438) * [-1222.865] (-1226.263) (-1227.677) (-1224.316) -- 0:00:04
979000 -- (-1227.711) (-1232.177) (-1221.545) [-1219.304] * [-1222.552] (-1227.681) (-1229.149) (-1224.883) -- 0:00:03
979500 -- (-1229.227) (-1231.081) (-1225.373) [-1219.597] * (-1230.610) (-1225.849) [-1228.694] (-1228.036) -- 0:00:03
980000 -- (-1223.547) (-1226.626) (-1233.267) [-1222.518] * (-1224.850) (-1231.147) [-1225.819] (-1225.157) -- 0:00:03
Average standard deviation of split frequencies: 0.007932
980500 -- (-1234.151) (-1225.728) [-1229.105] (-1220.525) * (-1229.643) (-1225.614) (-1229.915) [-1225.210] -- 0:00:03
981000 -- (-1233.432) [-1228.058] (-1227.615) (-1229.014) * (-1228.912) (-1227.296) (-1226.877) [-1223.264] -- 0:00:03
981500 -- (-1231.270) (-1225.806) [-1224.849] (-1227.782) * (-1228.990) [-1229.853] (-1229.713) (-1224.554) -- 0:00:03
982000 -- [-1226.997] (-1223.230) (-1234.884) (-1222.934) * [-1225.570] (-1231.739) (-1224.561) (-1227.054) -- 0:00:03
982500 -- (-1224.966) [-1228.433] (-1224.670) (-1227.118) * (-1230.044) [-1227.820] (-1228.843) (-1224.255) -- 0:00:03
983000 -- (-1235.635) (-1226.573) [-1220.500] (-1232.237) * (-1230.592) (-1226.178) (-1232.029) [-1222.308] -- 0:00:03
983500 -- [-1230.412] (-1232.255) (-1224.989) (-1227.748) * (-1227.174) [-1228.962] (-1233.259) (-1233.085) -- 0:00:03
984000 -- (-1227.256) (-1223.230) (-1225.124) [-1219.755] * (-1229.174) (-1226.436) [-1226.241] (-1225.169) -- 0:00:03
984500 -- [-1231.484] (-1225.578) (-1237.333) (-1234.374) * [-1222.166] (-1226.572) (-1230.053) (-1228.213) -- 0:00:02
985000 -- (-1227.205) [-1231.090] (-1231.360) (-1226.969) * (-1227.257) [-1230.155] (-1230.386) (-1227.430) -- 0:00:02
Average standard deviation of split frequencies: 0.008128
985500 -- [-1225.326] (-1226.783) (-1227.233) (-1224.919) * (-1221.827) (-1229.492) [-1223.450] (-1222.274) -- 0:00:02
986000 -- [-1228.224] (-1223.246) (-1232.984) (-1224.776) * (-1228.326) (-1233.492) [-1225.194] (-1225.017) -- 0:00:02
986500 -- (-1226.781) (-1230.903) (-1234.567) [-1225.312] * (-1223.580) [-1227.781] (-1230.919) (-1226.271) -- 0:00:02
987000 -- (-1226.160) [-1223.126] (-1224.148) (-1225.873) * (-1230.165) (-1224.964) [-1223.982] (-1224.237) -- 0:00:02
987500 -- (-1228.520) (-1229.085) (-1223.839) [-1224.700] * (-1229.571) [-1224.920] (-1223.355) (-1230.729) -- 0:00:02
988000 -- [-1232.117] (-1228.957) (-1229.245) (-1229.884) * [-1227.849] (-1223.334) (-1224.635) (-1227.893) -- 0:00:02
988500 -- (-1223.431) (-1228.757) [-1224.203] (-1221.100) * [-1224.773] (-1226.812) (-1230.288) (-1224.824) -- 0:00:02
989000 -- (-1232.845) [-1222.510] (-1222.103) (-1226.437) * (-1224.377) (-1227.472) (-1225.308) [-1220.522] -- 0:00:02
989500 -- (-1231.245) (-1226.480) [-1227.630] (-1234.121) * (-1226.659) (-1231.215) [-1229.486] (-1222.841) -- 0:00:01
990000 -- (-1229.705) [-1226.111] (-1232.635) (-1229.638) * (-1226.551) (-1229.142) [-1222.605] (-1227.197) -- 0:00:01
Average standard deviation of split frequencies: 0.008327
990500 -- [-1225.079] (-1224.138) (-1232.324) (-1224.767) * (-1238.564) (-1222.467) [-1222.341] (-1226.471) -- 0:00:01
991000 -- (-1227.935) (-1226.801) [-1226.473] (-1223.256) * (-1229.324) [-1224.066] (-1227.446) (-1225.062) -- 0:00:01
991500 -- (-1224.416) [-1224.876] (-1226.413) (-1226.516) * (-1224.638) [-1223.852] (-1231.375) (-1230.265) -- 0:00:01
992000 -- [-1225.505] (-1230.146) (-1223.678) (-1225.053) * [-1223.243] (-1223.461) (-1226.722) (-1226.067) -- 0:00:01
992500 -- (-1225.139) (-1225.185) (-1222.663) [-1225.216] * (-1225.914) (-1223.975) (-1226.284) [-1222.893] -- 0:00:01
993000 -- (-1225.712) (-1232.330) (-1231.283) [-1228.531] * (-1225.952) (-1229.075) [-1226.684] (-1227.108) -- 0:00:01
993500 -- (-1226.670) [-1230.856] (-1227.694) (-1236.338) * (-1233.704) (-1225.883) [-1228.757] (-1224.488) -- 0:00:01
994000 -- (-1223.165) (-1226.373) [-1229.498] (-1228.224) * (-1223.555) [-1225.950] (-1228.895) (-1227.368) -- 0:00:01
994500 -- (-1231.204) (-1229.725) (-1227.877) [-1226.252] * (-1224.428) (-1224.573) (-1225.856) [-1230.170] -- 0:00:01
995000 -- (-1224.401) (-1229.678) (-1228.636) [-1228.052] * (-1225.985) (-1226.690) (-1228.213) [-1229.892] -- 0:00:00
Average standard deviation of split frequencies: 0.008756
995500 -- (-1222.873) (-1235.763) (-1232.751) [-1224.247] * [-1227.819] (-1224.331) (-1227.396) (-1222.830) -- 0:00:00
996000 -- (-1229.159) [-1226.621] (-1231.474) (-1225.794) * (-1231.104) (-1227.805) [-1226.555] (-1230.466) -- 0:00:00
996500 -- (-1229.692) [-1223.838] (-1229.120) (-1226.029) * (-1223.792) (-1221.352) (-1226.539) [-1223.490] -- 0:00:00
997000 -- (-1227.084) (-1226.230) (-1227.209) [-1228.138] * (-1234.236) (-1230.434) (-1222.232) [-1220.958] -- 0:00:00
997500 -- (-1227.141) (-1226.531) (-1223.754) [-1223.795] * (-1228.434) (-1225.876) [-1223.864] (-1224.882) -- 0:00:00
998000 -- (-1229.792) (-1232.610) (-1223.167) [-1228.732] * (-1239.782) (-1228.709) (-1231.808) [-1223.808] -- 0:00:00
998500 -- (-1225.332) (-1225.627) [-1224.949] (-1230.541) * [-1224.766] (-1225.699) (-1225.764) (-1225.979) -- 0:00:00
999000 -- (-1231.370) [-1220.612] (-1223.790) (-1232.781) * (-1228.202) (-1220.732) [-1226.069] (-1223.908) -- 0:00:00
999500 -- [-1231.951] (-1230.539) (-1227.755) (-1229.206) * [-1223.843] (-1227.392) (-1224.620) (-1225.260) -- 0:00:00
1000000 -- (-1222.765) [-1220.737] (-1225.014) (-1240.053) * [-1223.494] (-1228.884) (-1227.887) (-1229.485) -- 0:00:00
Average standard deviation of split frequencies: 0.008362
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1222.765020 -- 11.034741
Chain 1 -- -1222.765020 -- 11.034741
Chain 2 -- -1220.737383 -- 10.199252
Chain 2 -- -1220.737390 -- 10.199252
Chain 3 -- -1225.013557 -- 13.791883
Chain 3 -- -1225.013557 -- 13.791883
Chain 4 -- -1240.052744 -- 11.256449
Chain 4 -- -1240.052742 -- 11.256449
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1223.494143 -- 12.865613
Chain 1 -- -1223.494142 -- 12.865613
Chain 2 -- -1228.883870 -- 12.534914
Chain 2 -- -1228.883867 -- 12.534914
Chain 3 -- -1227.886963 -- 13.364596
Chain 3 -- -1227.886964 -- 13.364596
Chain 4 -- -1229.484735 -- 11.524418
Chain 4 -- -1229.484737 -- 11.524418
Analysis completed in 3 mins 9 seconds
Analysis used 188.41 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1217.76
Likelihood of best state for "cold" chain of run 2 was -1217.32
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.1 % ( 43 %) Dirichlet(Revmat{all})
71.3 % ( 57 %) Slider(Revmat{all})
29.3 % ( 32 %) Dirichlet(Pi{all})
30.5 % ( 20 %) Slider(Pi{all})
65.1 % ( 45 %) Multiplier(Alpha{1,2})
47.3 % ( 20 %) Multiplier(Alpha{3})
67.1 % ( 37 %) Slider(Pinvar{all})
21.9 % ( 25 %) ExtSPR(Tau{all},V{all})
22.0 % ( 20 %) ExtTBR(Tau{all},V{all})
22.1 % ( 22 %) NNI(Tau{all},V{all})
17.7 % ( 20 %) ParsSPR(Tau{all},V{all})
26.4 % ( 25 %) Multiplier(V{all})
36.9 % ( 34 %) Nodeslider(V{all})
26.1 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
57.7 % ( 45 %) Dirichlet(Revmat{all})
70.7 % ( 56 %) Slider(Revmat{all})
28.9 % ( 19 %) Dirichlet(Pi{all})
31.0 % ( 28 %) Slider(Pi{all})
65.2 % ( 23 %) Multiplier(Alpha{1,2})
48.3 % ( 23 %) Multiplier(Alpha{3})
67.7 % ( 45 %) Slider(Pinvar{all})
22.0 % ( 25 %) ExtSPR(Tau{all},V{all})
21.8 % ( 25 %) ExtTBR(Tau{all},V{all})
22.2 % ( 26 %) NNI(Tau{all},V{all})
17.7 % ( 19 %) ParsSPR(Tau{all},V{all})
26.4 % ( 29 %) Multiplier(V{all})
36.7 % ( 41 %) Nodeslider(V{all})
26.1 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.57
2 | 166354 0.85 0.71
3 | 166803 166423 0.86
4 | 167052 166956 166412
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.56
2 | 166341 0.84 0.71
3 | 166487 166997 0.86
4 | 166535 166454 167186
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1224.18
| 2 |
| 1 2 |
| 1 1 1 |
| 1 2 1 2221 2|
| 1 2 2 1 * |
| 2 2 1 2 1 1 111 |
| 1* 12 11 1 11 12 2 2 211 |
|2 1 1 21 2 1 1 1 2 2 1 2 |
| 2 2 212 1 22 * 1 2 2112 2 2 2 2 1|
|1 2 1 22 2 1 12 2 1 1 |
| 1 2 1 11 2 1 1 2 2 1 1 2 |
| 2 2 1 2 2 2 |
| 2 1 1 2 1 |
| 22 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1227.69
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1223.05 -1232.03
2 -1223.08 -1234.51
--------------------------------------
TOTAL -1223.06 -1233.90
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.551914 0.007810 0.395447 0.726582 0.543081 1173.76 1284.27 1.000
r(A<->C){all} 0.076154 0.001165 0.013770 0.143467 0.072408 656.84 814.79 1.000
r(A<->G){all} 0.169494 0.002287 0.084950 0.265889 0.164477 818.74 885.02 1.000
r(A<->T){all} 0.132018 0.002010 0.048348 0.220727 0.128237 702.95 771.75 1.001
r(C<->G){all} 0.044722 0.000424 0.009307 0.087624 0.042101 990.67 1005.72 1.000
r(C<->T){all} 0.524238 0.004496 0.394796 0.656930 0.525014 791.02 831.34 1.002
r(G<->T){all} 0.053375 0.000718 0.009469 0.108650 0.049744 636.57 747.95 1.000
pi(A){all} 0.240925 0.000351 0.206515 0.279747 0.240572 1061.94 1272.45 1.000
pi(C){all} 0.235111 0.000310 0.201700 0.269150 0.234768 1038.20 1158.88 1.000
pi(G){all} 0.288607 0.000385 0.248174 0.325518 0.287983 1037.79 1190.18 1.000
pi(T){all} 0.235357 0.000308 0.201405 0.268592 0.234814 1276.75 1285.76 1.002
alpha{1,2} 0.052730 0.001276 0.000215 0.118040 0.047936 1212.54 1303.79 1.000
alpha{3} 2.013788 0.566903 0.762891 3.505539 1.906073 1447.87 1454.94 1.000
pinvar{all} 0.250327 0.008970 0.060288 0.428598 0.254233 1403.30 1433.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ..**.
7 -- ..***
8 -- .*..*
9 -- .***.
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 2979 0.992338 0.003298 0.990007 0.994670 2
7 1881 0.626582 0.006124 0.622252 0.630913 2
8 704 0.234510 0.015075 0.223851 0.245170 2
9 417 0.138907 0.008951 0.132578 0.145237 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.060857 0.000319 0.028805 0.096545 0.058935 1.000 2
length{all}[2] 0.016640 0.000104 0.000394 0.036725 0.014992 1.000 2
length{all}[3] 0.061977 0.000424 0.026472 0.103724 0.059376 1.000 2
length{all}[4] 0.070338 0.000499 0.029522 0.113849 0.067301 1.000 2
length{all}[5] 0.269199 0.004015 0.161923 0.396003 0.261211 1.000 2
length{all}[6] 0.053016 0.000522 0.011744 0.098338 0.050584 1.000 2
length{all}[7] 0.025246 0.000312 0.000050 0.059582 0.021956 1.000 2
length{all}[8] 0.011759 0.000086 0.000200 0.031558 0.009872 1.001 2
length{all}[9] 0.011243 0.000155 0.000029 0.030854 0.007769 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008362
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
+ /------------------------ C3 (3)
| /-----------99----------+
| | \------------------------ C4 (4)
\-----------63----------+
\------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/--------------- C1 (1)
|
|---- C2 (2)
|
+ /---------------- C3 (3)
| /-----------+
| | \------------------ C4 (4)
\-----+
\------------------------------------------------------------------ C5 (5)
|-----------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (5 trees sampled):
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 489
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
6 ambiguity characters in seq. 2
12 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
4 sites are removed. 13 14 162 163
Sequences read..
Counting site patterns.. 0:00
114 patterns at 159 / 159 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
111264 bytes for conP
15504 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 109
166896 bytes for conP, adjusted
0.107560 0.035359 0.036204 0.080404 0.106671 0.118424 0.402590 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1309.734297
Iterating by ming2
Initial: fx= 1309.734297
x= 0.10756 0.03536 0.03620 0.08040 0.10667 0.11842 0.40259 0.30000 1.30000
1 h-m-p 0.0000 0.0032 182.8631 ++++CYCCC 1272.940967 4 0.0027 25 | 0/9
2 h-m-p 0.0011 0.0070 443.3204 YYCCCCC 1258.177052 6 0.0010 47 | 0/9
3 h-m-p 0.0004 0.0018 221.8378 +YCYCCC 1229.931009 5 0.0016 68 | 0/9
4 h-m-p 0.0000 0.0001 2845.4020 +YYCCC 1223.826122 4 0.0000 87 | 0/9
5 h-m-p 0.0002 0.0009 154.9850 ++ 1217.075118 m 0.0009 99 | 0/9
6 h-m-p 0.0000 0.0000 725.8937
h-m-p: 7.03623770e-21 3.51811885e-20 7.25893713e+02 1217.075118
.. | 0/9
7 h-m-p 0.0000 0.0039 802.1987 +YCYCCC 1207.289616 5 0.0001 129 | 0/9
8 h-m-p 0.0004 0.0021 126.9072 +CYCCCC 1187.446113 5 0.0018 151 | 0/9
9 h-m-p 0.0003 0.0013 232.6435 ++ 1161.476949 m 0.0013 163 | 0/9
10 h-m-p 0.0000 0.0000 2229.1319
h-m-p: 1.91661802e-21 9.58309011e-21 2.22913186e+03 1161.476949
.. | 0/9
11 h-m-p 0.0000 0.0014 457.9472 ++CCCCC 1152.913469 4 0.0001 194 | 0/9
12 h-m-p 0.0003 0.0016 97.0454 CYCCCC 1150.195430 5 0.0005 215 | 0/9
13 h-m-p 0.0018 0.0089 23.7922 YC 1149.957799 1 0.0009 228 | 0/9
14 h-m-p 0.0021 0.0310 10.6005 YCC 1149.883353 2 0.0016 243 | 0/9
15 h-m-p 0.0010 0.0077 16.8564 CCC 1149.833675 2 0.0009 259 | 0/9
16 h-m-p 0.0041 0.1039 3.5401 CC 1149.827594 1 0.0012 273 | 0/9
17 h-m-p 0.0031 0.7461 1.3763 ++C 1149.788712 0 0.0486 287 | 0/9
18 h-m-p 0.0024 0.0537 27.7244 CCC 1149.756424 2 0.0021 303 | 0/9
19 h-m-p 0.2969 1.4847 0.0941 --C 1149.756338 0 0.0045 317 | 0/9
20 h-m-p 0.0130 4.7495 0.0326 ++C 1149.742797 0 0.2075 340 | 0/9
21 h-m-p 1.6000 8.0000 0.0019 YC 1149.737391 1 3.2448 362 | 0/9
22 h-m-p 1.4152 8.0000 0.0043 YC 1149.737094 1 1.1089 384 | 0/9
23 h-m-p 1.6000 8.0000 0.0005 Y 1149.737090 0 0.9942 405 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 Y 1149.737090 0 1.0238 426 | 0/9
25 h-m-p 1.6000 8.0000 0.0000 Y 1149.737090 0 0.4000 447 | 0/9
26 h-m-p 0.5807 8.0000 0.0000 Y 1149.737090 0 0.5807 468 | 0/9
27 h-m-p 1.2138 8.0000 0.0000 Y 1149.737090 0 1.2138 489 | 0/9
28 h-m-p 1.6000 8.0000 0.0000 --C 1149.737090 0 0.0250 512
Out..
lnL = -1149.737090
513 lfun, 513 eigenQcodon, 3591 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 109
0.107560 0.035359 0.036204 0.080404 0.106671 0.118424 0.402590 1.665043 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.599837
np = 10
lnL0 = -1206.735098
Iterating by ming2
Initial: fx= 1206.735098
x= 0.10756 0.03536 0.03620 0.08040 0.10667 0.11842 0.40259 1.66504 0.57321 0.49224
1 h-m-p 0.0000 0.0050 93.5271 +++++ 1185.984351 m 0.0050 18 | 0/10
2 h-m-p 0.0000 0.0000 2260.6009
h-m-p: 5.03802922e-21 2.51901461e-20 2.26060091e+03 1185.984351
.. | 0/10
3 h-m-p 0.0000 0.0015 288.9097 +++CYYYCC 1168.096645 5 0.0011 52 | 0/10
4 h-m-p 0.0001 0.0004 191.0565 YCYCCC 1164.611049 5 0.0002 73 | 0/10
5 h-m-p 0.0004 0.0031 89.4626 +CYCCC 1155.880503 4 0.0023 95 | 0/10
6 h-m-p 0.0003 0.0016 48.2841 YCCC 1155.189265 3 0.0008 113 | 0/10
7 h-m-p 0.0014 0.0141 25.7029 YC 1154.354612 1 0.0036 127 | 0/10
8 h-m-p 0.0049 0.0245 16.1214 YCC 1154.177641 2 0.0020 143 | 0/10
9 h-m-p 0.0087 0.1373 3.6517 YCC 1154.140602 2 0.0038 159 | 0/10
10 h-m-p 0.0041 0.2125 3.4212 ++YYCC 1153.542165 3 0.0536 178 | 0/10
11 h-m-p 0.0013 0.0156 138.8702 +CYCCC 1149.984428 4 0.0088 199 | 0/10
12 h-m-p 0.0083 0.0414 7.7750 YCC 1149.861753 2 0.0049 215 | 0/10
13 h-m-p 0.0328 0.3749 1.1697 ++ 1147.094410 m 0.3749 228 | 0/10
14 h-m-p 0.0892 0.4460 1.8544 +YCCC 1144.530343 3 0.2368 247 | 0/10
15 h-m-p 0.2149 1.1350 2.0435 CCCC 1142.613266 3 0.2434 266 | 0/10
16 h-m-p 1.3248 6.6239 0.1934 YCCC 1142.369118 3 0.7187 284 | 0/10
17 h-m-p 0.7273 8.0000 0.1911 YCC 1142.330770 2 0.3953 310 | 0/10
18 h-m-p 1.6000 8.0000 0.0184 YC 1142.321411 1 0.9546 334 | 0/10
19 h-m-p 1.6000 8.0000 0.0084 CC 1142.319836 1 0.6353 359 | 0/10
20 h-m-p 1.6000 8.0000 0.0012 CC 1142.318292 1 1.8686 384 | 0/10
21 h-m-p 1.6000 8.0000 0.0012 YC 1142.317841 1 1.0001 408 | 0/10
22 h-m-p 1.3236 8.0000 0.0009 C 1142.317807 0 1.1252 431 | 0/10
23 h-m-p 1.6000 8.0000 0.0001 Y 1142.317805 0 0.9635 454 | 0/10
24 h-m-p 1.6000 8.0000 0.0000 Y 1142.317805 0 0.8089 477 | 0/10
25 h-m-p 1.4103 8.0000 0.0000 C 1142.317805 0 1.1292 500 | 0/10
26 h-m-p 1.6000 8.0000 0.0000 Y 1142.317805 0 1.2319 523 | 0/10
27 h-m-p 1.6000 8.0000 0.0000 C 1142.317805 0 0.4000 546 | 0/10
28 h-m-p 0.6420 8.0000 0.0000 C 1142.317805 0 0.6111 569 | 0/10
29 h-m-p 1.6000 8.0000 0.0000 ----C 1142.317805 0 0.0016 596
Out..
lnL = -1142.317805
597 lfun, 1791 eigenQcodon, 8358 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 109
initial w for M2:NSpselection reset.
0.107560 0.035359 0.036204 0.080404 0.106671 0.118424 0.402590 1.738340 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.038172
np = 12
lnL0 = -1215.769986
Iterating by ming2
Initial: fx= 1215.769986
x= 0.10756 0.03536 0.03620 0.08040 0.10667 0.11842 0.40259 1.73834 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0083 101.1836 +++++ 1201.247131 m 0.0083 20 | 0/12
2 h-m-p 0.0017 0.0083 48.6896 CYCC 1199.520976 3 0.0019 40 | 0/12
3 h-m-p 0.0002 0.0009 251.8127 ++ 1193.468077 m 0.0009 55 | 1/12
4 h-m-p 0.0012 0.0059 41.3679 ++ 1188.952157 m 0.0059 70 | 1/12
5 h-m-p 0.0094 0.0512 25.9693 YCCCC 1181.650873 4 0.0222 92 | 1/12
6 h-m-p 0.0032 0.0162 39.3589 YCYCCCC 1177.101294 6 0.0071 117 | 0/12
7 h-m-p 0.0007 0.0036 146.5793 CCCCC 1175.515695 4 0.0010 140 | 0/12
8 h-m-p 0.0011 0.0055 77.5166 +YYCYCC 1169.381999 5 0.0038 163 | 0/12
9 h-m-p 0.0022 0.0112 21.7696 CCCCC 1168.654127 4 0.0026 186 | 0/12
10 h-m-p 0.0199 0.2065 2.8676 +YYCCC 1167.071422 4 0.0668 208 | 0/12
11 h-m-p 0.0077 0.0619 24.9815 +YCYCCC 1156.246813 5 0.0430 232 | 0/12
12 h-m-p 0.0896 0.4478 3.5734 CYCCC 1152.543674 4 0.1642 254 | 0/12
13 h-m-p 0.2623 1.3117 2.2177 YCCCCC 1146.755408 5 0.6885 278 | 0/12
14 h-m-p 0.3102 1.5509 1.5171 CCCC 1144.232667 3 0.3333 299 | 0/12
15 h-m-p 0.1314 0.6572 2.4606 CCCC 1143.455458 3 0.1387 320 | 0/12
16 h-m-p 0.5975 2.9875 0.5558 CCCC 1143.005733 3 0.6309 341 | 0/12
17 h-m-p 0.7238 5.0622 0.4845 YCCC 1142.833790 3 0.4480 373 | 0/12
18 h-m-p 0.4812 3.5368 0.4511 CCC 1142.735362 2 0.5221 404 | 0/12
19 h-m-p 0.4153 2.4562 0.5671 YCCC 1142.604419 3 0.8145 436 | 0/12
20 h-m-p 0.5572 2.7861 0.3165 YC 1142.467417 1 1.3714 464 | 0/12
21 h-m-p 0.2390 1.1949 0.3857 +YC 1142.358832 1 1.0060 493 | 0/12
22 h-m-p 1.6000 8.0000 0.1282 YCC 1142.328003 2 0.8996 523 | 0/12
23 h-m-p 0.1551 0.7756 0.1573 ++ 1142.318743 m 0.7756 550 | 1/12
24 h-m-p 1.6000 8.0000 0.0070 YC 1142.317861 1 0.8117 578 | 1/12
25 h-m-p 1.1016 8.0000 0.0052 YC 1142.317809 1 0.7473 605 | 1/12
26 h-m-p 1.6000 8.0000 0.0011 Y 1142.317805 0 0.6502 631 | 1/12
27 h-m-p 1.6000 8.0000 0.0002 Y 1142.317805 0 0.9346 657 | 1/12
28 h-m-p 1.6000 8.0000 0.0000 Y 1142.317805 0 0.9913 683 | 1/12
29 h-m-p 1.6000 8.0000 0.0000 Y 1142.317805 0 0.8902 709 | 1/12
30 h-m-p 1.6000 8.0000 0.0000 Y 1142.317805 0 2.6711 735 | 1/12
31 h-m-p 1.6000 8.0000 0.0000 Y 1142.317805 0 0.9786 761 | 1/12
32 h-m-p 1.6000 8.0000 0.0000 -------Y 1142.317805 0 0.0000 794
Out..
lnL = -1142.317805
795 lfun, 3180 eigenQcodon, 16695 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1151.433484 S = -1095.139110 -47.609670
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 114 patterns 0:11
did 20 / 114 patterns 0:11
did 30 / 114 patterns 0:11
did 40 / 114 patterns 0:11
did 50 / 114 patterns 0:11
did 60 / 114 patterns 0:11
did 70 / 114 patterns 0:11
did 80 / 114 patterns 0:11
did 90 / 114 patterns 0:12
did 100 / 114 patterns 0:12
did 110 / 114 patterns 0:12
did 114 / 114 patterns 0:12
Time used: 0:12
Model 3: discrete
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 109
0.107560 0.035359 0.036204 0.080404 0.106671 0.118424 0.402590 1.738340 0.331355 0.382499 0.041709 0.104124 0.174343
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.329372
np = 13
lnL0 = -1149.318517
Iterating by ming2
Initial: fx= 1149.318517
x= 0.10756 0.03536 0.03620 0.08040 0.10667 0.11842 0.40259 1.73834 0.33136 0.38250 0.04171 0.10412 0.17434
1 h-m-p 0.0000 0.0009 72.4614 ++++ 1146.397289 m 0.0009 20 | 1/13
2 h-m-p 0.0007 0.0037 37.8754 CCC 1145.780713 2 0.0012 40 | 1/13
3 h-m-p 0.0003 0.0015 72.3915 YCCCC 1145.036437 4 0.0007 63 | 1/13
4 h-m-p 0.0001 0.0006 77.6815 +CCC 1144.568290 2 0.0005 84 | 1/13
5 h-m-p 0.0017 0.0513 23.5120 CYC 1144.293215 2 0.0019 103 | 1/13
6 h-m-p 0.0418 0.2350 1.0636 YC 1144.284408 1 0.0066 120 | 1/13
7 h-m-p 0.0016 0.6205 4.4422 +++YYC 1143.772164 2 0.0876 141 | 0/13
8 h-m-p 0.0080 0.0429 48.5144 -YCC 1143.722179 2 0.0008 161 | 0/13
9 h-m-p 0.0009 0.0221 44.7809 +CYC 1143.522753 2 0.0033 181 | 0/13
10 h-m-p 0.0060 0.0371 24.7652 CY 1143.476903 1 0.0015 199 | 0/13
11 h-m-p 0.1755 1.6529 0.2062 YC 1143.328845 1 0.4205 216 | 0/13
12 h-m-p 0.0014 0.0071 37.7351 YCCC 1143.155354 3 0.0027 250 | 0/13
13 h-m-p 0.3886 8.0000 0.2639 +YCC 1143.041459 2 1.2749 270 | 0/13
14 h-m-p 0.1994 6.5735 1.6873 CCCC 1142.876644 3 0.3300 305 | 0/13
15 h-m-p 0.9219 8.0000 0.6040 YYCC 1142.764532 3 0.8667 325 | 0/13
16 h-m-p 1.0853 5.4266 0.1844 CCCC 1142.581552 3 1.3737 360 | 0/13
17 h-m-p 1.3519 8.0000 0.1874 CCC 1142.483648 2 1.8494 393 | 0/13
18 h-m-p 1.6000 8.0000 0.1459 CCCC 1142.384411 3 1.9389 428 | 0/13
19 h-m-p 1.6000 8.0000 0.1722 CYC 1142.331160 2 1.5150 460 | 0/13
20 h-m-p 0.8523 4.2615 0.1025 YC 1142.321639 1 0.4382 490 | 0/13
21 h-m-p 1.0129 8.0000 0.0443 CC 1142.317910 1 1.1701 521 | 0/13
22 h-m-p 1.6000 8.0000 0.0170 C 1142.317394 0 1.6433 550 | 0/13
23 h-m-p 1.6000 8.0000 0.0034 YC 1142.316291 1 3.8258 580 | 0/13
24 h-m-p 1.4505 8.0000 0.0089 YC 1142.314346 1 3.2246 610 | 0/13
25 h-m-p 1.6000 8.0000 0.0078 C 1142.314051 0 1.3562 639 | 0/13
26 h-m-p 1.6000 8.0000 0.0021 C 1142.314021 0 1.3620 668 | 0/13
27 h-m-p 1.6000 8.0000 0.0001 Y 1142.314021 0 0.9892 697 | 0/13
28 h-m-p 1.6000 8.0000 0.0000 Y 1142.314021 0 0.9944 726 | 0/13
29 h-m-p 1.6000 8.0000 0.0000 Y 1142.314021 0 0.9340 755 | 0/13
30 h-m-p 1.6000 8.0000 0.0000 Y 1142.314021 0 2.6250 784 | 0/13
31 h-m-p 1.6000 8.0000 0.0000 --C 1142.314021 0 0.0250 815
Out..
lnL = -1142.314021
816 lfun, 3264 eigenQcodon, 17136 P(t)
Time used: 0:19
Model 7: beta
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 109
0.107560 0.035359 0.036204 0.080404 0.106671 0.118424 0.402590 1.733004 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.913519
np = 10
lnL0 = -1163.084437
Iterating by ming2
Initial: fx= 1163.084437
x= 0.10756 0.03536 0.03620 0.08040 0.10667 0.11842 0.40259 1.73300 0.66567 1.54913
1 h-m-p 0.0000 0.0075 74.1457 +++YCYCCC 1160.584693 5 0.0012 26 | 0/10
2 h-m-p 0.0007 0.0033 73.9462 +CCYC 1155.075044 3 0.0026 45 | 0/10
3 h-m-p 0.0001 0.0003 451.9771 ++ 1150.921309 m 0.0003 58 | 0/10
4 h-m-p 0.0001 0.0004 838.6471 CYCCCC 1147.003646 5 0.0002 81 | 0/10
5 h-m-p 0.0003 0.0015 20.0992 ++ 1146.722453 m 0.0015 94 | 0/10
6 h-m-p -0.0000 -0.0000 6.7656
h-m-p: -1.70400115e-18 -8.52000573e-18 6.76564207e+00 1146.722453
.. | 0/10
7 h-m-p 0.0000 0.0063 122.7810 ++YCYCCC 1144.460404 5 0.0004 127 | 0/10
8 h-m-p 0.0004 0.0020 49.2910 YCCCC 1143.432160 4 0.0009 147 | 0/10
9 h-m-p 0.0003 0.0017 81.0008 CYC 1143.011216 2 0.0003 163 | 0/10
10 h-m-p 0.0038 0.0189 6.4491 CC 1142.986206 1 0.0012 178 | 0/10
11 h-m-p 0.0029 0.2444 2.7853 CC 1142.972963 1 0.0040 193 | 0/10
12 h-m-p 0.0072 0.4002 1.5650 CC 1142.970836 1 0.0023 208 | 0/10
13 h-m-p 0.0030 1.4765 1.4780 +CC 1142.961428 1 0.0157 224 | 0/10
14 h-m-p 0.0020 0.1537 11.8110 +CCC 1142.916289 2 0.0095 242 | 0/10
15 h-m-p 0.0131 0.0653 7.9343 -CC 1142.912646 1 0.0012 258 | 0/10
16 h-m-p 0.0186 3.1466 0.5208 +++YCCC 1142.815998 3 0.8001 279 | 0/10
17 h-m-p 1.6000 8.0000 0.0224 YC 1142.813745 1 0.7870 303 | 0/10
18 h-m-p 1.6000 8.0000 0.0072 YC 1142.813492 1 0.7634 327 | 0/10
19 h-m-p 1.2562 8.0000 0.0043 C 1142.813445 0 1.2670 350 | 0/10
20 h-m-p 1.6000 8.0000 0.0028 Y 1142.813433 0 0.9801 373 | 0/10
21 h-m-p 1.6000 8.0000 0.0001 C 1142.813433 0 1.3130 396 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 1142.813433 0 1.0708 419 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 C 1142.813433 0 1.5114 442 | 0/10
24 h-m-p 1.6000 8.0000 0.0000 ---Y 1142.813433 0 0.0063 468
Out..
lnL = -1142.813433
469 lfun, 5159 eigenQcodon, 32830 P(t)
Time used: 0:30
Model 8: beta&w>1
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 109
initial w for M8:NSbetaw>1 reset.
0.107560 0.035359 0.036204 0.080404 0.106671 0.118424 0.402590 1.715531 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.377286
np = 12
lnL0 = -1164.003950
Iterating by ming2
Initial: fx= 1164.003950
x= 0.10756 0.03536 0.03620 0.08040 0.10667 0.11842 0.40259 1.71553 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0008 164.1371 ++++ 1151.473127 m 0.0008 19 | 1/12
2 h-m-p 0.0003 0.0016 77.4595 +CYC 1147.588101 2 0.0014 39 | 1/12
3 h-m-p 0.0002 0.0010 245.9500 YCYCCC 1144.422226 5 0.0005 62 | 1/12
4 h-m-p 0.0014 0.0071 31.4670 YCC 1144.094794 2 0.0009 80 | 0/12
5 h-m-p 0.0005 0.0066 50.6166 YCCC 1143.826487 3 0.0003 100 | 0/12
6 h-m-p 0.0035 0.0703 4.9246 YCC 1143.755330 2 0.0059 118 | 0/12
7 h-m-p 0.0047 0.0767 6.0790 CYC 1143.708624 2 0.0044 136 | 0/12
8 h-m-p 0.0044 0.1058 6.0650 YC 1143.618160 1 0.0103 152 | 0/12
9 h-m-p 0.0024 0.0532 25.9515 +CYC 1143.289395 2 0.0095 171 | 0/12
10 h-m-p 0.0251 0.1256 2.2132 -YC 1143.284206 1 0.0027 188 | 0/12
11 h-m-p 0.0027 0.4186 2.1968 +++YCCC 1142.795849 3 0.2738 211 | 0/12
12 h-m-p 0.2191 1.0955 0.5162 CCC 1142.744676 2 0.2313 230 | 0/12
13 h-m-p 1.1556 8.0000 0.1033 YCC 1142.707805 2 0.7323 260 | 0/12
14 h-m-p 1.6000 8.0000 0.0418 C 1142.697814 0 1.6000 287 | 0/12
15 h-m-p 1.6000 8.0000 0.0343 YC 1142.688858 1 3.1584 315 | 0/12
16 h-m-p 1.2842 8.0000 0.0843 +CC 1142.658885 1 4.4381 345 | 0/12
17 h-m-p 0.8735 4.3677 0.2367 +CC 1142.595328 1 3.5749 375 | 0/12
18 h-m-p 1.6000 8.0000 0.1726 CC 1142.576860 1 1.3036 404 | 0/12
19 h-m-p 0.2959 1.4797 0.1981 +CC 1142.562755 1 1.1264 434 | 0/12
20 h-m-p 0.7200 8.0000 0.3100 +YCC 1142.518660 2 3.9872 465 | 0/12
21 h-m-p 0.1965 0.9827 0.4015 ++ 1142.497938 m 0.9827 492 | 1/12
22 h-m-p 0.1725 8.0000 2.2857 +CC 1142.475949 1 0.7535 522 | 1/12
23 h-m-p 1.2848 8.0000 1.3404 CYC 1142.437085 2 1.3954 540 | 1/12
24 h-m-p 1.0636 8.0000 1.7585 YC 1142.406371 1 2.2297 556 | 1/12
25 h-m-p 1.6000 8.0000 1.7253 +YCCC 1142.374511 3 4.8675 577 | 1/12
26 h-m-p 1.6000 8.0000 4.0357 CC 1142.358913 1 1.5391 594 | 1/12
27 h-m-p 1.6000 8.0000 3.0774 YCC 1142.349954 2 3.0170 612 | 1/12
28 h-m-p 1.2370 8.0000 7.5059 YC 1142.340724 1 1.9781 628 | 1/12
29 h-m-p 1.4416 7.2079 6.6124 +YC 1142.334772 1 3.7079 645 | 1/12
30 h-m-p 0.4097 2.0484 11.2984 ++ 1142.331125 m 2.0484 660 | 2/12
31 h-m-p 0.1598 0.7990 5.3998 -YC 1142.329215 1 0.0163 677 | 2/12
32 h-m-p 1.6000 8.0000 0.0037 YC 1142.329022 1 0.9749 693 | 2/12
33 h-m-p 1.6000 8.0000 0.0010 Y 1142.329019 0 1.0847 718 | 2/12
34 h-m-p 1.6000 8.0000 0.0000 Y 1142.329019 0 0.9749 743 | 2/12
35 h-m-p 1.6000 8.0000 0.0000 Y 1142.329019 0 1.1046 768 | 2/12
36 h-m-p 1.6000 8.0000 0.0000 Y 1142.329019 0 1.0123 793
Out..
lnL = -1142.329019
794 lfun, 9528 eigenQcodon, 61138 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1152.107163 S = -1095.163322 -49.080847
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 114 patterns 0:53
did 20 / 114 patterns 0:53
did 30 / 114 patterns 0:53
did 40 / 114 patterns 0:53
did 50 / 114 patterns 0:53
did 60 / 114 patterns 0:54
did 70 / 114 patterns 0:54
did 80 / 114 patterns 0:54
did 90 / 114 patterns 0:54
did 100 / 114 patterns 0:54
did 110 / 114 patterns 0:54
did 114 / 114 patterns 0:55
Time used: 0:55
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=5, Len=163
D_melanogaster_CG6421-PA MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
D_simulans_CG6421-PA MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
D_yakuba_CG6421-PA MRVFLRYFVYLL--LSPALVQGQGHVLDKPVTELCLTCICEAISGCNATA
D_erecta_CG6421-PA MRFFLRYFVYLQLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA
D_suzukii_CG6421-PA MRVFLGYFLFLLLVLSPSLVQGQGHVLDKPVTEKCLTCICEAISGCNATA
**.** * ::* ***:*************** ****************
D_melanogaster_CG6421-PA ICTSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCAKDPHCAA
D_simulans_CG6421-PA ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
D_yakuba_CG6421-PA ICTSTEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA
D_erecta_CG6421-PA ICTSPEKGTCGIFRITWGYWVDAGKLTVNGENPDSDNAFINCANDPHCAA
D_suzukii_CG6421-PA ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFVNCANDPHCAA
****.***:**********************:***::**:***:******
D_melanogaster_CG6421-PA DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
D_simulans_CG6421-PA DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
D_yakuba_CG6421-PA DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE
D_erecta_CG6421-PA DLVQNYMKKFNQDCNDDGQMDCHDYARIHKLGAYGCQADMPYKFQSVFEE
D_suzukii_CG6421-PA DLVQNYMKKFNQDCNEDGEMDCHDYARIHKLGAYGCQADMPYTFQSVFEE
***************:**:***********************.*******
D_melanogaster_CG6421-PA CIERYEDEGFE--
D_simulans_CG6421-PA CIEKYEDEGFQ--
D_yakuba_CG6421-PA CIEKYEDEGFQoo
D_erecta_CG6421-PA CIEKYEDKGFQ--
D_suzukii_CG6421-PA CIEKFEDEGLE--
***::**:*::
>D_melanogaster_CG6421-PA ATGCGAGTTTTCCTGCTATATTCCATATATTTGCTGCTGGTGCTGTCGCC TTCATTGGTTCAAGGCCAAGGTCATGTGCTGGATAAGCCGGTAACGGAGC TGTGTCTCACCTGCATTTGTGAGGCCATTAGTGGTTGCAATGCCACGGCG ATTTGCACCAGTGCGGAAAAGGGAGCATGCGGCATATTCCGCATCACCTG GGGATACTGGGTGGATGCTGGCAAACTGACGGTAAATGGAGAGCATCCCG ATTCGGAAAAGGCTTTCATCAACTGCGCCAAGGATCCGCACTGTGCCGCC GATTTGGTGCAAAACTATATGAAGAAGTTCAATCAGGATTGCAATGATGA TGGTGAGATGGATTGCCACGATTATGCTCGAATCCATAAACTGGGGGCTT ATGGCTGCCAAGCGGACATGCCCTACAATTTCCAGAGTGTGTTCGAGGAG TGCATCGAGAGGTACGAGGATGAGGGATTTGAG------ >D_simulans_CG6421-PA ATGCGAGTTTTCCTGCTATATTCTATATATCTGCTGCTGGTACTGTCGCC TTCATTGGTTCAAGGCCAAGGTCATGTGCTGGATAAACCCGTAACGGAGC TGTGTCTCACCTGCATTTGTGAGGCCATCAGTGGCTGCAATGCCACAGCG ATTTGCACCAGTCCGGAAAAGGGAACCTGCGGCATATTCCGCATCACCTG GGGATACTGGGTGGATGCTGGCAAGCTGACGGTTAATGGAGAGCATCCCG ATTCGGAAAAGGCCTTCATCAACTGCGCCAATGATCCGCACTGTGCCGCC GACTTGGTGCAAAACTATATGAAGAAGTTCAATCAGGATTGCAACGATGA TGGCGAGATGGATTGCCACGATTATGCTCGAATCCATAAACTGGGGGCTT ATGGCTGCCAAGCGGATATGCCCTACAAATTCCAGAGTGTGTTCGAGGAG TGCATCGAGAAGTACGAGGATGAGGGATTTCAG------ >D_yakuba_CG6421-PA ATGCGAGTTTTTCTGCGTTATTTTGTATATCTGCTG------CTGTCGCC TGCATTGGTACAAGGCCAAGGTCATGTGTTGGATAAGCCCGTAACGGAGC TGTGCCTCACCTGCATTTGTGAGGCCATCAGTGGCTGTAATGCCACGGCG ATTTGCACCAGTACGGAAAAGGGAGCATGCGGCATATTTCGCATCACCTG GGGATATTGGGTGGATGCAGGCAAACTGACAGTCAATGGAGAGCATCCCG ATTCGGAGAAGGCCTTCATCAACTGCGCCAATGATCCGCACTGTGCCGCC GACTTGGTGCAGAACTACATGAAGAAGTTCAATCAGGACTGCAACGATGA TGGCGAGATGGATTGCCATGATTATGCTCGAATCCATAAATTGGGCGCCT ATGGCTGTCAAGCAGACATGCCATACAATTTCCAAAGTGTGTTCGAGGAG TGTATCGAGAAGTACGAGGATGAGGGATTTCAG------ >D_erecta_CG6421-PA ATGCGATTTTTTCTGCGCTATTTTGTATATCTGCAGCTGGTGCTGTCGCC TTCATTGGTACAAGGCCAAGGTCATGTGCTGGATAAACCCGTAACGGAGC TGTGTCTCACCTGCATTTGTGAGGCCATCAGTGGCTGTAATGCCACGGCG ATTTGCACTAGTCCGGAAAAGGGAACCTGCGGCATATTCCGCATCACCTG GGGATATTGGGTGGATGCTGGAAAACTGACAGTGAATGGAGAGAACCCCG ATTCGGATAACGCCTTTATCAACTGCGCCAATGATCCGCATTGTGCCGCC GACTTGGTGCAAAACTACATGAAGAAGTTCAATCAGGACTGCAATGATGA TGGCCAGATGGATTGCCATGATTATGCCCGAATCCATAAATTGGGCGCTT ATGGCTGTCAAGCGGACATGCCCTACAAATTCCAAAGTGTGTTTGAGGAG TGCATCGAGAAGTACGAGGATAAGGGATTTCAG------ >D_suzukii_CG6421-PA ATGAGAGTTTTCTTGGGATATTTCCTTTTCTTACTGCTGGTTCTATCGCC TTCATTAGTGCAAGGTCAAGGTCATGTGCTGGATAAACCCGTAACGGAGA AGTGCCTCACGTGCATTTGCGAGGCAATCAGCGGCTGCAATGCCACGGCG ATTTGCACCAGTCCGGAAAAGGGAACCTGCGGCATTTTCCGCATCACCTG GGGCTACTGGGTGGATGCAGGCAAGCTGACTGTCAACGGAGAGCATCCCG ACTCGGAAAAGGCCTTCGTCAACTGTGCCAATGATCCGCACTGCGCCGCC GACTTGGTGCAGAACTACATGAAGAAGTTCAACCAGGACTGCAATGAGGA TGGCGAGATGGATTGCCACGACTATGCCCGAATCCACAAATTGGGGGCTT ATGGCTGTCAAGCGGACATGCCCTATACTTTTCAGAGCGTGTTCGAGGAG TGCATCGAGAAATTCGAGGATGAGGGCTTGGAG------
>D_melanogaster_CG6421-PA MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA ICTSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCAKDPHCAA DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE CIERYEDEGFE >D_simulans_CG6421-PA MRVFLLYSIYLLLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYKFQSVFEE CIEKYEDEGFQ >D_yakuba_CG6421-PA MRVFLRYFVYLL--LSPALVQGQGHVLDKPVTELCLTCICEAISGCNATA ICTSTEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKAFINCANDPHCAA DLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEE CIEKYEDEGFQ >D_erecta_CG6421-PA MRFFLRYFVYLQLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATA ICTSPEKGTCGIFRITWGYWVDAGKLTVNGENPDSDNAFINCANDPHCAA DLVQNYMKKFNQDCNDDGQMDCHDYARIHKLGAYGCQADMPYKFQSVFEE CIEKYEDKGFQ >D_suzukii_CG6421-PA MRVFLGYFLFLLLVLSPSLVQGQGHVLDKPVTEKCLTCICEAISGCNATA ICTSPEKGTCGIFRITWGYWVDAGKLTVNGEHPDSEKAFVNCANDPHCAA DLVQNYMKKFNQDCNEDGEMDCHDYARIHKLGAYGCQADMPYTFQSVFEE CIEKFEDEGLE
#NEXUS
[ID: 2273098199]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_CG6421-PA
D_simulans_CG6421-PA
D_yakuba_CG6421-PA
D_erecta_CG6421-PA
D_suzukii_CG6421-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG6421-PA,
2 D_simulans_CG6421-PA,
3 D_yakuba_CG6421-PA,
4 D_erecta_CG6421-PA,
5 D_suzukii_CG6421-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05893513,2:0.01499187,((3:0.05937614,4:0.067301)0.992:0.0505844,5:0.2612105)0.627:0.02195585);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05893513,2:0.01499187,((3:0.05937614,4:0.067301):0.0505844,5:0.2612105):0.02195585);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1223.05 -1232.03
2 -1223.08 -1234.51
--------------------------------------
TOTAL -1223.06 -1233.90
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/176/CG6421-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.551914 0.007810 0.395447 0.726582 0.543081 1173.76 1284.27 1.000
r(A<->C){all} 0.076154 0.001165 0.013770 0.143467 0.072408 656.84 814.79 1.000
r(A<->G){all} 0.169494 0.002287 0.084950 0.265889 0.164477 818.74 885.02 1.000
r(A<->T){all} 0.132018 0.002010 0.048348 0.220727 0.128237 702.95 771.75 1.001
r(C<->G){all} 0.044722 0.000424 0.009307 0.087624 0.042101 990.67 1005.72 1.000
r(C<->T){all} 0.524238 0.004496 0.394796 0.656930 0.525014 791.02 831.34 1.002
r(G<->T){all} 0.053375 0.000718 0.009469 0.108650 0.049744 636.57 747.95 1.000
pi(A){all} 0.240925 0.000351 0.206515 0.279747 0.240572 1061.94 1272.45 1.000
pi(C){all} 0.235111 0.000310 0.201700 0.269150 0.234768 1038.20 1158.88 1.000
pi(G){all} 0.288607 0.000385 0.248174 0.325518 0.287983 1037.79 1190.18 1.000
pi(T){all} 0.235357 0.000308 0.201405 0.268592 0.234814 1276.75 1285.76 1.002
alpha{1,2} 0.052730 0.001276 0.000215 0.118040 0.047936 1212.54 1303.79 1.000
alpha{3} 2.013788 0.566903 0.762891 3.505539 1.906073 1447.87 1454.94 1.000
pinvar{all} 0.250327 0.008970 0.060288 0.428598 0.254233 1403.30 1433.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/176/CG6421-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 159
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 4 6 1 | Ser TCT 0 1 0 0 0 | Tyr TAT 5 5 5 5 4 | Cys TGT 3 3 5 5 2
TTC 6 6 4 3 8 | TCC 1 0 0 0 0 | TAC 3 3 3 3 2 | TGC 9 9 7 7 10
Leu TTA 0 0 0 0 2 | TCA 1 1 0 1 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 3 2 4 3 4 | TCG 2 2 2 2 2 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 1 | Pro CCT 1 1 1 1 1 | His CAT 3 3 4 4 2 | Arg CGT 0 0 1 0 0
CTC 1 1 1 1 1 | CCC 2 3 2 3 3 | CAC 2 2 1 0 3 | CGC 1 1 1 2 1
CTA 1 1 0 0 1 | CCA 0 0 1 0 0 | Gln CAA 4 4 4 5 3 | CGA 2 2 2 2 1
CTG 7 8 6 6 3 | CCG 2 2 1 2 2 | CAG 2 3 3 4 3 | CGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 2 2 3 | Thr ACT 0 0 0 1 2 | Asn AAT 5 4 5 5 3 | Ser AGT 3 3 3 3 1
ATC 4 5 5 5 4 | ACC 3 4 3 3 3 | AAC 2 3 3 4 4 | AGC 0 0 0 0 2
ATA 2 2 1 1 0 | ACA 0 1 1 1 0 | Lys AAA 2 3 2 4 3 | Arg AGA 0 0 0 0 1
Met ATG 4 4 4 4 4 | ACG 3 2 3 2 3 | AAG 6 6 6 5 6 | AGG 1 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 2 3 1 0 1 | Ala GCT 4 3 1 2 1 | Asp GAT 11 11 9 10 6 | Gly GGT 3 1 1 1 2
GTC 0 0 1 0 2 | GCC 5 6 7 7 6 | GAC 1 1 3 3 5 | GGC 4 6 7 6 7
GTA 2 1 3 3 1 | GCA 1 0 4 0 2 | Glu GAA 2 2 1 1 2 | GGA 4 4 4 5 3
GTG 4 4 4 5 5 | GCG 3 2 1 2 2 | GAG 10 9 10 7 11 | GGG 1 1 0 0 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG6421-PA
position 1: T:0.22642 C:0.17610 A:0.23899 G:0.35849
position 2: T:0.25157 C:0.17610 A:0.36478 G:0.20755
position 3: T:0.27673 C:0.27673 A:0.13208 G:0.31447
Average T:0.25157 C:0.20964 A:0.24528 G:0.29350
#2: D_simulans_CG6421-PA
position 1: T:0.22013 C:0.19497 A:0.24528 G:0.33962
position 2: T:0.25157 C:0.17610 A:0.37107 G:0.20126
position 3: T:0.25786 C:0.31447 A:0.13208 G:0.29560
Average T:0.24319 C:0.22851 A:0.24948 G:0.27883
#3: D_yakuba_CG6421-PA
position 1: T:0.22642 C:0.17610 A:0.23899 G:0.35849
position 2: T:0.25157 C:0.16981 A:0.37107 G:0.20755
position 3: T:0.26415 C:0.30189 A:0.14465 G:0.28931
Average T:0.24738 C:0.21593 A:0.25157 G:0.28512
#4: D_erecta_CG6421-PA
position 1: T:0.23270 C:0.18868 A:0.25157 G:0.32704
position 2: T:0.24528 C:0.16981 A:0.37736 G:0.20755
position 3: T:0.28302 C:0.29560 A:0.14465 G:0.27673
Average T:0.25367 C:0.21803 A:0.25786 G:0.27044
#5: D_suzukii_CG6421-PA
position 1: T:0.23899 C:0.15723 A:0.24528 G:0.35849
position 2: T:0.25786 C:0.17610 A:0.35849 G:0.20755
position 3: T:0.18868 C:0.38365 A:0.12579 G:0.30189
Average T:0.22851 C:0.23899 A:0.24319 G:0.28931
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 13 | Ser S TCT 1 | Tyr Y TAT 24 | Cys C TGT 18
TTC 27 | TCC 1 | TAC 14 | TGC 42
Leu L TTA 2 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 16 | TCG 10 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 5 | His H CAT 16 | Arg R CGT 1
CTC 5 | CCC 13 | CAC 8 | CGC 6
CTA 3 | CCA 1 | Gln Q CAA 20 | CGA 9
CTG 30 | CCG 9 | CAG 15 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 3 | Asn N AAT 22 | Ser S AGT 13
ATC 23 | ACC 16 | AAC 16 | AGC 2
ATA 6 | ACA 3 | Lys K AAA 14 | Arg R AGA 1
Met M ATG 20 | ACG 13 | AAG 29 | AGG 1
------------------------------------------------------------------------------
Val V GTT 7 | Ala A GCT 11 | Asp D GAT 47 | Gly G GGT 8
GTC 3 | GCC 31 | GAC 13 | GGC 30
GTA 10 | GCA 7 | Glu E GAA 8 | GGA 20
GTG 22 | GCG 10 | GAG 47 | GGG 3
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22893 C:0.17862 A:0.24403 G:0.34843
position 2: T:0.25157 C:0.17358 A:0.36855 G:0.20629
position 3: T:0.25409 C:0.31447 A:0.13585 G:0.29560
Average T:0.24486 C:0.22222 A:0.24948 G:0.28344
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG6421-PA
D_simulans_CG6421-PA 0.1015 (0.0163 0.1602)
D_yakuba_CG6421-PA 0.0519 (0.0217 0.4184) 0.0538 (0.0190 0.3526)
D_erecta_CG6421-PA 0.1135 (0.0440 0.3874) 0.0923 (0.0272 0.2946) 0.1235 (0.0299 0.2420)
D_suzukii_CG6421-PA 0.0643 (0.0440 0.6843) 0.0614 (0.0370 0.6021) 0.0495 (0.0383 0.7729) 0.0665 (0.0509 0.7652)
Model 0: one-ratio
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 109
lnL(ntime: 7 np: 9): -1149.737090 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.120158 0.026673 0.068454 0.056526 0.115179 0.125660 0.389514 1.665043 0.083418
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.90216
(1: 0.120158, 2: 0.026673, ((3: 0.115179, 4: 0.125660): 0.056526, 5: 0.389514): 0.068454);
(D_melanogaster_CG6421-PA: 0.120158, D_simulans_CG6421-PA: 0.026673, ((D_yakuba_CG6421-PA: 0.115179, D_erecta_CG6421-PA: 0.125660): 0.056526, D_suzukii_CG6421-PA: 0.389514): 0.068454);
Detailed output identifying parameters
kappa (ts/tv) = 1.66504
omega (dN/dS) = 0.08342
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.120 368.2 108.8 0.0834 0.0114 0.1369 4.2 14.9
6..2 0.027 368.2 108.8 0.0834 0.0025 0.0304 0.9 3.3
6..7 0.068 368.2 108.8 0.0834 0.0065 0.0780 2.4 8.5
7..8 0.057 368.2 108.8 0.0834 0.0054 0.0644 2.0 7.0
8..3 0.115 368.2 108.8 0.0834 0.0109 0.1313 4.0 14.3
8..4 0.126 368.2 108.8 0.0834 0.0119 0.1432 4.4 15.6
7..5 0.390 368.2 108.8 0.0834 0.0370 0.4439 13.6 48.3
tree length for dN: 0.0858
tree length for dS: 1.0281
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 109
lnL(ntime: 7 np: 10): -1142.317805 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.130224 0.022703 0.069680 0.062084 0.123121 0.126943 0.422221 1.738340 0.930626 0.039715
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95698
(1: 0.130224, 2: 0.022703, ((3: 0.123121, 4: 0.126943): 0.062084, 5: 0.422221): 0.069680);
(D_melanogaster_CG6421-PA: 0.130224, D_simulans_CG6421-PA: 0.022703, ((D_yakuba_CG6421-PA: 0.123121, D_erecta_CG6421-PA: 0.126943): 0.062084, D_suzukii_CG6421-PA: 0.422221): 0.069680);
Detailed output identifying parameters
kappa (ts/tv) = 1.73834
dN/dS (w) for site classes (K=2)
p: 0.93063 0.06937
w: 0.03971 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.130 367.2 109.8 0.1063 0.0148 0.1391 5.4 15.3
6..2 0.023 367.2 109.8 0.1063 0.0026 0.0242 0.9 2.7
6..7 0.070 367.2 109.8 0.1063 0.0079 0.0744 2.9 8.2
7..8 0.062 367.2 109.8 0.1063 0.0071 0.0663 2.6 7.3
8..3 0.123 367.2 109.8 0.1063 0.0140 0.1315 5.1 14.4
8..4 0.127 367.2 109.8 0.1063 0.0144 0.1356 5.3 14.9
7..5 0.422 367.2 109.8 0.1063 0.0479 0.4509 17.6 49.5
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 109
lnL(ntime: 7 np: 12): -1142.317805 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.130224 0.022703 0.069680 0.062084 0.123121 0.126943 0.422221 1.738340 0.930626 0.057861 0.039715 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95698
(1: 0.130224, 2: 0.022703, ((3: 0.123121, 4: 0.126943): 0.062084, 5: 0.422221): 0.069680);
(D_melanogaster_CG6421-PA: 0.130224, D_simulans_CG6421-PA: 0.022703, ((D_yakuba_CG6421-PA: 0.123121, D_erecta_CG6421-PA: 0.126943): 0.062084, D_suzukii_CG6421-PA: 0.422221): 0.069680);
Detailed output identifying parameters
kappa (ts/tv) = 1.73834
dN/dS (w) for site classes (K=3)
p: 0.93063 0.05786 0.01151
w: 0.03971 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.130 367.2 109.8 0.1063 0.0148 0.1391 5.4 15.3
6..2 0.023 367.2 109.8 0.1063 0.0026 0.0242 0.9 2.7
6..7 0.070 367.2 109.8 0.1063 0.0079 0.0744 2.9 8.2
7..8 0.062 367.2 109.8 0.1063 0.0071 0.0663 2.6 7.3
8..3 0.123 367.2 109.8 0.1063 0.0140 0.1315 5.1 14.4
8..4 0.127 367.2 109.8 0.1063 0.0144 0.1356 5.3 14.9
7..5 0.422 367.2 109.8 0.1063 0.0479 0.4509 17.6 49.5
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG6421-PA)
Pr(w>1) post mean +- SE for w
6 L 0.587 1.706 +- 1.303
9 I 0.513 1.490 +- 1.023
141 N 0.614 1.665 +- 0.962
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.615 0.226 0.077 0.032 0.017 0.011 0.008 0.006 0.005 0.005
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.025 0.966
sum of density on p0-p1 = 1.000000
Time used: 0:12
Model 3: discrete (3 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 109
lnL(ntime: 7 np: 13): -1142.314021 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.129902 0.022787 0.069633 0.061895 0.122881 0.126811 0.421302 1.733004 0.450231 0.477453 0.038841 0.038841 0.949834
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95521
(1: 0.129902, 2: 0.022787, ((3: 0.122881, 4: 0.126811): 0.061895, 5: 0.421302): 0.069633);
(D_melanogaster_CG6421-PA: 0.129902, D_simulans_CG6421-PA: 0.022787, ((D_yakuba_CG6421-PA: 0.122881, D_erecta_CG6421-PA: 0.126811): 0.061895, D_suzukii_CG6421-PA: 0.421302): 0.069633);
Detailed output identifying parameters
kappa (ts/tv) = 1.73300
dN/dS (w) for site classes (K=3)
p: 0.45023 0.47745 0.07232
w: 0.03884 0.03884 0.94983
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.130 367.2 109.8 0.1047 0.0146 0.1393 5.4 15.3
6..2 0.023 367.2 109.8 0.1047 0.0026 0.0244 0.9 2.7
6..7 0.070 367.2 109.8 0.1047 0.0078 0.0747 2.9 8.2
7..8 0.062 367.2 109.8 0.1047 0.0070 0.0664 2.6 7.3
8..3 0.123 367.2 109.8 0.1047 0.0138 0.1318 5.1 14.5
8..4 0.127 367.2 109.8 0.1047 0.0142 0.1360 5.2 14.9
7..5 0.421 367.2 109.8 0.1047 0.0473 0.4519 17.4 49.6
Naive Empirical Bayes (NEB) analysis
Time used: 0:19
Model 7: beta (10 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 109
lnL(ntime: 7 np: 10): -1142.813433 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.126301 0.024028 0.068605 0.060617 0.120216 0.125450 0.410955 1.715531 0.136115 1.214946
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.93617
(1: 0.126301, 2: 0.024028, ((3: 0.120216, 4: 0.125450): 0.060617, 5: 0.410955): 0.068605);
(D_melanogaster_CG6421-PA: 0.126301, D_simulans_CG6421-PA: 0.024028, ((D_yakuba_CG6421-PA: 0.120216, D_erecta_CG6421-PA: 0.125450): 0.060617, D_suzukii_CG6421-PA: 0.410955): 0.068605);
Detailed output identifying parameters
kappa (ts/tv) = 1.71553
Parameters in M7 (beta):
p = 0.13611 q = 1.21495
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00003 0.00034 0.00214 0.00935 0.03203 0.09273 0.23969 0.58986
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.126 367.5 109.5 0.0966 0.0134 0.1385 4.9 15.2
6..2 0.024 367.5 109.5 0.0966 0.0025 0.0263 0.9 2.9
6..7 0.069 367.5 109.5 0.0966 0.0073 0.0752 2.7 8.2
7..8 0.061 367.5 109.5 0.0966 0.0064 0.0665 2.4 7.3
8..3 0.120 367.5 109.5 0.0966 0.0127 0.1318 4.7 14.4
8..4 0.125 367.5 109.5 0.0966 0.0133 0.1375 4.9 15.1
7..5 0.411 367.5 109.5 0.0966 0.0435 0.4506 16.0 49.3
Time used: 0:30
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 109
lnL(ntime: 7 np: 12): -1142.329019 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.130153 0.022685 0.069649 0.062045 0.123060 0.126850 0.421915 1.736735 0.931902 4.227288 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95636
(1: 0.130153, 2: 0.022685, ((3: 0.123060, 4: 0.126850): 0.062045, 5: 0.421915): 0.069649);
(D_melanogaster_CG6421-PA: 0.130153, D_simulans_CG6421-PA: 0.022685, ((D_yakuba_CG6421-PA: 0.123060, D_erecta_CG6421-PA: 0.126850): 0.062045, D_suzukii_CG6421-PA: 0.421915): 0.069649);
Detailed output identifying parameters
kappa (ts/tv) = 1.73673
Parameters in M8 (beta&w>1):
p0 = 0.93190 p = 4.22729 q = 99.00000
(p1 = 0.06810) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09319 0.09319 0.09319 0.09319 0.09319 0.09319 0.09319 0.09319 0.09319 0.09319 0.06810
w: 0.01479 0.02169 0.02670 0.03123 0.03571 0.04042 0.04569 0.05204 0.06072 0.07714 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.130 367.2 109.8 0.1059 0.0147 0.1392 5.4 15.3
6..2 0.023 367.2 109.8 0.1059 0.0026 0.0243 0.9 2.7
6..7 0.070 367.2 109.8 0.1059 0.0079 0.0745 2.9 8.2
7..8 0.062 367.2 109.8 0.1059 0.0070 0.0663 2.6 7.3
8..3 0.123 367.2 109.8 0.1059 0.0139 0.1316 5.1 14.4
8..4 0.127 367.2 109.8 0.1059 0.0144 0.1356 5.3 14.9
7..5 0.422 367.2 109.8 0.1059 0.0478 0.4511 17.5 49.5
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG6421-PA)
Pr(w>1) post mean +- SE for w
6 L 0.686 1.546 +- 1.144
9 I 0.608 1.364 +- 1.006
141 N 0.797 1.681 +- 0.954
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.002 0.014 0.049 0.108 0.186 0.275 0.367
ws: 0.687 0.210 0.060 0.021 0.009 0.005 0.003 0.002 0.002 0.002
Time used: 0:55
Model 1: NearlyNeutral -1142.317805 Model 2: PositiveSelection -1142.317805 Model 0: one-ratio -1149.73709 Model 3: discrete -1142.314021 Model 7: beta -1142.813433 Model 8: beta&w>1 -1142.329019 Model 0 vs 1 14.838570000000345 Model 2 vs 1 0.0 Model 8 vs 7 0.9688280000000304
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
