--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 08 10:00:12 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/171/CG5783-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2132.34 -2142.07
2 -2132.08 -2140.29
--------------------------------------
TOTAL -2132.20 -2141.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.398826 0.003930 0.285083 0.522553 0.390663 981.36 1146.17 1.000
r(A<->C){all} 0.054093 0.000558 0.010339 0.100130 0.051956 845.92 942.39 1.000
r(A<->G){all} 0.273057 0.002259 0.189289 0.374165 0.270419 809.19 887.35 1.000
r(A<->T){all} 0.096206 0.000690 0.048363 0.147941 0.094515 923.51 931.13 1.000
r(C<->G){all} 0.078816 0.000614 0.031767 0.126020 0.077431 912.54 998.68 1.000
r(C<->T){all} 0.460920 0.003371 0.353784 0.579082 0.460301 826.82 841.62 1.000
r(G<->T){all} 0.036908 0.000345 0.002472 0.072354 0.034545 993.21 1000.76 1.002
pi(A){all} 0.267943 0.000198 0.241156 0.294808 0.267595 1258.16 1289.79 1.000
pi(C){all} 0.224327 0.000177 0.199433 0.251083 0.224333 1032.22 1149.19 1.000
pi(G){all} 0.261935 0.000201 0.233164 0.288810 0.262194 972.68 1052.99 1.000
pi(T){all} 0.245795 0.000186 0.219840 0.272478 0.245278 1091.12 1132.96 1.000
alpha{1,2} 0.127572 0.007008 0.000196 0.269962 0.121075 813.70 841.17 1.001
alpha{3} 1.348165 0.401093 0.385434 2.574776 1.224848 1156.06 1219.98 1.001
pinvar{all} 0.273197 0.016628 0.039348 0.511955 0.272184 762.56 806.21 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2051.183392
Model 2: PositiveSelection -2050.034048
Model 0: one-ratio -2063.709282
Model 3: discrete -2050.034048
Model 7: beta -2052.518274
Model 8: beta&w>1 -2050.055066
Model 0 vs 1 25.05177999999978
Model 2 vs 1 2.2986879999998564
Model 8 vs 7 4.926416000000245
>C1
MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLK
CSSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPS
NKPSSEMFSKLGFQVIDQCYWLRTEPTGGQFTWPEGE
>C2
MGTRLEVIGLKDVQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKADDALKLRVEPPTGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
NKPSSGMFSKLGFQVIDQCFWLRTEPTEGQFTWPEGE
>C3
MGTRLEVIGLKDIQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKAEDALKLRVEPPTGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
NKPSSGMFSKLGFQVIEQCFWLRTEPTEGQFTWPEGE
>C4
MGTRLEVIGLKDIQQFQQLYKQNWPKYCQEYYCLDNFVSFLKKQPHMRNI
QMYTLDTKQARDEGLFVIVDRYQLFVGCLTNTNGLVRSALELLDWSTGLK
CSSIPSRHIDALDGLVESKRLELVFRDYTNLYFMKAEDALKLKVEPPDGF
VLRPLSVADAPLVNDEWPNHHVGSLFFIERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKALHKRRGFGSVVTREIAYRLAAEGHDVMALVGPL
NKPSSEMFSKLGFQVIDQCLWLRTEPTRGEFTWPEGE
>C5
MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
DMYTLDTKQARDEGLFVIVDRYQLFVGCLNNSSGLARTALDLLDWSTGLK
CSSVPSRHMDALDSVVESKKLDLVFRDCTNLFYMKAEDALKLKVEPPVGF
VLKSLSVADAPLINEEWPNHHVGSLFFIERQIRLCISAGLYQEDTQELVA
WCIRSQGGFLGTLQVKDSHKRRGFGSVVTREMAYRIAAQGHDVMALVNPC
NKPSSEMFSKLGFQVIDQCYWLRTEPTSGEFTWPEGE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=287
C1 MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
C2 MGTRLEVIGLKDVQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
C3 MGTRLEVIGLKDIQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
C4 MGTRLEVIGLKDIQQFQQLYKQNWPKYCQEYYCLDNFVSFLKKQPHMRNI
C5 MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
************:*:*******.***************.***********
C1 KMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLK
C2 KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
C3 KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
C4 QMYTLDTKQARDEGLFVIVDRYQLFVGCLTNTNGLVRSALELLDWSTGLK
C5 DMYTLDTKQARDEGLFVIVDRYQLFVGCLNNSSGLARTALDLLDWSTGLK
.*****:**********************.*:.**. .**:*****:***
C1 CSSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGF
C2 CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKADDALKLRVEPPTGF
C3 CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKAEDALKLRVEPPTGF
C4 CSSIPSRHIDALDGLVESKRLELVFRDYTNLYFMKAEDALKLKVEPPDGF
C5 CSSVPSRHMDALDSVVESKKLDLVFRDCTNLFYMKAEDALKLKVEPPVGF
***:****:.***.:****:*:**:** ***::***:*****:**** **
C1 VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
C2 VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
C3 VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
C4 VLRPLSVADAPLVNDEWPNHHVGSLFFIERQIRLCVSVGLYQEDTQELVA
C5 VLKSLSVADAPLINEEWPNHHVGSLFFIERQIRLCISAGLYQEDTQELVA
**:.********:* ****** *****:*******:*.************
C1 WCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPS
C2 WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
C3 WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
C4 WCIRLQGGYLGALQVKALHKRRGFGSVVTREIAYRLAAEGHDVMALVGPL
C5 WCIRSQGGFLGTLQVKDSHKRRGFGSVVTREMAYRIAAQGHDVMALVNPC
**** ***:**:**** *************:***:*.:********.*
C1 NKPSSEMFSKLGFQVIDQCYWLRTEPTGGQFTWPEGE
C2 NKPSSGMFSKLGFQVIDQCFWLRTEPTEGQFTWPEGE
C3 NKPSSGMFSKLGFQVIEQCFWLRTEPTEGQFTWPEGE
C4 NKPSSEMFSKLGFQVIDQCLWLRTEPTRGEFTWPEGE
C5 NKPSSEMFSKLGFQVIDQCYWLRTEPTSGEFTWPEGE
***** **********:** ******* *:*******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 287 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 287 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5740]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5740]--->[5740]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/171/CG5783-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.291 Mb, Max= 30.590 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLK
CSSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPS
NKPSSEMFSKLGFQVIDQCYWLRTEPTGGQFTWPEGE
>C2
MGTRLEVIGLKDVQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKADDALKLRVEPPTGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
NKPSSGMFSKLGFQVIDQCFWLRTEPTEGQFTWPEGE
>C3
MGTRLEVIGLKDIQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKAEDALKLRVEPPTGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
NKPSSGMFSKLGFQVIEQCFWLRTEPTEGQFTWPEGE
>C4
MGTRLEVIGLKDIQQFQQLYKQNWPKYCQEYYCLDNFVSFLKKQPHMRNI
QMYTLDTKQARDEGLFVIVDRYQLFVGCLTNTNGLVRSALELLDWSTGLK
CSSIPSRHIDALDGLVESKRLELVFRDYTNLYFMKAEDALKLKVEPPDGF
VLRPLSVADAPLVNDEWPNHHVGSLFFIERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKALHKRRGFGSVVTREIAYRLAAEGHDVMALVGPL
NKPSSEMFSKLGFQVIDQCLWLRTEPTRGEFTWPEGE
>C5
MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
DMYTLDTKQARDEGLFVIVDRYQLFVGCLNNSSGLARTALDLLDWSTGLK
CSSVPSRHMDALDSVVESKKLDLVFRDCTNLFYMKAEDALKLKVEPPVGF
VLKSLSVADAPLINEEWPNHHVGSLFFIERQIRLCISAGLYQEDTQELVA
WCIRSQGGFLGTLQVKDSHKRRGFGSVVTREMAYRIAAQGHDVMALVNPC
NKPSSEMFSKLGFQVIDQCYWLRTEPTSGEFTWPEGE
FORMAT of file /tmp/tmp657040675321671265aln Not Supported[FATAL:T-COFFEE]
>C1
MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLK
CSSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPS
NKPSSEMFSKLGFQVIDQCYWLRTEPTGGQFTWPEGE
>C2
MGTRLEVIGLKDVQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKADDALKLRVEPPTGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
NKPSSGMFSKLGFQVIDQCFWLRTEPTEGQFTWPEGE
>C3
MGTRLEVIGLKDIQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKAEDALKLRVEPPTGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
NKPSSGMFSKLGFQVIEQCFWLRTEPTEGQFTWPEGE
>C4
MGTRLEVIGLKDIQQFQQLYKQNWPKYCQEYYCLDNFVSFLKKQPHMRNI
QMYTLDTKQARDEGLFVIVDRYQLFVGCLTNTNGLVRSALELLDWSTGLK
CSSIPSRHIDALDGLVESKRLELVFRDYTNLYFMKAEDALKLKVEPPDGF
VLRPLSVADAPLVNDEWPNHHVGSLFFIERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKALHKRRGFGSVVTREIAYRLAAEGHDVMALVGPL
NKPSSEMFSKLGFQVIDQCLWLRTEPTRGEFTWPEGE
>C5
MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
DMYTLDTKQARDEGLFVIVDRYQLFVGCLNNSSGLARTALDLLDWSTGLK
CSSVPSRHMDALDSVVESKKLDLVFRDCTNLFYMKAEDALKLKVEPPVGF
VLKSLSVADAPLINEEWPNHHVGSLFFIERQIRLCISAGLYQEDTQELVA
WCIRSQGGFLGTLQVKDSHKRRGFGSVVTREMAYRIAAQGHDVMALVNPC
NKPSSEMFSKLGFQVIDQCYWLRTEPTSGEFTWPEGE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:287 S:100 BS:287
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 94.77 C1 C2 94.77
TOP 1 0 94.77 C2 C1 94.77
BOT 0 2 94.77 C1 C3 94.77
TOP 2 0 94.77 C3 C1 94.77
BOT 0 3 89.20 C1 C4 89.20
TOP 3 0 89.20 C4 C1 89.20
BOT 0 4 88.15 C1 C5 88.15
TOP 4 0 88.15 C5 C1 88.15
BOT 1 2 98.95 C2 C3 98.95
TOP 2 1 98.95 C3 C2 98.95
BOT 1 3 89.55 C2 C4 89.55
TOP 3 1 89.55 C4 C2 89.55
BOT 1 4 88.85 C2 C5 88.85
TOP 4 1 88.85 C5 C2 88.85
BOT 2 3 89.90 C3 C4 89.90
TOP 3 2 89.90 C4 C3 89.90
BOT 2 4 89.20 C3 C5 89.20
TOP 4 2 89.20 C5 C3 89.20
BOT 3 4 87.11 C4 C5 87.11
TOP 4 3 87.11 C5 C4 87.11
AVG 0 C1 * 91.72
AVG 1 C2 * 93.03
AVG 2 C3 * 93.21
AVG 3 C4 * 88.94
AVG 4 C5 * 88.33
TOT TOT * 91.05
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATATCCAGGAGTTCCA
C2 ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATGTCCAGGAGTTCCA
C3 ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATATCCAGGAGTTCCA
C4 ATGGGTACTCGATTAGAAGTTATTGGATTGAAAGACATCCAGCAGTTCCA
C5 ATGGGTACTCGCTTAGAAGTTATTGGATTGAAAGATATCCAGGAATTCCA
***********.**************. ******* .***** *.*****
C1 ACAGCTCTACAAGCAAAACTGGCCAAAATATTGCCAGGAATACTACTGCC
C2 ACAGCTCTACAAGCAAAGCTGGCCAAAATATTGCCAGGAGTACTACTGCC
C3 ACAGCTCTACAAGCAAAGCTGGCCAAAATATTGCCAGGAGTACTACTGCC
C4 ACAGCTCTACAAGCAGAACTGGCCGAAGTATTGCCAGGAATACTACTGCC
C5 GCAGCTCTACAAGCAAAACTGGCCGAAATATTGCCAGGAATACTACTGCC
.**************.*.******.**.***********.**********
C1 TTGATAACTTTGTGGAATTTCTGAAAAAACAGCCCCATATGAGGAATATT
C2 TTGATAACTTTGTGGAATTTCTGAAAAAACAACCCCACATGAGGAACATT
C3 TTGATAACTTTGTGGAATTTCTGAAAAAACAACCCCACATGAGGAACATT
C4 TTGATAACTTCGTGTCATTCCTGAAAAAACAACCCCACATGAGGAACATT
C5 TTGACAATTTTGTGGAATTTCTGAAAAAACAACCCCACATGCGGAATATT
**** ** ** *** .*** ***********.***** ***.**** ***
C1 AAGATGTACACATTGGATGCAAAACAAGCCAGAGATGAAGGTCTTTTTGT
C2 AAGATGTACACATTGGATACAAAACAAGCCAGAGATGAAGGTCTTTTTGT
C3 AAGATGTACACATTGGATACAAAACAAGCCAGAGATGAAGGTCTTTTTGT
C4 CAGATGTACACATTGGATACAAAACAAGCCAGAGACGAAGGTCTTTTTGT
C5 GATATGTACACATTGGATACAAAACAGGCCAGAGATGAAGGTCTCTTTGT
* ***************.*******.******** ******** *****
C1 TATAGTGGATCGCTATCAACTATTCGTAGGTTGCTTGAACAACACGAACG
C2 CATAGTGGATCGCTATCAACTATTCGTAGGTTGCTTGAACAACACAAACG
C3 CATAGTGGATCGCTATCAACTATTCGTAGGCTGCTTGAACAACACAAACG
C4 CATAGTGGATCGCTATCAACTATTTGTAGGTTGCTTGACCAACACAAACG
C5 CATAGTGGATCGCTATCAACTTTTCGTAGGTTGCTTGAACAACTCAAGCG
********************:** ***** *******.****:*.*.**
C1 GCCTTGTTGGAAAAGCTCTGGATTTACTGGACTGGTCGTCGGGTTTGAAA
C2 GCCTTGTTAGAAAAGCTCTGGATTTGCTGGACTGGTCGACGGGTCTGAAA
C3 GCCTTGTTAGAAAAGCTCTGGATTTGCTGGACTGGTCGACGGGTCTGAAA
C4 GCCTTGTTAGATCAGCTTTGGAATTATTGGACTGGTCGACGGGTCTGAAA
C5 GTCTTGCTAGAACAGCTTTGGATTTATTGGACTGGTCGACGGGTCTGAAA
* **** *.**:.**** ****:**. ***********:***** *****
C1 TGCAGTTCTATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA
C2 TGCAGTTCAATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA
C3 TGCAGTTCAATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA
C4 TGCAGTTCAATACCCTCCAGACACATTGATGCCCTGGATGGTCTGGTTGA
C5 TGTAGTTCAGTACCCTCCAGACATATGGATGCCCTGGACAGTGTGGTAGA
** *****:.************* ** *.********* .** **** **
C1 GTCCAAAAAGTTGAATCTGGTGTACAGGGACTGCACGAATTTGTTTTTTA
C2 GTCCAAGAAGTTGGATCTGGTGTTCAGGGACTGCACGAATTTGTTTTTTA
C3 GTCCAAGAAGTTGGATCTGGTGTTCAGGGACTGCACGAATTTGTTTTTTA
C4 GTCTAAGAGGTTGGAGCTGGTATTCAGGGATTACACGAATTTGTATTTTA
C5 GTCTAAAAAGTTGGACCTCGTATTCAGGGATTGCACGAATTTGTTTTATA
*** **.*.****.* ** **.*:****** *.***********:**:**
C1 TGAAAGCCAACGACGCTCTCAAGCTGAAAGTCGAACCTCCATCTGGATTT
C2 TGAAAGCCGACGACGCTCTCAAGCTGAGAGTCGAACCCCCGACTGGATTT
C3 TGAAAGCCGAGGACGCTCTCAAGCTGAGAGTCGAACCCCCGACTGGATTT
C4 TGAAAGCTGAGGACGCTCTCAAGCTGAAAGTTGAACCACCAGATGGATTT
C5 TGAAAGCTGAGGACGCTCTCAAGCTGAAAGTTGAACCCCCAGTTGGATTT
******* .* ****************.*** ***** **. *******
C1 GTTTTAAAGTCGTTGAGTGTGGCAGATGCTCCATTGGTTAACGCAGAGTG
C2 GTTTTAAAATCGTTGAGCGTGGCAGATGCTCCATTGGTCAACGCGGAGTG
C3 GTTTTAAAATCGCTGAGCGTGGCAGATGCTCCATTGGTCAACGCGGAGTG
C4 GTTCTAAGGCCCCTGAGCGTGGCAGACGCTCCTTTGGTGAACGACGAGTG
C5 GTTTTAAAGTCGCTGAGCGTGGCAGACGCCCCTTTGATTAACGAAGAGTG
*** ***.. * **** ******** ** **:***.* ****. *****
C1 GCCCAATCATCATGAGGGATCTTTGTTCTTCGTAGAAAGGCAGATTCGCC
C2 GCCCAATCATCATGAGGGCTCTTTGTTCTTCGTAGAAAGGCAGATTCGCC
C3 GCCCAATCATCATGAGGGATCTTTGTTCTTCGTAGAAAGGCAGATTCGCC
C4 GCCCAACCATCATGTGGGATCTTTGTTCTTCATAGAAAGACAGATTCGCC
C5 GCCCAATCATCATGTGGGATCTTTGTTCTTCATAGAAAGACAGATTCGCT
****** *******:***.************.*******.*********
C1 TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACCCAGGAACTAGTTGCC
C2 TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACTCAGGAACTAGTTGCC
C3 TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACTCAGGAACTAGTTGCC
C4 TGTGCGTCAGTGTAGGATTGTACCAGGAGGACACCCAAGAACTAGTTGCC
C5 TGTGCATCAGTGCGGGATTGTACCAGGAAGATACCCAGGAACTAGTTGCC
*****.****** **************.** ** **.************
C1 TGGTGCATTAGGTTACAAGGCGGCTACTTGGGCGCCCTGCAAGTCAAAGA
C2 TGGTGCATTAGGTTACAAGGCGGTTACTTGGGCGCTTTGCAAGTGAAAGA
C3 TGGTGCATTAGGTTACAAGGCGGCTACTTGGGCGCCCTGCAAGTGAAAGA
C4 TGGTGCATCAGGTTGCAAGGCGGCTACTTGGGCGCCCTGCAGGTGAAAGC
C5 TGGTGCATCAGGTCACAAGGCGGCTTCTTGGGCACCCTGCAAGTGAAAGA
******** **** .******** *:*******.* ****.** ****.
C1 TACACACAAGCGACGCGGATTTGGCAGTGTGGTGACTAGGGAAATAGCAT
C2 TTCGCACAAGCGTCGCGGATTTGGCAGTGTGGTGACGAGGGAAATAGCAT
C3 TTCGCACAAGCGTCGTGGATTTGGCAGTGTGGTGACGAGGGAAATTGCAT
C4 TTTACACAAACGTCGAGGATTCGGCAGTGTAGTGACGAGGGAAATCGCAT
C5 TTCTCACAAGCGTCGGGGATTTGGCAGTGTCGTGACGAGGGAAATGGCAT
*: *****.**:** ***** ******** ***** ******** ****
C1 ACCGCCTAGCCGTCCAAGGTCACGATGTAATGGCTCTCGTGGGCCCCTCG
C2 ACCGCCTAGCTGCCCAAGGTCACGATGTAATGGCTCTCGTGGGCCCCTCG
C3 ACCGCCTAGCTGCCCAAGGTCACGATGTAATGGCCCTCGTGGGCCCCTCG
C4 ACCGCCTAGCCGCTGAGGGTCACGATGTAATGGCCCTCGTGGGCCCCTTG
C5 ACCGCATAGCCGCCCAGGGCCACGATGTAATGGCCCTCGTAAACCCCTGT
*****.**** * *.** ************** *****...*****
C1 AATAAGCCGTCATCGGAGATGTTCAGCAAACTGGGATTCCAGGTCATCGA
C2 AATAAGCCCTCTTCGGGGATGTTCAGTAAACTGGGTTTCCAGGTCATCGA
C3 AATAAGCCTTCATCGGGGATGTTTAGCAAACTGGGCTTCCAGGTCATCGA
C4 AATAAGCCCTCATCCGAGATGTTCAGCAAACTTGGCTTCCAGGTCATCGA
C5 AATAAGCCCTCGTCCGAAATGTTTAGCAAACTTGGCTTCCAGGTCATCGA
******** ** ** *..***** ** ***** ** **************
C1 TCAATGCTACTGGCTAAGGACGGAACCCACCGGTGGGCAGTTCACATGGC
C2 CCAATGCTTCTGGCTAAGGACGGAACCCACCGAGGGGCAGTTCACATGGC
C3 ACAATGCTTCTGGCTAAGAACGGAACCCACCGAGGGGCAGTTCACATGGC
C4 CCAGTGCCTTTGGCTAAGGACCGAACCCACCAGGGGCGAGTTCACCTGGC
C5 CCAGTGCTATTGGCTAAGGACGGAACCCACCAGCGGCGAGTTCACCTGGC
**.*** : ********.** *********.. ** *******.****
C1 CCGAGGGCGAG
C2 CCGAGGGCGAG
C3 CCGAGGGCGAG
C4 CCGAGGGCGAG
C5 CCGAGGGCGAG
***********
>C1
ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATATCCAGGAGTTCCA
ACAGCTCTACAAGCAAAACTGGCCAAAATATTGCCAGGAATACTACTGCC
TTGATAACTTTGTGGAATTTCTGAAAAAACAGCCCCATATGAGGAATATT
AAGATGTACACATTGGATGCAAAACAAGCCAGAGATGAAGGTCTTTTTGT
TATAGTGGATCGCTATCAACTATTCGTAGGTTGCTTGAACAACACGAACG
GCCTTGTTGGAAAAGCTCTGGATTTACTGGACTGGTCGTCGGGTTTGAAA
TGCAGTTCTATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA
GTCCAAAAAGTTGAATCTGGTGTACAGGGACTGCACGAATTTGTTTTTTA
TGAAAGCCAACGACGCTCTCAAGCTGAAAGTCGAACCTCCATCTGGATTT
GTTTTAAAGTCGTTGAGTGTGGCAGATGCTCCATTGGTTAACGCAGAGTG
GCCCAATCATCATGAGGGATCTTTGTTCTTCGTAGAAAGGCAGATTCGCC
TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACCCAGGAACTAGTTGCC
TGGTGCATTAGGTTACAAGGCGGCTACTTGGGCGCCCTGCAAGTCAAAGA
TACACACAAGCGACGCGGATTTGGCAGTGTGGTGACTAGGGAAATAGCAT
ACCGCCTAGCCGTCCAAGGTCACGATGTAATGGCTCTCGTGGGCCCCTCG
AATAAGCCGTCATCGGAGATGTTCAGCAAACTGGGATTCCAGGTCATCGA
TCAATGCTACTGGCTAAGGACGGAACCCACCGGTGGGCAGTTCACATGGC
CCGAGGGCGAG
>C2
ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATGTCCAGGAGTTCCA
ACAGCTCTACAAGCAAAGCTGGCCAAAATATTGCCAGGAGTACTACTGCC
TTGATAACTTTGTGGAATTTCTGAAAAAACAACCCCACATGAGGAACATT
AAGATGTACACATTGGATACAAAACAAGCCAGAGATGAAGGTCTTTTTGT
CATAGTGGATCGCTATCAACTATTCGTAGGTTGCTTGAACAACACAAACG
GCCTTGTTAGAAAAGCTCTGGATTTGCTGGACTGGTCGACGGGTCTGAAA
TGCAGTTCAATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA
GTCCAAGAAGTTGGATCTGGTGTTCAGGGACTGCACGAATTTGTTTTTTA
TGAAAGCCGACGACGCTCTCAAGCTGAGAGTCGAACCCCCGACTGGATTT
GTTTTAAAATCGTTGAGCGTGGCAGATGCTCCATTGGTCAACGCGGAGTG
GCCCAATCATCATGAGGGCTCTTTGTTCTTCGTAGAAAGGCAGATTCGCC
TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACTCAGGAACTAGTTGCC
TGGTGCATTAGGTTACAAGGCGGTTACTTGGGCGCTTTGCAAGTGAAAGA
TTCGCACAAGCGTCGCGGATTTGGCAGTGTGGTGACGAGGGAAATAGCAT
ACCGCCTAGCTGCCCAAGGTCACGATGTAATGGCTCTCGTGGGCCCCTCG
AATAAGCCCTCTTCGGGGATGTTCAGTAAACTGGGTTTCCAGGTCATCGA
CCAATGCTTCTGGCTAAGGACGGAACCCACCGAGGGGCAGTTCACATGGC
CCGAGGGCGAG
>C3
ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATATCCAGGAGTTCCA
ACAGCTCTACAAGCAAAGCTGGCCAAAATATTGCCAGGAGTACTACTGCC
TTGATAACTTTGTGGAATTTCTGAAAAAACAACCCCACATGAGGAACATT
AAGATGTACACATTGGATACAAAACAAGCCAGAGATGAAGGTCTTTTTGT
CATAGTGGATCGCTATCAACTATTCGTAGGCTGCTTGAACAACACAAACG
GCCTTGTTAGAAAAGCTCTGGATTTGCTGGACTGGTCGACGGGTCTGAAA
TGCAGTTCAATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA
GTCCAAGAAGTTGGATCTGGTGTTCAGGGACTGCACGAATTTGTTTTTTA
TGAAAGCCGAGGACGCTCTCAAGCTGAGAGTCGAACCCCCGACTGGATTT
GTTTTAAAATCGCTGAGCGTGGCAGATGCTCCATTGGTCAACGCGGAGTG
GCCCAATCATCATGAGGGATCTTTGTTCTTCGTAGAAAGGCAGATTCGCC
TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACTCAGGAACTAGTTGCC
TGGTGCATTAGGTTACAAGGCGGCTACTTGGGCGCCCTGCAAGTGAAAGA
TTCGCACAAGCGTCGTGGATTTGGCAGTGTGGTGACGAGGGAAATTGCAT
ACCGCCTAGCTGCCCAAGGTCACGATGTAATGGCCCTCGTGGGCCCCTCG
AATAAGCCTTCATCGGGGATGTTTAGCAAACTGGGCTTCCAGGTCATCGA
ACAATGCTTCTGGCTAAGAACGGAACCCACCGAGGGGCAGTTCACATGGC
CCGAGGGCGAG
>C4
ATGGGTACTCGATTAGAAGTTATTGGATTGAAAGACATCCAGCAGTTCCA
ACAGCTCTACAAGCAGAACTGGCCGAAGTATTGCCAGGAATACTACTGCC
TTGATAACTTCGTGTCATTCCTGAAAAAACAACCCCACATGAGGAACATT
CAGATGTACACATTGGATACAAAACAAGCCAGAGACGAAGGTCTTTTTGT
CATAGTGGATCGCTATCAACTATTTGTAGGTTGCTTGACCAACACAAACG
GCCTTGTTAGATCAGCTTTGGAATTATTGGACTGGTCGACGGGTCTGAAA
TGCAGTTCAATACCCTCCAGACACATTGATGCCCTGGATGGTCTGGTTGA
GTCTAAGAGGTTGGAGCTGGTATTCAGGGATTACACGAATTTGTATTTTA
TGAAAGCTGAGGACGCTCTCAAGCTGAAAGTTGAACCACCAGATGGATTT
GTTCTAAGGCCCCTGAGCGTGGCAGACGCTCCTTTGGTGAACGACGAGTG
GCCCAACCATCATGTGGGATCTTTGTTCTTCATAGAAAGACAGATTCGCC
TGTGCGTCAGTGTAGGATTGTACCAGGAGGACACCCAAGAACTAGTTGCC
TGGTGCATCAGGTTGCAAGGCGGCTACTTGGGCGCCCTGCAGGTGAAAGC
TTTACACAAACGTCGAGGATTCGGCAGTGTAGTGACGAGGGAAATCGCAT
ACCGCCTAGCCGCTGAGGGTCACGATGTAATGGCCCTCGTGGGCCCCTTG
AATAAGCCCTCATCCGAGATGTTCAGCAAACTTGGCTTCCAGGTCATCGA
CCAGTGCCTTTGGCTAAGGACCGAACCCACCAGGGGCGAGTTCACCTGGC
CCGAGGGCGAG
>C5
ATGGGTACTCGCTTAGAAGTTATTGGATTGAAAGATATCCAGGAATTCCA
GCAGCTCTACAAGCAAAACTGGCCGAAATATTGCCAGGAATACTACTGCC
TTGACAATTTTGTGGAATTTCTGAAAAAACAACCCCACATGCGGAATATT
GATATGTACACATTGGATACAAAACAGGCCAGAGATGAAGGTCTCTTTGT
CATAGTGGATCGCTATCAACTTTTCGTAGGTTGCTTGAACAACTCAAGCG
GTCTTGCTAGAACAGCTTTGGATTTATTGGACTGGTCGACGGGTCTGAAA
TGTAGTTCAGTACCCTCCAGACATATGGATGCCCTGGACAGTGTGGTAGA
GTCTAAAAAGTTGGACCTCGTATTCAGGGATTGCACGAATTTGTTTTATA
TGAAAGCTGAGGACGCTCTCAAGCTGAAAGTTGAACCCCCAGTTGGATTT
GTTTTAAAGTCGCTGAGCGTGGCAGACGCCCCTTTGATTAACGAAGAGTG
GCCCAATCATCATGTGGGATCTTTGTTCTTCATAGAAAGACAGATTCGCT
TGTGCATCAGTGCGGGATTGTACCAGGAAGATACCCAGGAACTAGTTGCC
TGGTGCATCAGGTCACAAGGCGGCTTCTTGGGCACCCTGCAAGTGAAAGA
TTCTCACAAGCGTCGGGGATTTGGCAGTGTCGTGACGAGGGAAATGGCAT
ACCGCATAGCCGCCCAGGGCCACGATGTAATGGCCCTCGTAAACCCCTGT
AATAAGCCCTCGTCCGAAATGTTTAGCAAACTTGGCTTCCAGGTCATCGA
CCAGTGCTATTGGCTAAGGACGGAACCCACCAGCGGCGAGTTCACCTGGC
CCGAGGGCGAG
>C1
MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLK
CSSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPS
NKPSSEMFSKLGFQVIDQCYWLRTEPTGGQFTWPEGE
>C2
MGTRLEVIGLKDVQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKADDALKLRVEPPTGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
NKPSSGMFSKLGFQVIDQCFWLRTEPTEGQFTWPEGE
>C3
MGTRLEVIGLKDIQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKAEDALKLRVEPPTGF
VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
NKPSSGMFSKLGFQVIEQCFWLRTEPTEGQFTWPEGE
>C4
MGTRLEVIGLKDIQQFQQLYKQNWPKYCQEYYCLDNFVSFLKKQPHMRNI
QMYTLDTKQARDEGLFVIVDRYQLFVGCLTNTNGLVRSALELLDWSTGLK
CSSIPSRHIDALDGLVESKRLELVFRDYTNLYFMKAEDALKLKVEPPDGF
VLRPLSVADAPLVNDEWPNHHVGSLFFIERQIRLCVSVGLYQEDTQELVA
WCIRLQGGYLGALQVKALHKRRGFGSVVTREIAYRLAAEGHDVMALVGPL
NKPSSEMFSKLGFQVIDQCLWLRTEPTRGEFTWPEGE
>C5
MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
DMYTLDTKQARDEGLFVIVDRYQLFVGCLNNSSGLARTALDLLDWSTGLK
CSSVPSRHMDALDSVVESKKLDLVFRDCTNLFYMKAEDALKLKVEPPVGF
VLKSLSVADAPLINEEWPNHHVGSLFFIERQIRLCISAGLYQEDTQELVA
WCIRSQGGFLGTLQVKDSHKRRGFGSVVTREMAYRIAAQGHDVMALVNPC
NKPSSEMFSKLGFQVIDQCYWLRTEPTSGEFTWPEGE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 861 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478598901
Setting output file names to "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1556622622
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0990728217
Seed = 397567492
Swapseed = 1478598901
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 30 unique site patterns
Division 2 has 25 unique site patterns
Division 3 has 60 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2516.678664 -- -25.624409
Chain 2 -- -2516.678664 -- -25.624409
Chain 3 -- -2515.856082 -- -25.624409
Chain 4 -- -2416.063342 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2474.556827 -- -25.624409
Chain 2 -- -2527.491660 -- -25.624409
Chain 3 -- -2516.678664 -- -25.624409
Chain 4 -- -2518.004683 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2516.679] (-2516.679) (-2515.856) (-2416.063) * [-2474.557] (-2527.492) (-2516.679) (-2518.005)
500 -- (-2185.238) (-2184.960) (-2191.194) [-2170.510] * (-2179.808) (-2177.505) [-2171.636] (-2180.096) -- 0:00:00
1000 -- (-2165.325) (-2178.192) (-2182.100) [-2156.382] * (-2171.090) [-2166.757] (-2163.723) (-2181.090) -- 0:00:00
1500 -- (-2156.101) (-2168.866) (-2180.827) [-2152.674] * (-2161.952) [-2158.419] (-2152.253) (-2171.649) -- 0:00:00
2000 -- [-2140.399] (-2160.813) (-2162.988) (-2149.321) * (-2151.469) [-2148.326] (-2154.912) (-2154.143) -- 0:08:19
2500 -- (-2133.614) (-2158.470) (-2152.856) [-2144.652] * (-2139.366) [-2136.230] (-2146.013) (-2147.979) -- 0:06:39
3000 -- (-2138.269) (-2160.483) (-2143.186) [-2144.853] * [-2137.251] (-2136.699) (-2150.128) (-2142.278) -- 0:05:32
3500 -- [-2140.287] (-2159.329) (-2140.539) (-2136.865) * (-2132.478) (-2137.130) [-2143.055] (-2146.489) -- 0:04:44
4000 -- (-2137.078) (-2144.120) [-2144.059] (-2139.709) * (-2130.380) (-2139.506) [-2129.372] (-2142.579) -- 0:04:09
4500 -- (-2133.153) (-2140.816) (-2145.283) [-2133.702] * (-2134.704) [-2133.966] (-2137.991) (-2142.268) -- 0:03:41
5000 -- [-2129.754] (-2144.135) (-2152.959) (-2137.421) * (-2137.084) (-2144.641) [-2138.906] (-2136.071) -- 0:03:19
Average standard deviation of split frequencies: 0.052378
5500 -- (-2139.041) [-2132.238] (-2142.051) (-2134.432) * [-2134.060] (-2135.865) (-2132.093) (-2134.493) -- 0:03:00
6000 -- [-2131.086] (-2133.812) (-2138.950) (-2134.039) * (-2131.254) (-2137.386) [-2132.730] (-2136.521) -- 0:02:45
6500 -- (-2136.306) (-2136.430) (-2141.449) [-2134.857] * [-2131.544] (-2136.276) (-2135.071) (-2135.392) -- 0:05:05
7000 -- (-2138.375) (-2140.601) [-2133.005] (-2137.081) * (-2135.330) (-2133.080) (-2132.141) [-2134.580] -- 0:04:43
7500 -- (-2133.494) [-2136.592] (-2131.865) (-2133.802) * [-2132.286] (-2131.820) (-2135.696) (-2135.638) -- 0:04:24
8000 -- (-2131.519) (-2139.379) [-2134.461] (-2132.589) * (-2138.405) [-2135.834] (-2137.827) (-2134.457) -- 0:04:08
8500 -- [-2130.496] (-2134.582) (-2137.604) (-2135.824) * (-2143.161) [-2136.383] (-2133.856) (-2139.622) -- 0:03:53
9000 -- (-2131.325) (-2142.116) (-2135.830) [-2136.569] * (-2138.797) (-2133.095) (-2134.687) [-2139.945] -- 0:03:40
9500 -- (-2137.344) [-2131.620] (-2138.828) (-2134.567) * (-2138.499) (-2133.226) (-2133.892) [-2139.447] -- 0:03:28
10000 -- (-2136.744) (-2137.201) (-2138.533) [-2131.423] * [-2145.606] (-2134.249) (-2137.752) (-2134.431) -- 0:03:18
Average standard deviation of split frequencies: 0.029463
10500 -- [-2130.729] (-2132.216) (-2140.717) (-2135.468) * (-2140.005) (-2135.699) [-2139.128] (-2132.254) -- 0:03:08
11000 -- (-2132.408) [-2133.176] (-2139.237) (-2134.266) * (-2138.301) (-2134.877) (-2137.314) [-2136.983] -- 0:04:29
11500 -- [-2136.761] (-2131.020) (-2135.620) (-2140.951) * (-2135.984) (-2134.198) (-2137.753) [-2135.522] -- 0:04:17
12000 -- (-2134.835) (-2141.321) (-2132.950) [-2139.367] * (-2134.982) [-2135.372] (-2142.627) (-2133.145) -- 0:04:07
12500 -- (-2134.392) (-2136.514) (-2134.540) [-2135.157] * (-2136.827) [-2133.351] (-2138.218) (-2137.676) -- 0:03:57
13000 -- [-2136.049] (-2131.250) (-2128.690) (-2146.537) * [-2136.879] (-2140.309) (-2135.780) (-2139.296) -- 0:03:47
13500 -- (-2136.641) (-2133.916) (-2134.273) [-2137.122] * (-2136.514) (-2133.360) (-2134.921) [-2137.631] -- 0:03:39
14000 -- (-2135.420) [-2133.986] (-2137.744) (-2134.677) * (-2134.316) [-2135.026] (-2143.129) (-2140.325) -- 0:03:31
14500 -- [-2137.517] (-2139.183) (-2141.377) (-2138.894) * (-2134.237) [-2139.605] (-2135.682) (-2141.569) -- 0:03:23
15000 -- [-2135.401] (-2140.644) (-2136.404) (-2142.324) * (-2132.503) (-2134.853) (-2132.096) [-2136.538] -- 0:03:17
Average standard deviation of split frequencies: 0.019642
15500 -- (-2137.681) (-2130.378) [-2137.052] (-2140.853) * (-2132.288) (-2135.994) [-2133.937] (-2136.558) -- 0:04:14
16000 -- (-2132.484) [-2131.789] (-2133.150) (-2137.081) * (-2130.152) (-2139.795) (-2136.154) [-2135.768] -- 0:04:06
16500 -- [-2131.997] (-2136.851) (-2142.378) (-2134.675) * (-2133.343) (-2137.892) [-2141.974] (-2133.951) -- 0:03:58
17000 -- (-2134.510) (-2137.225) [-2138.164] (-2137.631) * (-2133.959) (-2137.547) (-2134.983) [-2137.281] -- 0:03:51
17500 -- (-2135.630) [-2132.559] (-2132.456) (-2146.444) * (-2130.286) (-2135.067) (-2134.060) [-2132.616] -- 0:03:44
18000 -- (-2133.251) [-2130.780] (-2134.520) (-2140.530) * (-2138.594) (-2137.540) [-2133.898] (-2137.545) -- 0:03:38
18500 -- [-2132.528] (-2129.913) (-2136.113) (-2137.862) * (-2134.814) [-2134.088] (-2133.890) (-2135.549) -- 0:03:32
19000 -- (-2132.693) [-2132.451] (-2136.491) (-2140.473) * (-2139.861) [-2131.642] (-2137.907) (-2136.312) -- 0:03:26
19500 -- (-2132.999) (-2129.899) (-2133.099) [-2132.986] * [-2143.073] (-2134.009) (-2144.529) (-2133.776) -- 0:03:21
20000 -- (-2133.427) (-2133.297) (-2134.243) [-2135.210] * (-2135.854) [-2132.428] (-2137.409) (-2136.316) -- 0:04:05
Average standard deviation of split frequencies: 0.038016
20500 -- (-2136.893) [-2132.052] (-2132.971) (-2138.973) * (-2138.912) [-2133.575] (-2138.515) (-2134.999) -- 0:03:58
21000 -- [-2134.894] (-2130.934) (-2132.267) (-2145.094) * (-2136.094) (-2135.246) (-2142.597) [-2133.212] -- 0:03:53
21500 -- [-2134.704] (-2130.729) (-2135.451) (-2137.723) * (-2137.066) (-2136.731) (-2145.537) [-2135.745] -- 0:03:47
22000 -- (-2134.556) [-2133.965] (-2137.770) (-2130.216) * [-2131.902] (-2133.694) (-2138.339) (-2138.900) -- 0:03:42
22500 -- (-2141.125) (-2137.781) [-2135.688] (-2132.514) * [-2130.366] (-2132.837) (-2137.775) (-2139.026) -- 0:03:37
23000 -- (-2133.693) (-2133.810) [-2133.501] (-2135.280) * (-2140.536) (-2132.727) [-2133.397] (-2141.734) -- 0:03:32
23500 -- (-2137.959) [-2129.926] (-2136.420) (-2138.096) * (-2134.006) (-2134.096) (-2138.815) [-2130.531] -- 0:03:27
24000 -- (-2137.016) (-2131.238) (-2135.794) [-2132.535] * (-2137.090) (-2142.671) (-2133.879) [-2134.742] -- 0:03:23
24500 -- [-2139.475] (-2136.689) (-2134.456) (-2136.086) * (-2136.178) (-2134.759) (-2136.512) [-2134.861] -- 0:03:58
25000 -- (-2140.293) (-2132.414) (-2133.782) [-2132.272] * (-2143.235) (-2131.609) (-2140.026) [-2136.500] -- 0:03:54
Average standard deviation of split frequencies: 0.024175
25500 -- [-2133.415] (-2133.718) (-2133.606) (-2136.555) * (-2135.995) [-2135.443] (-2136.231) (-2134.453) -- 0:03:49
26000 -- (-2134.582) (-2132.757) (-2143.649) [-2133.251] * (-2139.471) [-2134.161] (-2144.410) (-2139.274) -- 0:03:44
26500 -- (-2143.561) [-2133.132] (-2135.925) (-2130.730) * [-2133.295] (-2131.505) (-2134.521) (-2137.019) -- 0:03:40
27000 -- (-2133.864) (-2137.338) (-2130.859) [-2134.227] * (-2133.695) [-2136.578] (-2136.728) (-2131.924) -- 0:03:36
27500 -- [-2133.299] (-2136.484) (-2137.944) (-2135.173) * (-2138.244) [-2137.118] (-2129.561) (-2134.147) -- 0:03:32
28000 -- (-2134.454) (-2133.943) (-2134.555) [-2141.211] * (-2139.237) (-2131.941) [-2137.671] (-2136.163) -- 0:03:28
28500 -- (-2132.815) (-2135.270) (-2137.369) [-2139.622] * (-2141.926) [-2134.129] (-2133.170) (-2135.991) -- 0:03:24
29000 -- (-2135.950) (-2140.188) [-2135.424] (-2148.912) * [-2134.769] (-2135.185) (-2135.145) (-2136.342) -- 0:03:54
29500 -- [-2133.694] (-2144.780) (-2139.170) (-2140.201) * (-2132.752) [-2133.282] (-2139.965) (-2140.383) -- 0:03:50
30000 -- (-2133.577) [-2135.510] (-2137.003) (-2136.994) * (-2137.953) (-2135.171) [-2135.066] (-2133.536) -- 0:03:46
Average standard deviation of split frequencies: 0.051240
30500 -- (-2131.360) (-2132.925) (-2138.675) [-2134.485] * [-2136.006] (-2136.526) (-2138.972) (-2141.166) -- 0:03:42
31000 -- (-2130.405) (-2133.484) [-2137.202] (-2131.216) * (-2132.661) [-2140.700] (-2129.728) (-2140.783) -- 0:03:38
31500 -- (-2135.910) (-2139.132) [-2132.542] (-2135.108) * (-2135.696) [-2136.649] (-2135.793) (-2142.115) -- 0:03:35
32000 -- (-2134.870) (-2132.718) (-2131.065) [-2132.675] * (-2132.645) (-2131.931) [-2135.622] (-2139.143) -- 0:03:31
32500 -- (-2134.562) (-2131.398) (-2130.853) [-2134.590] * (-2134.867) (-2143.148) (-2136.805) [-2138.590] -- 0:03:28
33000 -- [-2138.837] (-2134.662) (-2133.576) (-2131.805) * (-2129.800) (-2132.869) [-2135.545] (-2139.769) -- 0:03:25
33500 -- (-2138.967) [-2137.030] (-2131.622) (-2132.969) * [-2130.180] (-2134.931) (-2134.185) (-2137.845) -- 0:03:50
34000 -- (-2137.796) [-2131.940] (-2134.896) (-2132.018) * (-2133.170) (-2135.393) (-2140.802) [-2136.888] -- 0:03:47
34500 -- (-2136.434) [-2134.511] (-2138.520) (-2134.010) * (-2132.836) (-2139.470) [-2134.186] (-2138.348) -- 0:03:43
35000 -- (-2132.280) [-2132.682] (-2132.051) (-2136.348) * (-2140.396) (-2136.512) (-2134.939) [-2134.153] -- 0:03:40
Average standard deviation of split frequencies: 0.034919
35500 -- (-2133.528) [-2134.181] (-2136.116) (-2134.566) * (-2135.247) (-2139.918) [-2140.665] (-2131.566) -- 0:03:37
36000 -- [-2134.966] (-2133.390) (-2139.937) (-2132.423) * (-2134.416) (-2132.001) [-2132.689] (-2135.998) -- 0:03:34
36500 -- [-2131.853] (-2137.372) (-2143.142) (-2134.314) * (-2135.443) [-2132.362] (-2136.151) (-2134.339) -- 0:03:31
37000 -- (-2135.169) (-2136.366) [-2132.616] (-2135.356) * [-2135.457] (-2135.798) (-2134.123) (-2140.345) -- 0:03:28
37500 -- (-2131.418) (-2136.388) [-2134.259] (-2141.679) * (-2134.526) (-2137.537) [-2131.630] (-2135.325) -- 0:03:25
38000 -- (-2143.921) (-2136.084) (-2138.419) [-2140.178] * (-2135.342) [-2135.363] (-2135.591) (-2131.761) -- 0:03:47
38500 -- [-2140.724] (-2134.244) (-2137.999) (-2137.785) * (-2135.620) (-2139.272) [-2134.314] (-2133.111) -- 0:03:44
39000 -- (-2140.249) (-2132.298) (-2136.972) [-2134.245] * (-2134.991) [-2136.952] (-2132.398) (-2137.668) -- 0:03:41
39500 -- (-2136.881) (-2136.144) (-2140.979) [-2135.701] * [-2135.692] (-2134.428) (-2133.409) (-2133.402) -- 0:03:38
40000 -- (-2134.450) (-2135.225) (-2133.895) [-2139.528] * (-2135.006) (-2137.573) (-2135.960) [-2133.336] -- 0:03:36
Average standard deviation of split frequencies: 0.007728
40500 -- (-2131.661) (-2134.988) (-2136.989) [-2142.892] * (-2135.585) [-2136.716] (-2137.870) (-2131.797) -- 0:03:33
41000 -- (-2138.248) [-2140.400] (-2135.324) (-2142.532) * (-2137.387) (-2138.231) (-2142.498) [-2134.888] -- 0:03:30
41500 -- (-2133.746) (-2133.544) [-2133.569] (-2136.271) * (-2134.571) [-2133.206] (-2135.096) (-2137.503) -- 0:03:27
42000 -- (-2136.911) [-2131.823] (-2131.526) (-2135.651) * (-2131.916) (-2134.407) [-2133.478] (-2133.611) -- 0:03:25
42500 -- (-2135.168) (-2131.509) (-2136.644) [-2133.431] * (-2131.085) (-2139.873) (-2134.746) [-2133.053] -- 0:03:45
43000 -- (-2134.496) (-2132.012) [-2138.828] (-2132.364) * (-2131.469) [-2136.292] (-2140.301) (-2138.816) -- 0:03:42
43500 -- [-2135.209] (-2138.484) (-2137.991) (-2136.084) * (-2134.394) (-2132.904) (-2136.166) [-2134.640] -- 0:03:39
44000 -- [-2133.143] (-2134.277) (-2144.281) (-2134.202) * [-2135.121] (-2138.661) (-2135.538) (-2136.169) -- 0:03:37
44500 -- (-2130.232) [-2133.507] (-2135.344) (-2136.891) * (-2139.565) [-2136.648] (-2135.116) (-2132.455) -- 0:03:34
45000 -- (-2137.586) (-2137.615) (-2137.690) [-2133.326] * [-2133.080] (-2139.637) (-2134.224) (-2136.487) -- 0:03:32
Average standard deviation of split frequencies: 0.013664
45500 -- [-2136.296] (-2134.782) (-2138.232) (-2136.677) * [-2137.708] (-2136.445) (-2133.735) (-2145.271) -- 0:03:29
46000 -- (-2135.380) [-2137.138] (-2133.495) (-2141.523) * (-2132.762) (-2137.166) (-2137.168) [-2137.939] -- 0:03:27
46500 -- [-2130.631] (-2136.889) (-2133.232) (-2139.284) * (-2135.412) [-2135.139] (-2132.028) (-2131.521) -- 0:03:25
47000 -- (-2137.825) (-2134.563) [-2133.200] (-2133.027) * (-2134.911) (-2136.527) [-2141.507] (-2132.663) -- 0:03:43
47500 -- (-2136.804) (-2137.688) [-2132.570] (-2131.672) * (-2136.964) (-2133.844) [-2138.062] (-2133.787) -- 0:03:40
48000 -- (-2141.064) [-2135.343] (-2136.708) (-2137.299) * [-2135.688] (-2137.725) (-2135.083) (-2133.883) -- 0:03:38
48500 -- (-2137.740) (-2136.845) [-2133.966] (-2141.452) * (-2136.779) (-2134.530) (-2132.856) [-2133.474] -- 0:03:35
49000 -- (-2139.114) (-2138.327) [-2133.941] (-2133.878) * [-2134.631] (-2134.597) (-2134.894) (-2135.491) -- 0:03:33
49500 -- (-2133.030) (-2135.441) [-2139.806] (-2133.723) * [-2131.361] (-2133.580) (-2130.711) (-2139.239) -- 0:03:31
50000 -- [-2132.691] (-2133.336) (-2138.935) (-2144.160) * (-2135.498) (-2136.932) [-2132.152] (-2132.373) -- 0:03:29
Average standard deviation of split frequencies: 0.012405
50500 -- (-2136.124) [-2139.981] (-2141.194) (-2139.448) * (-2131.967) (-2132.371) [-2142.754] (-2133.873) -- 0:03:26
51000 -- [-2136.390] (-2134.567) (-2136.078) (-2145.811) * (-2138.250) [-2136.633] (-2133.044) (-2135.241) -- 0:03:24
51500 -- (-2137.272) [-2137.277] (-2135.282) (-2139.256) * (-2133.484) (-2140.378) [-2133.456] (-2145.304) -- 0:03:41
52000 -- (-2133.426) (-2134.289) (-2136.191) [-2137.628] * (-2141.435) [-2140.948] (-2142.291) (-2139.155) -- 0:03:38
52500 -- (-2136.555) [-2135.336] (-2137.819) (-2140.336) * (-2135.853) (-2137.345) (-2132.648) [-2138.256] -- 0:03:36
53000 -- (-2135.119) [-2133.123] (-2138.254) (-2137.636) * (-2137.534) (-2128.594) [-2134.607] (-2133.284) -- 0:03:34
53500 -- (-2133.839) [-2138.592] (-2131.766) (-2139.875) * [-2135.877] (-2129.801) (-2132.031) (-2137.698) -- 0:03:32
54000 -- (-2131.457) (-2134.155) [-2131.401] (-2136.037) * [-2137.747] (-2132.103) (-2138.577) (-2137.039) -- 0:03:30
54500 -- (-2135.626) (-2134.080) [-2138.425] (-2134.253) * (-2136.812) (-2133.482) (-2139.830) [-2143.067] -- 0:03:28
55000 -- (-2132.088) (-2136.068) [-2137.285] (-2136.291) * [-2136.632] (-2132.751) (-2144.691) (-2135.551) -- 0:03:26
Average standard deviation of split frequencies: 0.028060
55500 -- (-2132.015) [-2132.287] (-2139.321) (-2135.038) * (-2136.784) (-2134.201) [-2133.678] (-2138.919) -- 0:03:24
56000 -- (-2137.840) (-2132.224) [-2139.406] (-2131.666) * (-2135.790) (-2135.231) [-2134.850] (-2143.433) -- 0:03:39
56500 -- [-2129.600] (-2136.685) (-2133.897) (-2132.706) * [-2134.202] (-2133.215) (-2133.465) (-2137.847) -- 0:03:37
57000 -- (-2129.416) (-2131.752) [-2135.610] (-2132.090) * (-2138.476) (-2134.554) [-2135.485] (-2138.506) -- 0:03:35
57500 -- (-2132.042) [-2131.854] (-2135.393) (-2135.221) * (-2137.758) (-2136.592) (-2136.458) [-2140.280] -- 0:03:33
58000 -- (-2132.043) [-2131.064] (-2144.270) (-2139.656) * [-2133.333] (-2139.969) (-2138.472) (-2139.046) -- 0:03:31
58500 -- (-2135.856) (-2130.657) (-2135.187) [-2135.698] * [-2133.724] (-2135.891) (-2136.766) (-2140.222) -- 0:03:29
59000 -- (-2131.128) (-2135.269) [-2134.914] (-2136.499) * (-2135.989) (-2139.093) [-2141.743] (-2137.764) -- 0:03:27
59500 -- (-2135.274) (-2132.159) (-2139.212) [-2136.802] * (-2137.024) [-2131.108] (-2139.141) (-2136.684) -- 0:03:25
60000 -- (-2135.782) (-2133.192) (-2133.685) [-2130.937] * (-2131.810) (-2144.083) (-2141.185) [-2129.028] -- 0:03:23
Average standard deviation of split frequencies: 0.041442
60500 -- [-2133.587] (-2139.751) (-2139.693) (-2132.422) * (-2132.268) [-2133.096] (-2140.854) (-2137.373) -- 0:03:37
61000 -- (-2134.223) [-2130.604] (-2132.942) (-2138.200) * (-2138.140) (-2135.772) (-2142.435) [-2134.708] -- 0:03:35
61500 -- (-2138.472) [-2137.218] (-2131.041) (-2130.687) * (-2133.763) (-2139.422) [-2138.695] (-2136.201) -- 0:03:33
62000 -- [-2133.533] (-2132.327) (-2135.230) (-2133.116) * (-2133.699) (-2137.098) (-2132.267) [-2133.355] -- 0:03:31
62500 -- (-2135.692) (-2133.822) (-2141.222) [-2138.870] * (-2140.853) (-2133.060) [-2134.538] (-2137.388) -- 0:03:30
63000 -- (-2134.018) (-2137.898) (-2135.153) [-2135.400] * [-2135.032] (-2133.813) (-2131.422) (-2138.130) -- 0:03:28
63500 -- (-2135.521) (-2139.663) [-2137.491] (-2138.591) * (-2138.630) [-2136.043] (-2133.238) (-2140.922) -- 0:03:26
64000 -- (-2134.305) (-2136.188) [-2137.136] (-2142.451) * (-2139.626) [-2133.111] (-2133.939) (-2135.488) -- 0:03:24
64500 -- (-2133.218) [-2134.692] (-2133.979) (-2141.227) * [-2134.895] (-2137.963) (-2134.117) (-2133.515) -- 0:03:23
65000 -- (-2133.350) (-2135.953) (-2140.055) [-2134.234] * [-2129.340] (-2140.434) (-2135.698) (-2135.601) -- 0:03:35
Average standard deviation of split frequencies: 0.038093
65500 -- (-2136.931) (-2134.885) [-2131.616] (-2139.006) * [-2132.764] (-2143.743) (-2135.288) (-2136.670) -- 0:03:34
66000 -- (-2137.432) (-2132.307) [-2143.300] (-2147.439) * [-2136.169] (-2142.162) (-2133.527) (-2140.672) -- 0:03:32
66500 -- (-2136.594) (-2136.242) [-2131.527] (-2140.114) * [-2139.181] (-2138.764) (-2131.502) (-2139.512) -- 0:03:30
67000 -- (-2138.475) (-2130.461) (-2141.526) [-2135.393] * (-2136.904) (-2135.915) [-2135.429] (-2135.417) -- 0:03:28
67500 -- (-2141.004) (-2132.704) [-2132.278] (-2143.232) * [-2135.842] (-2145.391) (-2134.633) (-2133.664) -- 0:03:27
68000 -- [-2138.700] (-2134.578) (-2137.379) (-2138.537) * [-2135.457] (-2133.136) (-2131.733) (-2136.554) -- 0:03:25
68500 -- (-2137.850) (-2146.230) (-2133.686) [-2133.567] * [-2133.403] (-2137.097) (-2132.408) (-2137.354) -- 0:03:23
69000 -- (-2134.484) (-2133.379) (-2135.445) [-2137.144] * (-2134.163) (-2133.945) [-2132.991] (-2131.327) -- 0:03:22
69500 -- (-2136.625) (-2141.290) (-2135.441) [-2137.817] * [-2135.821] (-2136.816) (-2133.126) (-2136.166) -- 0:03:34
70000 -- (-2137.821) [-2135.520] (-2136.823) (-2132.807) * [-2139.101] (-2135.603) (-2134.896) (-2136.474) -- 0:03:32
Average standard deviation of split frequencies: 0.046696
70500 -- (-2139.220) (-2141.115) (-2137.069) [-2134.279] * (-2135.028) (-2137.092) [-2133.339] (-2133.250) -- 0:03:30
71000 -- (-2137.440) (-2134.337) (-2134.036) [-2140.440] * (-2130.179) (-2135.986) (-2133.032) [-2134.015] -- 0:03:29
71500 -- (-2139.213) (-2132.225) [-2133.513] (-2135.289) * (-2134.484) (-2139.328) (-2139.508) [-2137.827] -- 0:03:27
72000 -- (-2139.245) (-2134.314) (-2133.397) [-2131.315] * [-2133.866] (-2134.978) (-2134.606) (-2132.836) -- 0:03:26
72500 -- [-2141.648] (-2139.085) (-2138.694) (-2132.618) * [-2132.115] (-2134.116) (-2138.535) (-2139.195) -- 0:03:24
73000 -- (-2141.220) (-2143.923) [-2137.527] (-2133.953) * [-2135.112] (-2131.958) (-2131.692) (-2137.066) -- 0:03:23
73500 -- (-2141.897) (-2137.876) [-2141.071] (-2136.824) * (-2135.075) (-2131.007) [-2131.788] (-2133.659) -- 0:03:21
74000 -- (-2140.736) [-2132.064] (-2136.584) (-2134.237) * (-2135.616) [-2133.847] (-2142.441) (-2135.541) -- 0:03:32
74500 -- (-2140.367) (-2132.587) [-2135.914] (-2154.160) * (-2134.244) [-2133.567] (-2137.916) (-2133.868) -- 0:03:31
75000 -- (-2129.836) [-2132.906] (-2135.923) (-2136.782) * [-2132.787] (-2137.603) (-2135.157) (-2134.576) -- 0:03:29
Average standard deviation of split frequencies: 0.018608
75500 -- (-2135.331) (-2140.452) [-2137.733] (-2136.637) * (-2135.198) [-2131.237] (-2135.784) (-2133.821) -- 0:03:28
76000 -- (-2140.918) (-2137.220) (-2136.666) [-2137.085] * (-2139.132) [-2137.543] (-2135.099) (-2134.260) -- 0:03:26
76500 -- (-2138.349) (-2135.433) (-2134.799) [-2135.123] * (-2138.387) (-2135.315) (-2135.365) [-2135.706] -- 0:03:25
77000 -- (-2134.636) (-2135.140) [-2132.618] (-2137.372) * (-2132.783) (-2140.226) [-2133.350] (-2134.983) -- 0:03:23
77500 -- (-2139.934) (-2137.010) [-2134.770] (-2133.480) * (-2133.331) (-2136.747) [-2135.885] (-2133.578) -- 0:03:22
78000 -- [-2134.290] (-2142.466) (-2144.120) (-2134.520) * (-2132.154) [-2132.916] (-2134.214) (-2142.776) -- 0:03:20
78500 -- (-2136.310) [-2135.661] (-2136.998) (-2135.818) * (-2136.536) [-2134.129] (-2138.343) (-2141.315) -- 0:03:31
79000 -- [-2129.794] (-2134.614) (-2131.623) (-2136.823) * [-2132.348] (-2139.308) (-2133.726) (-2143.178) -- 0:03:29
79500 -- [-2133.388] (-2134.744) (-2134.916) (-2143.839) * [-2136.191] (-2134.350) (-2133.086) (-2138.096) -- 0:03:28
80000 -- (-2134.752) [-2133.611] (-2135.869) (-2135.558) * [-2133.041] (-2135.112) (-2135.459) (-2133.595) -- 0:03:27
Average standard deviation of split frequencies: 0.011688
80500 -- (-2133.887) [-2132.020] (-2139.546) (-2140.712) * (-2133.316) (-2135.760) [-2136.633] (-2134.396) -- 0:03:25
81000 -- (-2134.077) [-2133.765] (-2136.003) (-2132.299) * (-2135.749) [-2131.497] (-2134.416) (-2132.174) -- 0:03:24
81500 -- (-2134.036) (-2137.902) [-2134.153] (-2134.099) * (-2133.537) (-2135.625) [-2138.681] (-2133.341) -- 0:03:22
82000 -- (-2137.349) (-2140.408) [-2135.437] (-2132.854) * (-2147.612) (-2135.807) (-2139.171) [-2136.707] -- 0:03:21
82500 -- [-2132.201] (-2141.251) (-2141.288) (-2139.120) * [-2133.153] (-2136.055) (-2133.458) (-2131.725) -- 0:03:20
83000 -- [-2134.928] (-2139.804) (-2140.239) (-2138.288) * (-2135.967) (-2140.000) [-2134.027] (-2136.106) -- 0:03:29
83500 -- [-2135.245] (-2138.821) (-2135.075) (-2137.202) * [-2144.004] (-2133.777) (-2136.691) (-2142.005) -- 0:03:28
84000 -- [-2133.223] (-2133.855) (-2130.987) (-2135.186) * (-2136.255) (-2134.545) (-2135.244) [-2134.650] -- 0:03:27
84500 -- (-2143.328) (-2137.888) [-2137.178] (-2141.501) * (-2138.914) [-2137.535] (-2139.323) (-2136.015) -- 0:03:25
85000 -- (-2136.820) (-2139.995) [-2133.849] (-2136.146) * [-2132.240] (-2137.201) (-2141.564) (-2133.876) -- 0:03:24
Average standard deviation of split frequencies: 0.014617
85500 -- (-2139.276) (-2138.350) [-2132.539] (-2136.459) * (-2136.605) (-2134.665) (-2136.835) [-2131.332] -- 0:03:23
86000 -- (-2139.071) [-2131.473] (-2134.231) (-2138.220) * (-2137.054) [-2133.973] (-2134.367) (-2130.983) -- 0:03:21
86500 -- (-2135.663) (-2131.646) [-2133.438] (-2137.420) * (-2137.907) (-2135.418) (-2138.030) [-2132.452] -- 0:03:20
87000 -- [-2137.469] (-2133.371) (-2133.980) (-2137.832) * [-2134.700] (-2132.155) (-2132.830) (-2138.219) -- 0:03:19
87500 -- (-2140.392) (-2134.344) [-2131.135] (-2139.336) * (-2138.427) [-2136.469] (-2132.972) (-2139.833) -- 0:03:28
88000 -- (-2135.204) [-2134.420] (-2138.779) (-2132.343) * [-2134.689] (-2137.445) (-2137.127) (-2137.919) -- 0:03:27
88500 -- (-2136.755) [-2132.710] (-2137.135) (-2137.934) * (-2133.592) (-2137.010) (-2139.450) [-2132.523] -- 0:03:25
89000 -- [-2133.265] (-2134.039) (-2132.880) (-2134.672) * [-2136.637] (-2135.549) (-2138.425) (-2138.124) -- 0:03:24
89500 -- (-2137.527) (-2139.666) (-2144.766) [-2130.789] * (-2136.442) (-2136.100) [-2143.779] (-2133.387) -- 0:03:23
90000 -- (-2137.036) (-2133.996) (-2141.878) [-2136.224] * (-2129.820) [-2134.328] (-2136.119) (-2136.168) -- 0:03:22
Average standard deviation of split frequencies: 0.003466
90500 -- (-2136.571) (-2136.522) (-2135.192) [-2132.288] * (-2134.661) [-2135.625] (-2136.748) (-2135.304) -- 0:03:20
91000 -- (-2135.522) (-2139.948) [-2135.032] (-2135.515) * (-2133.217) [-2133.467] (-2137.909) (-2137.224) -- 0:03:19
91500 -- (-2137.112) [-2131.916] (-2139.344) (-2131.412) * (-2134.943) (-2135.622) [-2134.833] (-2135.451) -- 0:03:28
92000 -- (-2137.760) [-2134.129] (-2144.565) (-2133.999) * (-2131.892) (-2143.994) [-2132.967] (-2135.803) -- 0:03:27
92500 -- [-2133.117] (-2133.498) (-2134.490) (-2134.916) * (-2138.207) (-2133.591) (-2133.598) [-2132.895] -- 0:03:26
93000 -- (-2138.045) (-2134.199) [-2136.653] (-2135.800) * (-2130.770) (-2135.871) [-2133.278] (-2133.713) -- 0:03:24
93500 -- [-2135.511] (-2135.409) (-2133.419) (-2135.013) * [-2130.330] (-2140.759) (-2139.155) (-2133.346) -- 0:03:23
94000 -- (-2133.939) [-2134.432] (-2134.535) (-2138.432) * (-2138.792) (-2135.375) (-2130.536) [-2139.656] -- 0:03:22
94500 -- (-2133.915) (-2138.560) (-2131.989) [-2140.938] * (-2131.410) [-2136.554] (-2135.821) (-2132.586) -- 0:03:21
95000 -- (-2135.052) (-2141.372) (-2131.275) [-2138.059] * (-2135.277) (-2135.175) [-2133.158] (-2131.091) -- 0:03:20
Average standard deviation of split frequencies: 0.001637
95500 -- (-2140.491) (-2135.893) (-2134.565) [-2135.329] * (-2139.986) [-2129.270] (-2142.772) (-2136.237) -- 0:03:18
96000 -- (-2139.248) (-2134.610) (-2134.418) [-2138.114] * (-2142.442) (-2136.334) (-2137.390) [-2133.348] -- 0:03:27
96500 -- (-2132.003) [-2133.114] (-2141.089) (-2144.486) * (-2137.332) (-2132.283) (-2140.127) [-2134.144] -- 0:03:25
97000 -- (-2138.007) (-2133.299) (-2140.022) [-2138.769] * (-2134.729) (-2138.248) [-2139.451] (-2139.263) -- 0:03:24
97500 -- [-2134.614] (-2133.902) (-2135.265) (-2133.026) * (-2135.794) (-2137.064) (-2138.147) [-2132.162] -- 0:03:23
98000 -- (-2136.617) (-2137.789) [-2136.922] (-2138.903) * (-2141.812) [-2133.463] (-2134.293) (-2129.067) -- 0:03:22
98500 -- (-2138.920) (-2136.156) (-2138.342) [-2134.656] * (-2138.925) [-2133.313] (-2131.887) (-2133.814) -- 0:03:21
99000 -- (-2139.560) [-2138.829] (-2139.945) (-2133.651) * (-2140.584) (-2135.730) (-2142.745) [-2134.242] -- 0:03:20
99500 -- (-2140.077) [-2135.737] (-2133.693) (-2136.847) * (-2139.639) [-2139.471] (-2145.307) (-2140.469) -- 0:03:19
100000 -- (-2141.741) (-2133.736) [-2134.850] (-2132.619) * (-2141.210) (-2131.757) (-2132.343) [-2135.778] -- 0:03:18
Average standard deviation of split frequencies: 0.010927
100500 -- (-2140.120) (-2131.426) [-2135.485] (-2134.538) * (-2141.560) (-2130.594) [-2132.794] (-2137.144) -- 0:03:25
101000 -- (-2135.832) (-2138.186) (-2140.211) [-2135.274] * (-2134.011) (-2130.093) (-2137.279) [-2136.177] -- 0:03:24
101500 -- (-2133.415) [-2135.671] (-2135.014) (-2134.353) * (-2135.204) (-2139.026) (-2141.745) [-2132.841] -- 0:03:23
102000 -- (-2135.479) (-2131.919) [-2138.695] (-2137.266) * (-2141.275) (-2134.084) (-2130.329) [-2133.369] -- 0:03:22
102500 -- (-2140.660) [-2133.746] (-2142.001) (-2134.432) * (-2134.318) (-2132.266) (-2136.345) [-2135.776] -- 0:03:21
103000 -- (-2144.921) [-2130.115] (-2134.131) (-2130.683) * (-2145.254) (-2134.124) [-2135.619] (-2138.117) -- 0:03:20
103500 -- (-2146.081) (-2134.363) [-2135.417] (-2134.918) * (-2134.494) (-2142.184) (-2137.979) [-2136.521] -- 0:03:19
104000 -- (-2139.203) (-2141.787) [-2132.129] (-2139.072) * (-2135.137) [-2135.115] (-2139.696) (-2136.394) -- 0:03:18
104500 -- (-2139.800) [-2136.954] (-2137.208) (-2138.823) * [-2135.168] (-2132.210) (-2137.186) (-2132.082) -- 0:03:17
105000 -- [-2134.606] (-2133.334) (-2136.664) (-2135.216) * (-2135.608) (-2136.242) (-2137.167) [-2132.707] -- 0:03:24
Average standard deviation of split frequencies: 0.016306
105500 -- (-2144.303) (-2131.724) (-2136.144) [-2138.683] * (-2138.403) (-2144.697) [-2136.556] (-2132.162) -- 0:03:23
106000 -- (-2133.907) (-2131.995) [-2132.882] (-2135.507) * (-2140.208) (-2135.815) (-2133.950) [-2141.829] -- 0:03:22
106500 -- (-2141.272) (-2138.226) (-2138.560) [-2138.085] * (-2137.361) (-2136.951) [-2131.600] (-2144.367) -- 0:03:21
107000 -- [-2136.305] (-2139.063) (-2138.077) (-2134.803) * (-2140.898) [-2136.265] (-2140.687) (-2136.364) -- 0:03:20
107500 -- (-2136.856) (-2137.105) (-2134.870) [-2133.723] * (-2134.080) (-2134.222) [-2133.710] (-2136.256) -- 0:03:19
108000 -- (-2142.586) [-2135.700] (-2139.661) (-2135.495) * (-2133.175) (-2141.555) [-2132.230] (-2137.500) -- 0:03:18
108500 -- (-2134.842) (-2143.051) (-2131.034) [-2132.240] * (-2131.331) [-2133.143] (-2133.829) (-2131.739) -- 0:03:17
109000 -- [-2131.845] (-2138.056) (-2132.799) (-2136.069) * (-2138.908) (-2136.242) [-2133.923] (-2131.565) -- 0:03:16
109500 -- [-2133.829] (-2137.691) (-2132.918) (-2135.222) * (-2136.902) (-2135.507) (-2134.891) [-2132.502] -- 0:03:23
110000 -- [-2135.224] (-2140.722) (-2136.178) (-2134.104) * (-2132.214) (-2139.370) [-2135.177] (-2137.392) -- 0:03:22
Average standard deviation of split frequencies: 0.012779
110500 -- (-2138.780) (-2141.626) (-2140.320) [-2131.525] * (-2131.764) (-2139.050) [-2139.696] (-2134.709) -- 0:03:21
111000 -- (-2134.176) [-2137.324] (-2140.346) (-2131.582) * (-2134.023) (-2136.963) [-2138.413] (-2135.020) -- 0:03:20
111500 -- (-2134.169) [-2138.907] (-2138.412) (-2138.258) * (-2136.402) (-2135.044) (-2137.771) [-2145.943] -- 0:03:19
112000 -- (-2133.500) [-2135.674] (-2139.009) (-2131.404) * (-2136.345) [-2132.829] (-2138.171) (-2139.728) -- 0:03:18
112500 -- (-2139.109) (-2139.106) [-2132.674] (-2130.135) * (-2134.041) [-2135.447] (-2133.854) (-2136.327) -- 0:03:17
113000 -- (-2138.556) [-2133.458] (-2135.017) (-2139.313) * (-2138.647) (-2133.695) (-2136.398) [-2134.074] -- 0:03:16
113500 -- (-2136.300) (-2134.384) (-2137.222) [-2134.375] * (-2144.340) [-2137.127] (-2138.270) (-2136.185) -- 0:03:15
114000 -- (-2137.765) [-2141.974] (-2134.861) (-2135.594) * (-2136.378) [-2134.174] (-2145.334) (-2135.264) -- 0:03:22
114500 -- (-2136.878) (-2136.677) (-2136.391) [-2129.846] * (-2132.764) (-2133.893) (-2137.913) [-2134.015] -- 0:03:21
115000 -- (-2137.619) [-2133.235] (-2132.879) (-2135.677) * [-2134.043] (-2134.666) (-2139.118) (-2133.361) -- 0:03:20
Average standard deviation of split frequencies: 0.006773
115500 -- (-2138.489) (-2131.588) (-2134.637) [-2132.255] * (-2140.283) (-2132.743) (-2131.009) [-2135.178] -- 0:03:19
116000 -- (-2137.658) (-2135.204) [-2137.943] (-2134.888) * [-2132.457] (-2134.358) (-2136.635) (-2137.222) -- 0:03:18
116500 -- [-2137.098] (-2133.514) (-2133.866) (-2136.373) * (-2136.823) (-2136.339) (-2138.740) [-2134.026] -- 0:03:17
117000 -- (-2134.323) [-2137.013] (-2133.888) (-2137.989) * (-2134.077) [-2138.070] (-2134.496) (-2136.680) -- 0:03:16
117500 -- [-2136.700] (-2133.797) (-2130.676) (-2134.702) * [-2134.994] (-2141.828) (-2132.687) (-2132.675) -- 0:03:15
118000 -- (-2135.228) (-2134.222) [-2133.530] (-2136.935) * (-2133.490) (-2143.428) (-2140.262) [-2134.768] -- 0:03:14
118500 -- (-2134.194) [-2134.367] (-2135.625) (-2137.644) * (-2133.926) [-2133.972] (-2136.152) (-2134.546) -- 0:03:20
119000 -- (-2133.974) (-2136.933) (-2136.148) [-2132.243] * [-2131.025] (-2132.211) (-2137.006) (-2135.852) -- 0:03:19
119500 -- (-2137.814) [-2133.731] (-2134.882) (-2133.324) * (-2138.736) (-2132.848) (-2133.992) [-2136.518] -- 0:03:18
120000 -- (-2143.553) (-2139.965) [-2137.369] (-2133.730) * (-2137.460) (-2147.046) [-2135.773] (-2140.297) -- 0:03:18
Average standard deviation of split frequencies: 0.006511
120500 -- [-2139.366] (-2135.202) (-2136.831) (-2137.308) * (-2132.137) (-2138.223) [-2139.760] (-2134.970) -- 0:03:17
121000 -- [-2139.942] (-2132.632) (-2136.153) (-2138.236) * (-2130.201) [-2133.523] (-2132.303) (-2135.356) -- 0:03:16
121500 -- (-2138.328) [-2133.083] (-2136.381) (-2141.581) * (-2134.125) (-2131.955) (-2138.841) [-2139.892] -- 0:03:15
122000 -- (-2137.556) (-2135.701) [-2135.179] (-2137.648) * (-2135.892) [-2132.668] (-2131.540) (-2137.565) -- 0:03:14
122500 -- (-2136.770) (-2137.596) (-2141.007) [-2137.459] * [-2139.418] (-2132.844) (-2134.326) (-2138.344) -- 0:03:13
123000 -- (-2134.103) (-2134.553) [-2133.671] (-2139.952) * (-2142.901) (-2137.514) (-2134.563) [-2136.093] -- 0:03:19
123500 -- (-2138.554) (-2139.704) [-2137.022] (-2139.256) * (-2143.656) (-2135.887) (-2133.848) [-2131.327] -- 0:03:18
124000 -- (-2142.938) [-2134.817] (-2140.305) (-2146.550) * [-2137.158] (-2138.626) (-2135.645) (-2137.081) -- 0:03:17
124500 -- (-2134.916) (-2134.539) (-2136.460) [-2137.965] * (-2136.885) [-2135.162] (-2135.060) (-2141.753) -- 0:03:16
125000 -- [-2133.034] (-2132.269) (-2137.485) (-2138.167) * (-2132.974) (-2138.273) (-2135.061) [-2132.093] -- 0:03:16
Average standard deviation of split frequencies: 0.013718
125500 -- (-2138.894) (-2138.035) [-2139.656] (-2136.572) * [-2139.007] (-2131.636) (-2135.620) (-2132.688) -- 0:03:15
126000 -- (-2135.687) (-2134.149) (-2141.329) [-2139.100] * [-2141.033] (-2145.080) (-2134.740) (-2132.979) -- 0:03:14
126500 -- (-2133.851) (-2133.648) (-2133.277) [-2134.089] * (-2136.389) (-2139.062) [-2136.944] (-2136.473) -- 0:03:13
127000 -- [-2136.800] (-2132.040) (-2143.058) (-2134.489) * (-2141.634) [-2141.728] (-2133.555) (-2131.897) -- 0:03:12
127500 -- (-2133.453) (-2136.000) (-2135.657) [-2132.626] * (-2137.082) (-2144.927) (-2129.174) [-2130.490] -- 0:03:18
128000 -- (-2132.292) (-2131.972) [-2132.295] (-2134.046) * (-2135.504) (-2141.306) [-2132.835] (-2135.616) -- 0:03:17
128500 -- (-2134.008) (-2138.433) [-2132.492] (-2135.276) * [-2141.160] (-2138.267) (-2129.301) (-2129.927) -- 0:03:16
129000 -- (-2133.997) (-2138.866) [-2138.714] (-2136.072) * (-2138.537) (-2134.937) (-2140.099) [-2133.402] -- 0:03:15
129500 -- (-2143.337) [-2135.795] (-2136.961) (-2134.027) * (-2134.310) (-2133.541) (-2137.559) [-2131.440] -- 0:03:14
130000 -- [-2137.813] (-2139.576) (-2139.310) (-2131.193) * (-2133.338) (-2132.505) (-2137.062) [-2131.571] -- 0:03:14
Average standard deviation of split frequencies: 0.008418
130500 -- (-2135.665) [-2135.027] (-2137.754) (-2128.979) * (-2133.958) [-2132.709] (-2139.794) (-2138.521) -- 0:03:13
131000 -- (-2132.826) (-2136.402) [-2132.585] (-2132.708) * [-2135.390] (-2134.996) (-2136.709) (-2135.321) -- 0:03:12
131500 -- (-2134.800) (-2131.833) (-2133.282) [-2133.231] * (-2143.296) (-2136.429) [-2130.974] (-2134.716) -- 0:03:11
132000 -- (-2131.948) (-2136.043) [-2142.871] (-2134.033) * (-2138.311) (-2135.987) [-2134.663] (-2140.950) -- 0:03:17
132500 -- (-2131.438) (-2144.579) (-2134.802) [-2137.010] * [-2137.870] (-2142.815) (-2142.228) (-2131.570) -- 0:03:16
133000 -- (-2136.045) [-2132.714] (-2132.643) (-2136.244) * (-2132.218) (-2142.316) [-2132.716] (-2134.455) -- 0:03:15
133500 -- (-2129.659) [-2127.940] (-2133.095) (-2133.576) * (-2130.477) (-2133.160) [-2132.629] (-2133.181) -- 0:03:14
134000 -- (-2142.510) (-2131.656) [-2136.359] (-2145.553) * (-2134.481) (-2130.135) (-2139.296) [-2134.538] -- 0:03:13
134500 -- (-2138.481) [-2133.560] (-2132.809) (-2138.521) * (-2135.554) (-2132.699) (-2141.517) [-2132.464] -- 0:03:13
135000 -- (-2132.402) [-2134.890] (-2134.423) (-2138.135) * (-2139.993) (-2132.944) [-2132.260] (-2135.786) -- 0:03:12
Average standard deviation of split frequencies: 0.015020
135500 -- [-2132.419] (-2142.660) (-2144.890) (-2133.571) * [-2134.070] (-2140.032) (-2134.230) (-2137.235) -- 0:03:11
136000 -- [-2137.731] (-2133.403) (-2136.460) (-2140.135) * (-2137.672) (-2139.901) (-2133.401) [-2134.724] -- 0:03:10
136500 -- (-2132.928) (-2139.276) (-2132.643) [-2128.835] * [-2136.564] (-2135.915) (-2131.887) (-2136.164) -- 0:03:16
137000 -- (-2136.015) (-2137.305) [-2132.363] (-2131.315) * [-2134.829] (-2137.510) (-2130.680) (-2135.229) -- 0:03:15
137500 -- (-2139.053) (-2134.197) (-2132.844) [-2134.783] * (-2140.876) [-2136.835] (-2134.291) (-2136.200) -- 0:03:14
138000 -- [-2131.321] (-2133.848) (-2133.161) (-2135.630) * (-2140.763) (-2142.172) [-2130.831] (-2134.005) -- 0:03:13
138500 -- [-2136.425] (-2134.562) (-2133.003) (-2137.834) * (-2138.061) (-2144.873) [-2135.078] (-2133.179) -- 0:03:12
139000 -- (-2136.670) (-2134.766) (-2140.865) [-2128.978] * [-2140.385] (-2138.987) (-2141.469) (-2136.439) -- 0:03:12
139500 -- [-2132.618] (-2137.307) (-2137.329) (-2134.478) * [-2135.030] (-2136.408) (-2136.928) (-2136.145) -- 0:03:11
140000 -- (-2135.411) [-2138.395] (-2142.442) (-2137.882) * [-2133.031] (-2137.056) (-2140.355) (-2134.973) -- 0:03:10
Average standard deviation of split frequencies: 0.012288
140500 -- (-2133.725) (-2132.422) [-2135.650] (-2135.502) * (-2134.083) [-2134.155] (-2130.772) (-2138.768) -- 0:03:09
141000 -- (-2136.827) (-2134.854) (-2136.846) [-2131.538] * (-2134.896) (-2132.342) (-2131.856) [-2140.396] -- 0:03:14
141500 -- (-2137.057) (-2132.114) [-2133.092] (-2135.562) * (-2138.685) [-2131.229] (-2134.843) (-2142.164) -- 0:03:14
142000 -- (-2135.928) (-2132.712) [-2133.833] (-2133.593) * [-2134.244] (-2130.638) (-2134.218) (-2137.775) -- 0:03:13
142500 -- (-2137.889) (-2135.352) (-2131.564) [-2134.833] * (-2138.223) (-2132.105) (-2134.810) [-2137.304] -- 0:03:12
143000 -- (-2133.981) (-2135.860) (-2137.410) [-2133.636] * [-2135.177] (-2136.896) (-2142.142) (-2134.235) -- 0:03:11
143500 -- (-2137.821) [-2136.685] (-2139.872) (-2132.414) * [-2134.824] (-2137.254) (-2136.257) (-2140.528) -- 0:03:10
144000 -- (-2135.155) [-2135.380] (-2133.125) (-2140.220) * (-2137.558) (-2136.392) (-2133.550) [-2137.846] -- 0:03:10
144500 -- (-2139.114) (-2142.503) [-2136.403] (-2141.892) * (-2137.546) [-2129.552] (-2137.256) (-2138.384) -- 0:03:09
145000 -- [-2134.969] (-2139.952) (-2137.687) (-2137.746) * (-2138.792) (-2130.055) [-2139.905] (-2137.036) -- 0:03:08
Average standard deviation of split frequencies: 0.011839
145500 -- (-2132.783) (-2143.230) (-2134.851) [-2134.251] * [-2133.523] (-2134.729) (-2134.875) (-2143.314) -- 0:03:13
146000 -- [-2133.209] (-2142.725) (-2138.491) (-2135.582) * (-2132.850) (-2138.149) [-2134.588] (-2136.464) -- 0:03:13
146500 -- [-2133.499] (-2138.024) (-2134.198) (-2137.209) * (-2135.074) [-2132.312] (-2131.140) (-2136.970) -- 0:03:12
147000 -- [-2132.873] (-2141.871) (-2137.587) (-2135.000) * [-2132.813] (-2136.253) (-2135.316) (-2139.298) -- 0:03:11
147500 -- [-2131.863] (-2137.145) (-2143.553) (-2139.547) * [-2134.960] (-2142.992) (-2133.420) (-2135.276) -- 0:03:10
148000 -- [-2131.332] (-2138.435) (-2147.867) (-2137.003) * [-2132.509] (-2141.625) (-2134.986) (-2139.741) -- 0:03:09
148500 -- [-2133.549] (-2137.419) (-2142.858) (-2134.870) * (-2139.317) (-2140.557) [-2134.646] (-2142.961) -- 0:03:09
149000 -- (-2133.644) (-2137.205) (-2142.032) [-2139.717] * (-2134.919) (-2145.159) [-2135.741] (-2132.122) -- 0:03:08
149500 -- [-2139.729] (-2136.144) (-2143.165) (-2132.240) * (-2137.557) (-2139.634) [-2131.567] (-2131.915) -- 0:03:07
150000 -- (-2137.059) (-2134.778) (-2139.803) [-2133.173] * (-2140.809) [-2133.676] (-2131.198) (-2137.632) -- 0:03:12
Average standard deviation of split frequencies: 0.003129
150500 -- (-2141.211) (-2132.566) (-2138.470) [-2129.740] * [-2139.228] (-2138.214) (-2132.572) (-2132.475) -- 0:03:11
151000 -- (-2134.678) (-2135.531) (-2134.821) [-2129.098] * (-2132.449) (-2137.668) [-2134.756] (-2140.827) -- 0:03:11
151500 -- (-2132.415) (-2131.961) [-2136.573] (-2130.242) * (-2132.140) (-2140.488) (-2135.354) [-2133.352] -- 0:03:10
152000 -- [-2129.949] (-2134.900) (-2136.326) (-2136.609) * (-2140.942) (-2139.159) [-2138.141] (-2135.550) -- 0:03:09
152500 -- [-2133.242] (-2131.621) (-2133.735) (-2133.431) * (-2133.625) (-2133.066) [-2135.186] (-2131.448) -- 0:03:08
153000 -- [-2131.952] (-2139.220) (-2136.729) (-2136.364) * [-2135.880] (-2135.428) (-2135.749) (-2141.274) -- 0:03:08
153500 -- [-2134.755] (-2134.442) (-2135.366) (-2137.487) * [-2136.501] (-2136.279) (-2136.335) (-2138.501) -- 0:03:07
154000 -- (-2134.476) [-2132.737] (-2132.053) (-2134.442) * (-2135.628) [-2132.184] (-2133.371) (-2131.958) -- 0:03:06
154500 -- (-2133.744) (-2136.993) [-2138.113] (-2138.556) * (-2131.056) [-2132.713] (-2133.780) (-2134.690) -- 0:03:11
155000 -- (-2135.816) (-2134.547) [-2133.434] (-2136.708) * [-2131.573] (-2138.060) (-2135.213) (-2133.046) -- 0:03:10
Average standard deviation of split frequencies: 0.002015
155500 -- [-2134.871] (-2135.195) (-2136.656) (-2131.241) * [-2135.728] (-2136.680) (-2138.571) (-2133.862) -- 0:03:10
156000 -- (-2132.567) (-2130.148) (-2132.571) [-2132.694] * (-2143.224) (-2141.168) (-2139.224) [-2138.096] -- 0:03:09
156500 -- (-2136.987) [-2135.275] (-2133.297) (-2133.779) * [-2137.632] (-2138.204) (-2146.600) (-2134.351) -- 0:03:08
157000 -- (-2132.484) [-2137.613] (-2133.293) (-2134.530) * (-2138.521) [-2143.223] (-2139.450) (-2134.658) -- 0:03:07
157500 -- (-2135.626) (-2140.576) [-2131.088] (-2130.096) * [-2135.083] (-2136.629) (-2139.776) (-2140.178) -- 0:03:07
158000 -- (-2141.577) (-2142.558) (-2133.116) [-2132.806] * (-2137.332) (-2136.931) [-2140.793] (-2135.143) -- 0:03:06
158500 -- [-2135.560] (-2135.337) (-2135.887) (-2141.020) * (-2147.593) (-2132.469) (-2136.188) [-2134.923] -- 0:03:05
159000 -- (-2134.983) (-2135.151) [-2140.021] (-2132.443) * (-2131.528) [-2133.266] (-2137.985) (-2141.276) -- 0:03:10
159500 -- (-2131.087) (-2139.041) (-2137.298) [-2138.604] * (-2132.172) [-2135.521] (-2133.656) (-2134.554) -- 0:03:09
160000 -- (-2134.288) (-2137.182) (-2140.818) [-2135.334] * (-2136.511) [-2138.827] (-2135.880) (-2134.885) -- 0:03:09
Average standard deviation of split frequencies: 0.003912
160500 -- (-2139.932) [-2131.328] (-2131.118) (-2130.596) * (-2138.732) (-2138.431) [-2133.100] (-2141.901) -- 0:03:08
161000 -- (-2148.813) (-2132.102) [-2132.208] (-2135.331) * (-2136.747) [-2139.384] (-2134.389) (-2137.207) -- 0:03:07
161500 -- (-2142.689) [-2134.721] (-2136.167) (-2137.337) * [-2133.170] (-2133.009) (-2131.556) (-2148.817) -- 0:03:06
162000 -- (-2136.718) (-2132.434) [-2135.953] (-2139.945) * (-2134.100) [-2135.362] (-2137.726) (-2139.366) -- 0:03:06
162500 -- (-2136.959) (-2138.947) [-2132.269] (-2137.626) * (-2137.571) (-2136.122) [-2134.581] (-2142.918) -- 0:03:05
163000 -- [-2132.438] (-2137.222) (-2133.249) (-2132.641) * (-2148.956) [-2137.194] (-2133.399) (-2137.906) -- 0:03:04
163500 -- (-2136.764) [-2130.225] (-2131.225) (-2137.533) * (-2141.904) [-2135.935] (-2133.938) (-2137.418) -- 0:03:09
164000 -- (-2133.783) (-2142.706) (-2138.623) [-2130.643] * (-2143.010) [-2131.087] (-2132.230) (-2135.774) -- 0:03:08
164500 -- [-2130.458] (-2139.890) (-2139.796) (-2129.841) * (-2138.955) (-2136.650) (-2139.083) [-2133.233] -- 0:03:07
165000 -- [-2140.948] (-2134.343) (-2142.355) (-2137.060) * (-2143.291) (-2138.283) [-2135.948] (-2136.241) -- 0:03:07
Average standard deviation of split frequencies: 0.007573
165500 -- (-2135.240) (-2140.248) [-2138.614] (-2140.153) * (-2137.760) [-2137.624] (-2137.025) (-2139.651) -- 0:03:06
166000 -- (-2141.990) [-2130.277] (-2138.393) (-2135.774) * (-2131.482) (-2137.982) [-2134.882] (-2141.805) -- 0:03:05
166500 -- [-2136.789] (-2134.983) (-2132.431) (-2134.736) * [-2135.529] (-2134.157) (-2129.058) (-2136.950) -- 0:03:05
167000 -- [-2133.546] (-2136.235) (-2142.373) (-2133.403) * (-2133.303) [-2135.577] (-2136.543) (-2133.197) -- 0:03:04
167500 -- (-2132.725) [-2135.465] (-2142.235) (-2131.268) * [-2132.061] (-2132.006) (-2135.894) (-2136.340) -- 0:03:03
168000 -- [-2132.257] (-2133.229) (-2136.422) (-2137.478) * (-2132.322) [-2136.134] (-2134.219) (-2132.855) -- 0:03:08
168500 -- (-2134.961) (-2133.488) [-2131.413] (-2136.358) * (-2136.627) (-2132.758) (-2135.410) [-2132.713] -- 0:03:07
169000 -- (-2140.506) (-2131.206) [-2132.081] (-2139.647) * [-2137.796] (-2133.303) (-2138.562) (-2138.440) -- 0:03:06
169500 -- (-2136.827) [-2132.924] (-2138.085) (-2132.897) * (-2143.391) [-2132.350] (-2137.754) (-2135.443) -- 0:03:06
170000 -- (-2134.014) (-2136.655) (-2136.381) [-2132.893] * (-2134.171) (-2136.866) (-2137.346) [-2135.761] -- 0:03:05
Average standard deviation of split frequencies: 0.010128
170500 -- (-2135.586) [-2132.020] (-2140.674) (-2142.890) * [-2133.554] (-2133.193) (-2142.942) (-2141.868) -- 0:03:04
171000 -- (-2140.087) (-2136.371) (-2147.111) [-2137.750] * (-2138.858) (-2136.609) (-2138.613) [-2132.331] -- 0:03:04
171500 -- (-2135.969) (-2135.414) (-2143.015) [-2136.172] * (-2138.752) [-2132.326] (-2136.482) (-2136.283) -- 0:03:03
172000 -- (-2132.094) (-2135.694) [-2138.695] (-2135.762) * [-2138.818] (-2138.921) (-2134.166) (-2133.669) -- 0:03:02
172500 -- (-2135.414) (-2136.452) (-2137.845) [-2135.208] * (-2132.992) (-2139.954) (-2135.244) [-2130.816] -- 0:03:07
173000 -- [-2130.098] (-2135.259) (-2136.699) (-2132.459) * (-2140.113) (-2138.497) [-2131.309] (-2135.911) -- 0:03:06
173500 -- (-2138.149) (-2132.879) (-2137.819) [-2133.199] * (-2133.518) (-2138.784) (-2136.438) [-2138.335] -- 0:03:05
174000 -- [-2135.796] (-2136.355) (-2148.037) (-2137.950) * (-2136.055) (-2133.821) (-2135.513) [-2136.113] -- 0:03:05
174500 -- (-2131.061) (-2148.504) (-2136.759) [-2133.854] * [-2136.416] (-2135.588) (-2136.430) (-2140.608) -- 0:03:04
175000 -- (-2130.627) [-2131.059] (-2131.810) (-2138.512) * (-2137.064) (-2135.417) (-2133.819) [-2131.206] -- 0:03:03
Average standard deviation of split frequencies: 0.006250
175500 -- (-2130.864) (-2135.960) (-2135.216) [-2134.605] * (-2143.688) (-2135.743) (-2131.938) [-2135.931] -- 0:03:03
176000 -- (-2139.185) (-2136.623) [-2139.060] (-2134.757) * (-2139.972) [-2135.625] (-2132.604) (-2140.258) -- 0:03:02
176500 -- (-2133.361) (-2137.011) [-2132.259] (-2136.515) * (-2136.789) (-2140.176) [-2137.851] (-2137.479) -- 0:03:01
177000 -- (-2135.363) (-2133.192) [-2132.499] (-2140.579) * (-2133.097) [-2137.333] (-2138.473) (-2139.618) -- 0:03:05
177500 -- (-2135.958) [-2135.596] (-2133.426) (-2135.401) * (-2139.179) (-2144.623) [-2133.229] (-2134.901) -- 0:03:05
178000 -- (-2136.301) [-2140.949] (-2136.232) (-2134.599) * [-2134.241] (-2134.901) (-2134.666) (-2132.677) -- 0:03:04
178500 -- (-2135.659) (-2136.739) (-2141.045) [-2133.189] * (-2139.822) (-2134.480) (-2136.640) [-2130.081] -- 0:03:04
179000 -- (-2131.704) (-2134.703) [-2137.137] (-2139.548) * (-2136.536) (-2138.423) (-2132.029) [-2131.209] -- 0:03:03
179500 -- (-2135.397) [-2132.672] (-2134.760) (-2136.774) * (-2141.282) (-2133.306) [-2134.930] (-2132.337) -- 0:03:02
180000 -- (-2141.487) (-2137.712) (-2133.311) [-2132.356] * (-2137.277) (-2139.322) [-2133.531] (-2135.745) -- 0:03:02
Average standard deviation of split frequencies: 0.004349
180500 -- (-2140.104) (-2135.433) [-2134.792] (-2139.203) * (-2137.153) (-2142.976) [-2134.949] (-2135.271) -- 0:03:01
181000 -- (-2141.616) (-2137.387) (-2140.967) [-2133.686] * [-2134.963] (-2135.134) (-2135.137) (-2139.064) -- 0:03:00
181500 -- (-2134.479) (-2151.338) (-2136.084) [-2133.441] * (-2136.038) [-2134.048] (-2137.947) (-2134.658) -- 0:03:04
182000 -- [-2133.992] (-2137.535) (-2132.035) (-2140.152) * (-2146.168) (-2137.137) (-2132.508) [-2130.306] -- 0:03:04
182500 -- (-2135.089) [-2134.430] (-2139.973) (-2136.213) * [-2136.356] (-2139.828) (-2136.921) (-2137.910) -- 0:03:03
183000 -- (-2133.840) [-2132.565] (-2138.841) (-2134.024) * (-2138.233) (-2133.925) (-2132.669) [-2135.135] -- 0:03:03
183500 -- (-2132.814) (-2139.304) (-2138.358) [-2135.227] * [-2137.555] (-2136.707) (-2137.075) (-2138.925) -- 0:03:02
184000 -- (-2134.899) (-2133.812) (-2139.989) [-2132.872] * (-2144.673) (-2131.864) [-2137.898] (-2137.774) -- 0:03:01
184500 -- (-2130.613) (-2135.347) (-2137.309) [-2136.867] * (-2134.901) (-2133.938) [-2134.911] (-2136.215) -- 0:03:01
185000 -- [-2133.807] (-2134.105) (-2138.111) (-2133.757) * (-2137.269) (-2142.345) (-2136.846) [-2134.939] -- 0:03:00
Average standard deviation of split frequencies: 0.005914
185500 -- (-2136.002) (-2132.041) [-2136.838] (-2137.402) * (-2137.526) (-2141.039) (-2138.042) [-2134.855] -- 0:03:00
186000 -- (-2137.528) [-2132.771] (-2140.503) (-2134.537) * (-2139.500) (-2140.703) [-2133.789] (-2132.796) -- 0:03:03
186500 -- (-2135.581) [-2134.094] (-2135.262) (-2139.631) * [-2140.116] (-2132.682) (-2137.986) (-2131.324) -- 0:03:03
187000 -- (-2133.966) (-2138.229) (-2137.074) [-2137.146] * (-2131.347) (-2135.644) (-2139.927) [-2133.714] -- 0:03:02
187500 -- [-2133.296] (-2140.804) (-2139.946) (-2137.341) * (-2136.704) (-2138.251) (-2133.761) [-2133.898] -- 0:03:02
188000 -- (-2130.712) (-2137.249) (-2137.643) [-2129.109] * (-2140.446) [-2135.153] (-2133.991) (-2131.970) -- 0:03:01
188500 -- (-2146.878) (-2135.511) [-2141.788] (-2133.463) * (-2130.836) (-2137.190) (-2135.643) [-2133.599] -- 0:03:00
189000 -- (-2137.443) [-2133.225] (-2141.389) (-2144.900) * (-2138.494) (-2138.690) (-2141.993) [-2131.385] -- 0:03:00
189500 -- (-2133.057) (-2131.961) (-2138.164) [-2134.639] * (-2137.138) [-2134.862] (-2138.908) (-2137.662) -- 0:02:59
190000 -- (-2139.127) (-2140.432) (-2139.982) [-2138.218] * [-2136.672] (-2135.907) (-2133.775) (-2136.561) -- 0:02:59
Average standard deviation of split frequencies: 0.007417
190500 -- (-2133.556) (-2136.047) [-2135.055] (-2136.618) * [-2133.400] (-2137.603) (-2141.457) (-2141.929) -- 0:03:02
191000 -- [-2133.635] (-2135.861) (-2144.141) (-2131.465) * [-2130.915] (-2134.011) (-2138.892) (-2137.765) -- 0:03:02
191500 -- (-2137.795) (-2134.225) (-2135.687) [-2132.363] * (-2136.385) [-2132.711] (-2135.166) (-2134.278) -- 0:03:01
192000 -- (-2137.147) (-2135.415) [-2134.527] (-2133.111) * [-2133.575] (-2134.808) (-2137.724) (-2134.231) -- 0:03:00
192500 -- (-2133.056) (-2146.365) (-2136.788) [-2130.259] * (-2133.567) (-2139.140) (-2135.384) [-2135.953] -- 0:03:00
193000 -- (-2133.744) (-2137.007) (-2141.615) [-2138.238] * (-2129.872) (-2138.812) [-2134.848] (-2133.678) -- 0:02:59
193500 -- (-2139.314) (-2134.251) [-2138.318] (-2132.915) * (-2134.967) [-2133.700] (-2132.417) (-2136.082) -- 0:02:59
194000 -- [-2131.055] (-2134.897) (-2137.868) (-2133.309) * [-2131.299] (-2135.026) (-2131.483) (-2135.695) -- 0:02:58
194500 -- [-2138.350] (-2134.707) (-2138.330) (-2133.172) * (-2139.560) (-2134.410) (-2140.012) [-2144.991] -- 0:02:58
195000 -- (-2137.068) (-2132.195) [-2130.975] (-2137.541) * (-2140.907) (-2132.348) (-2136.730) [-2137.784] -- 0:03:01
Average standard deviation of split frequencies: 0.002405
195500 -- (-2139.467) [-2134.828] (-2131.793) (-2133.672) * (-2139.431) (-2133.422) [-2131.335] (-2142.894) -- 0:03:01
196000 -- (-2132.837) [-2129.222] (-2135.941) (-2133.967) * (-2135.979) [-2136.468] (-2144.172) (-2141.751) -- 0:03:00
196500 -- (-2134.399) [-2129.670] (-2136.935) (-2139.257) * (-2135.466) (-2134.653) (-2139.604) [-2132.845] -- 0:02:59
197000 -- (-2137.623) (-2138.013) [-2130.410] (-2136.434) * (-2135.193) [-2132.377] (-2136.462) (-2134.492) -- 0:02:59
197500 -- (-2134.130) (-2134.821) (-2131.589) [-2136.010] * (-2133.833) (-2140.786) (-2134.079) [-2134.572] -- 0:02:58
198000 -- (-2137.501) [-2141.083] (-2132.213) (-2133.633) * (-2140.854) (-2132.854) (-2141.195) [-2131.829] -- 0:02:58
198500 -- (-2141.440) [-2132.319] (-2132.211) (-2128.651) * (-2132.760) (-2136.655) (-2138.759) [-2134.055] -- 0:02:57
199000 -- [-2133.324] (-2131.250) (-2135.947) (-2129.528) * [-2135.416] (-2134.059) (-2147.954) (-2145.444) -- 0:02:57
199500 -- (-2132.299) [-2135.776] (-2138.037) (-2130.130) * [-2134.753] (-2131.558) (-2136.940) (-2134.594) -- 0:03:00
200000 -- (-2136.831) [-2137.574] (-2133.816) (-2138.206) * (-2139.091) (-2131.364) (-2139.034) [-2131.175] -- 0:03:00
Average standard deviation of split frequencies: 0.000783
200500 -- [-2136.006] (-2139.374) (-2137.207) (-2133.809) * (-2133.820) (-2132.007) (-2137.862) [-2130.550] -- 0:02:59
201000 -- (-2140.492) [-2141.542] (-2137.460) (-2134.323) * (-2132.578) (-2137.818) [-2140.961] (-2133.997) -- 0:02:58
201500 -- (-2137.986) [-2132.834] (-2132.200) (-2132.747) * (-2131.931) [-2132.658] (-2132.534) (-2133.291) -- 0:02:58
202000 -- (-2138.886) (-2131.365) [-2130.422] (-2132.934) * [-2131.565] (-2135.539) (-2139.348) (-2143.021) -- 0:02:57
202500 -- (-2133.444) (-2133.075) [-2139.962] (-2137.907) * (-2133.148) [-2139.642] (-2134.879) (-2141.063) -- 0:02:57
203000 -- [-2135.668] (-2132.451) (-2137.490) (-2137.878) * (-2138.022) (-2138.134) (-2134.155) [-2132.710] -- 0:02:56
203500 -- (-2134.585) (-2137.464) [-2130.107] (-2137.163) * [-2130.903] (-2134.444) (-2141.640) (-2133.620) -- 0:02:56
204000 -- (-2132.170) (-2137.327) (-2132.274) [-2137.786] * [-2131.800] (-2135.109) (-2137.813) (-2134.908) -- 0:02:59
204500 -- (-2135.596) (-2147.383) [-2133.902] (-2133.665) * (-2135.839) (-2138.191) [-2134.945] (-2133.597) -- 0:02:58
205000 -- (-2135.219) (-2133.743) (-2128.944) [-2135.218] * [-2133.478] (-2145.007) (-2130.337) (-2133.713) -- 0:02:58
Average standard deviation of split frequencies: 0.000000
205500 -- (-2135.498) (-2136.755) [-2135.424] (-2135.547) * (-2133.111) (-2135.190) (-2130.730) [-2134.724] -- 0:02:57
206000 -- (-2133.954) (-2147.398) (-2133.752) [-2135.079] * [-2132.669] (-2139.770) (-2140.620) (-2136.523) -- 0:02:57
206500 -- (-2136.364) [-2132.486] (-2135.237) (-2145.501) * (-2132.383) (-2139.502) [-2133.461] (-2136.795) -- 0:02:56
207000 -- (-2144.094) [-2131.500] (-2134.173) (-2137.373) * (-2137.417) [-2134.077] (-2140.228) (-2132.807) -- 0:02:56
207500 -- (-2134.735) (-2129.694) (-2131.677) [-2136.372] * (-2135.710) [-2134.452] (-2131.458) (-2131.018) -- 0:02:55
208000 -- (-2139.007) (-2137.942) [-2143.872] (-2133.210) * (-2136.940) [-2133.330] (-2138.388) (-2131.154) -- 0:02:55
208500 -- [-2140.132] (-2134.619) (-2133.599) (-2133.840) * [-2140.262] (-2140.838) (-2137.551) (-2134.758) -- 0:02:58
209000 -- (-2141.117) (-2134.275) (-2133.429) [-2133.529] * (-2136.484) (-2138.064) [-2133.986] (-2134.375) -- 0:02:57
209500 -- (-2135.936) [-2133.968] (-2136.928) (-2136.444) * (-2131.841) (-2138.391) (-2131.934) [-2134.485] -- 0:02:57
210000 -- (-2135.076) (-2132.557) [-2136.166] (-2131.355) * [-2133.186] (-2143.300) (-2138.902) (-2138.815) -- 0:02:56
Average standard deviation of split frequencies: 0.002984
210500 -- (-2138.012) (-2134.418) [-2131.100] (-2134.431) * [-2137.687] (-2131.823) (-2136.242) (-2137.351) -- 0:02:56
211000 -- (-2134.759) (-2134.485) [-2136.802] (-2135.305) * (-2137.281) (-2136.606) [-2132.880] (-2130.102) -- 0:02:55
211500 -- (-2137.462) [-2141.820] (-2134.370) (-2134.188) * (-2138.192) (-2131.480) [-2136.576] (-2137.514) -- 0:02:55
212000 -- (-2132.995) (-2134.465) [-2133.954] (-2136.175) * [-2134.563] (-2134.067) (-2136.904) (-2133.008) -- 0:02:54
212500 -- (-2134.837) [-2132.887] (-2131.398) (-2137.495) * (-2139.688) (-2135.391) [-2135.868] (-2137.184) -- 0:02:54
213000 -- [-2141.331] (-2131.476) (-2137.350) (-2141.197) * (-2142.102) (-2133.590) (-2131.596) [-2133.052] -- 0:02:57
213500 -- (-2136.167) [-2136.086] (-2144.271) (-2138.381) * (-2146.485) [-2133.952] (-2138.762) (-2136.319) -- 0:02:56
214000 -- (-2136.721) [-2129.818] (-2141.560) (-2134.334) * (-2138.876) (-2136.551) [-2135.355] (-2137.407) -- 0:02:56
214500 -- (-2138.078) [-2139.023] (-2138.532) (-2132.998) * (-2134.574) (-2137.631) (-2145.658) [-2135.032] -- 0:02:55
215000 -- (-2139.351) (-2134.681) [-2136.722] (-2131.767) * (-2132.916) (-2135.515) (-2139.833) [-2129.661] -- 0:02:55
Average standard deviation of split frequencies: 0.002182
215500 -- (-2132.964) (-2139.851) (-2142.712) [-2133.628] * (-2139.043) (-2136.698) [-2131.685] (-2134.527) -- 0:02:54
216000 -- [-2133.348] (-2141.274) (-2143.882) (-2140.492) * (-2136.308) (-2138.150) [-2129.817] (-2133.055) -- 0:02:54
216500 -- (-2137.765) (-2136.886) [-2136.474] (-2138.325) * (-2143.276) [-2132.000] (-2130.607) (-2134.666) -- 0:02:53
217000 -- [-2134.338] (-2138.911) (-2138.079) (-2141.293) * [-2131.136] (-2129.544) (-2136.420) (-2130.930) -- 0:02:53
217500 -- [-2134.773] (-2133.358) (-2137.990) (-2133.938) * [-2130.453] (-2131.400) (-2134.326) (-2137.816) -- 0:02:56
218000 -- (-2137.414) (-2130.588) [-2137.745] (-2136.427) * (-2135.089) (-2131.571) (-2133.569) [-2137.069] -- 0:02:55
218500 -- (-2136.957) (-2133.535) (-2136.187) [-2133.743] * (-2137.931) [-2132.554] (-2138.745) (-2131.439) -- 0:02:55
219000 -- (-2142.759) (-2134.965) [-2134.890] (-2132.577) * (-2135.090) (-2129.960) [-2131.953] (-2141.883) -- 0:02:54
219500 -- (-2131.525) (-2142.912) [-2139.658] (-2130.492) * (-2136.214) (-2142.746) [-2131.228] (-2138.318) -- 0:02:54
220000 -- (-2132.612) (-2134.383) (-2139.554) [-2137.210] * (-2136.004) (-2131.800) [-2136.034] (-2142.621) -- 0:02:53
Average standard deviation of split frequencies: 0.004985
220500 -- (-2132.471) (-2132.428) (-2140.772) [-2136.561] * (-2139.209) (-2135.760) [-2134.338] (-2136.181) -- 0:02:53
221000 -- [-2133.695] (-2138.436) (-2140.283) (-2134.348) * (-2133.573) [-2133.128] (-2132.994) (-2133.796) -- 0:02:52
221500 -- [-2136.471] (-2136.181) (-2132.557) (-2136.318) * [-2133.121] (-2136.753) (-2137.126) (-2133.513) -- 0:02:52
222000 -- (-2138.426) (-2140.348) [-2132.190] (-2138.456) * [-2138.662] (-2133.755) (-2140.349) (-2139.006) -- 0:02:55
222500 -- (-2135.293) (-2138.674) (-2130.720) [-2130.538] * [-2133.188] (-2139.357) (-2133.807) (-2138.994) -- 0:02:54
223000 -- (-2134.955) (-2138.382) (-2141.405) [-2130.838] * (-2134.821) (-2133.604) [-2134.927] (-2132.603) -- 0:02:54
223500 -- [-2136.357] (-2139.925) (-2141.131) (-2130.345) * (-2133.373) (-2137.324) [-2136.479] (-2132.066) -- 0:02:53
224000 -- [-2134.136] (-2134.419) (-2135.110) (-2142.918) * (-2138.105) (-2133.689) (-2138.900) [-2133.610] -- 0:02:53
224500 -- (-2136.758) (-2134.154) (-2133.521) [-2133.333] * (-2137.359) (-2132.435) [-2135.126] (-2133.042) -- 0:02:52
225000 -- [-2140.409] (-2137.525) (-2133.738) (-2134.634) * (-2142.286) [-2134.434] (-2135.560) (-2131.550) -- 0:02:52
Average standard deviation of split frequencies: 0.007648
225500 -- (-2145.435) (-2133.041) [-2135.774] (-2139.439) * (-2141.128) (-2135.876) (-2138.425) [-2130.799] -- 0:02:51
226000 -- [-2133.004] (-2132.969) (-2143.831) (-2141.656) * [-2132.122] (-2130.860) (-2140.932) (-2133.306) -- 0:02:51
226500 -- (-2136.845) [-2138.978] (-2141.662) (-2133.554) * (-2135.953) [-2133.673] (-2142.107) (-2139.355) -- 0:02:54
227000 -- (-2136.039) (-2134.408) (-2141.346) [-2131.401] * [-2136.428] (-2136.639) (-2138.288) (-2131.424) -- 0:02:53
227500 -- (-2134.835) (-2143.870) (-2130.993) [-2130.360] * (-2134.239) [-2133.803] (-2136.937) (-2138.853) -- 0:02:53
228000 -- (-2134.574) (-2135.052) [-2133.985] (-2141.835) * [-2132.973] (-2134.340) (-2132.804) (-2133.039) -- 0:02:52
228500 -- (-2134.255) [-2135.928] (-2133.489) (-2135.602) * (-2137.525) [-2134.457] (-2136.649) (-2131.114) -- 0:02:52
229000 -- [-2134.825] (-2133.334) (-2135.434) (-2136.581) * (-2146.155) [-2130.578] (-2136.364) (-2134.879) -- 0:02:51
229500 -- (-2129.645) (-2145.146) (-2132.905) [-2135.838] * (-2138.178) (-2133.556) (-2140.387) [-2134.651] -- 0:02:51
230000 -- (-2138.345) (-2135.973) (-2138.275) [-2138.875] * (-2135.137) (-2136.531) [-2136.901] (-2131.154) -- 0:02:50
Average standard deviation of split frequencies: 0.000681
230500 -- [-2134.499] (-2132.926) (-2141.274) (-2134.287) * (-2142.610) [-2137.791] (-2135.648) (-2133.860) -- 0:02:50
231000 -- (-2137.538) [-2135.560] (-2141.697) (-2134.329) * (-2139.349) [-2139.195] (-2145.429) (-2135.128) -- 0:02:53
231500 -- (-2133.965) (-2135.156) [-2133.225] (-2132.665) * [-2130.255] (-2134.673) (-2135.916) (-2132.751) -- 0:02:52
232000 -- (-2144.715) [-2138.857] (-2135.968) (-2139.607) * (-2136.570) (-2133.932) (-2136.640) [-2133.961] -- 0:02:52
232500 -- (-2139.371) [-2135.030] (-2137.837) (-2131.379) * (-2133.296) (-2137.128) (-2135.457) [-2134.801] -- 0:02:51
233000 -- (-2132.012) (-2137.348) (-2140.084) [-2131.895] * (-2133.088) [-2133.068] (-2132.119) (-2131.174) -- 0:02:51
233500 -- [-2130.470] (-2135.631) (-2133.069) (-2135.665) * (-2133.856) (-2136.597) (-2135.851) [-2133.204] -- 0:02:50
234000 -- (-2134.003) (-2135.081) [-2131.464] (-2141.611) * [-2134.970] (-2130.829) (-2134.340) (-2132.623) -- 0:02:50
234500 -- (-2133.998) (-2134.286) [-2140.099] (-2135.339) * (-2133.115) (-2134.024) [-2131.622] (-2133.113) -- 0:02:49
235000 -- (-2142.153) (-2136.666) [-2140.753] (-2134.859) * (-2136.805) (-2139.042) (-2136.139) [-2134.787] -- 0:02:49
Average standard deviation of split frequencies: 0.000666
235500 -- (-2132.909) [-2133.722] (-2134.158) (-2133.788) * (-2131.124) [-2138.940] (-2135.156) (-2137.848) -- 0:02:52
236000 -- (-2133.173) (-2145.256) (-2139.375) [-2132.679] * (-2134.842) (-2150.371) [-2127.554] (-2137.563) -- 0:02:51
236500 -- (-2133.884) [-2132.492] (-2134.726) (-2130.429) * (-2137.258) [-2134.748] (-2130.841) (-2138.828) -- 0:02:51
237000 -- (-2132.250) (-2137.559) (-2140.008) [-2134.772] * [-2133.104] (-2133.248) (-2136.038) (-2148.671) -- 0:02:50
237500 -- (-2133.302) (-2135.866) (-2132.543) [-2133.771] * (-2137.385) [-2132.330] (-2134.123) (-2147.255) -- 0:02:50
238000 -- (-2133.705) [-2135.643] (-2137.305) (-2132.763) * [-2131.564] (-2134.611) (-2135.099) (-2131.970) -- 0:02:49
238500 -- [-2134.375] (-2140.402) (-2133.518) (-2136.771) * (-2131.545) (-2145.402) [-2137.500] (-2133.640) -- 0:02:49
239000 -- (-2133.185) (-2134.100) (-2139.056) [-2133.179] * (-2132.992) [-2134.492] (-2133.096) (-2132.060) -- 0:02:48
239500 -- (-2136.092) [-2136.563] (-2135.528) (-2134.692) * [-2132.703] (-2134.057) (-2132.033) (-2133.581) -- 0:02:48
240000 -- (-2135.054) [-2139.705] (-2139.037) (-2136.109) * (-2132.764) (-2132.546) (-2134.449) [-2134.190] -- 0:02:51
Average standard deviation of split frequencies: 0.004570
240500 -- [-2135.035] (-2136.905) (-2136.373) (-2130.382) * (-2135.475) [-2134.490] (-2133.956) (-2133.227) -- 0:02:50
241000 -- (-2136.163) [-2132.024] (-2134.247) (-2136.883) * [-2132.368] (-2137.676) (-2139.482) (-2139.997) -- 0:02:50
241500 -- (-2134.429) (-2142.155) [-2135.972] (-2143.171) * (-2135.605) (-2137.101) [-2145.084] (-2145.771) -- 0:02:49
242000 -- [-2131.513] (-2137.468) (-2132.880) (-2136.599) * (-2135.381) (-2136.202) [-2143.131] (-2134.966) -- 0:02:49
242500 -- [-2135.030] (-2132.367) (-2132.943) (-2137.509) * [-2135.070] (-2139.137) (-2141.801) (-2132.311) -- 0:02:48
243000 -- (-2135.700) (-2133.348) [-2133.734] (-2133.826) * [-2139.688] (-2137.888) (-2138.184) (-2132.201) -- 0:02:48
243500 -- (-2131.040) (-2134.962) (-2132.625) [-2129.493] * [-2139.535] (-2136.165) (-2139.448) (-2137.986) -- 0:02:47
244000 -- (-2138.561) [-2137.405] (-2135.536) (-2142.889) * (-2134.882) [-2138.346] (-2135.160) (-2138.894) -- 0:02:47
244500 -- (-2137.987) [-2132.871] (-2134.505) (-2132.693) * (-2135.479) (-2137.293) (-2138.628) [-2135.376] -- 0:02:49
245000 -- [-2134.253] (-2141.671) (-2132.607) (-2133.193) * (-2133.549) [-2133.719] (-2135.601) (-2135.050) -- 0:02:49
Average standard deviation of split frequencies: 0.004471
245500 -- [-2133.992] (-2132.658) (-2132.362) (-2135.411) * (-2135.268) (-2138.666) (-2137.400) [-2139.751] -- 0:02:49
246000 -- (-2133.070) (-2133.216) [-2139.057] (-2131.550) * (-2137.050) (-2135.196) [-2131.894] (-2137.944) -- 0:02:48
246500 -- (-2136.361) (-2136.074) [-2135.164] (-2130.701) * (-2138.077) (-2137.772) [-2137.549] (-2133.191) -- 0:02:48
247000 -- [-2135.666] (-2133.423) (-2136.808) (-2134.376) * (-2136.110) [-2131.381] (-2134.254) (-2130.895) -- 0:02:47
247500 -- [-2139.276] (-2145.535) (-2134.365) (-2134.967) * (-2142.502) [-2132.847] (-2140.625) (-2137.335) -- 0:02:47
248000 -- [-2133.102] (-2137.368) (-2136.245) (-2134.372) * (-2145.650) (-2135.807) [-2139.162] (-2133.628) -- 0:02:46
248500 -- (-2143.147) (-2134.394) (-2133.367) [-2145.528] * (-2134.017) [-2142.132] (-2143.416) (-2136.132) -- 0:02:46
249000 -- (-2139.273) [-2136.639] (-2135.417) (-2148.450) * (-2136.578) (-2138.911) (-2146.140) [-2138.609] -- 0:02:48
249500 -- (-2132.944) [-2134.037] (-2139.273) (-2142.850) * [-2135.259] (-2134.680) (-2138.037) (-2145.884) -- 0:02:48
250000 -- (-2135.408) (-2134.529) [-2141.193] (-2143.293) * (-2131.672) [-2130.993] (-2135.311) (-2140.256) -- 0:02:48
Average standard deviation of split frequencies: 0.001881
250500 -- (-2138.716) (-2130.875) [-2132.139] (-2138.251) * (-2132.421) (-2137.459) (-2141.254) [-2137.529] -- 0:02:47
251000 -- (-2137.054) [-2132.329] (-2132.243) (-2143.559) * (-2139.166) (-2130.667) [-2133.571] (-2133.310) -- 0:02:47
251500 -- (-2140.162) [-2138.904] (-2132.726) (-2139.488) * (-2131.968) (-2132.344) (-2136.080) [-2135.768] -- 0:02:46
252000 -- [-2133.852] (-2142.173) (-2141.547) (-2140.847) * (-2131.123) [-2131.547] (-2140.132) (-2138.577) -- 0:02:46
252500 -- [-2136.640] (-2133.502) (-2132.726) (-2139.800) * [-2133.772] (-2134.731) (-2150.037) (-2135.836) -- 0:02:45
253000 -- (-2135.044) [-2133.322] (-2137.250) (-2134.631) * (-2136.500) (-2133.373) [-2139.212] (-2134.482) -- 0:02:45
253500 -- (-2131.715) [-2130.381] (-2135.174) (-2144.381) * [-2130.451] (-2135.067) (-2137.818) (-2136.164) -- 0:02:47
254000 -- [-2134.405] (-2130.727) (-2135.657) (-2136.031) * [-2134.982] (-2132.065) (-2136.528) (-2134.288) -- 0:02:47
254500 -- (-2136.330) (-2141.503) (-2135.653) [-2133.784] * (-2131.809) [-2131.890] (-2140.147) (-2142.416) -- 0:02:46
255000 -- (-2134.545) (-2135.374) (-2134.698) [-2134.047] * [-2135.343] (-2133.263) (-2136.994) (-2131.850) -- 0:02:46
Average standard deviation of split frequencies: 0.003683
255500 -- (-2129.617) (-2134.817) [-2135.526] (-2132.805) * (-2133.436) (-2138.651) [-2138.392] (-2134.992) -- 0:02:46
256000 -- (-2136.270) (-2134.451) (-2136.310) [-2130.065] * (-2130.651) [-2133.442] (-2136.405) (-2130.041) -- 0:02:45
256500 -- (-2130.923) (-2138.619) (-2135.579) [-2133.735] * (-2134.391) [-2131.190] (-2135.771) (-2132.190) -- 0:02:45
257000 -- (-2139.080) (-2142.736) [-2137.060] (-2140.187) * (-2136.466) (-2134.064) [-2138.363] (-2132.700) -- 0:02:44
257500 -- (-2137.771) [-2135.145] (-2141.288) (-2135.276) * (-2139.094) (-2132.671) [-2132.629] (-2132.529) -- 0:02:44
258000 -- (-2134.623) [-2136.658] (-2132.113) (-2138.755) * (-2138.841) (-2130.845) (-2137.354) [-2130.102] -- 0:02:46
258500 -- (-2145.060) [-2134.117] (-2133.219) (-2134.925) * (-2134.890) (-2133.919) [-2135.665] (-2136.823) -- 0:02:46
259000 -- [-2137.313] (-2133.403) (-2139.689) (-2137.338) * [-2128.527] (-2137.070) (-2141.250) (-2131.616) -- 0:02:45
259500 -- (-2136.877) [-2132.418] (-2135.361) (-2135.211) * [-2135.114] (-2136.587) (-2141.306) (-2137.639) -- 0:02:45
260000 -- [-2132.339] (-2132.977) (-2130.516) (-2137.595) * (-2142.222) [-2134.600] (-2137.978) (-2134.806) -- 0:02:45
Average standard deviation of split frequencies: 0.003617
260500 -- (-2135.584) [-2133.012] (-2136.649) (-2131.572) * [-2140.552] (-2139.536) (-2139.704) (-2137.602) -- 0:02:44
261000 -- [-2132.989] (-2135.200) (-2136.058) (-2133.932) * (-2138.280) [-2131.922] (-2133.393) (-2133.637) -- 0:02:44
261500 -- [-2130.771] (-2133.418) (-2134.472) (-2138.248) * (-2134.834) (-2134.345) (-2132.755) [-2139.836] -- 0:02:43
262000 -- (-2137.722) [-2138.490] (-2133.422) (-2135.336) * [-2134.826] (-2141.248) (-2136.121) (-2134.918) -- 0:02:43
262500 -- [-2136.034] (-2140.311) (-2134.808) (-2135.987) * [-2132.492] (-2136.365) (-2132.989) (-2136.594) -- 0:02:45
263000 -- (-2138.972) [-2138.594] (-2138.243) (-2134.385) * (-2134.261) (-2134.293) (-2136.681) [-2142.456] -- 0:02:45
263500 -- [-2141.916] (-2137.892) (-2135.643) (-2140.869) * (-2136.453) [-2133.140] (-2136.968) (-2138.852) -- 0:02:44
264000 -- (-2135.534) (-2135.636) (-2133.879) [-2134.066] * (-2135.604) (-2136.132) [-2135.557] (-2136.869) -- 0:02:44
264500 -- [-2140.319] (-2136.774) (-2134.113) (-2133.458) * (-2131.712) (-2134.153) (-2139.673) [-2136.290] -- 0:02:44
265000 -- (-2131.496) (-2134.803) (-2135.457) [-2134.078] * (-2138.040) [-2133.124] (-2144.587) (-2133.498) -- 0:02:43
Average standard deviation of split frequencies: 0.004726
265500 -- (-2134.961) (-2135.714) [-2134.011] (-2136.553) * (-2133.662) [-2135.961] (-2136.794) (-2135.087) -- 0:02:43
266000 -- (-2140.486) [-2133.214] (-2141.023) (-2133.306) * (-2133.818) (-2135.252) [-2135.863] (-2138.888) -- 0:02:42
266500 -- (-2135.672) [-2135.928] (-2136.486) (-2134.643) * (-2138.881) (-2134.846) [-2138.325] (-2132.904) -- 0:02:45
267000 -- (-2132.650) [-2137.897] (-2138.261) (-2133.409) * [-2130.310] (-2133.853) (-2138.167) (-2139.001) -- 0:02:44
267500 -- (-2133.486) (-2138.938) [-2131.478] (-2138.905) * [-2131.842] (-2133.299) (-2137.868) (-2134.715) -- 0:02:44
268000 -- (-2133.581) [-2142.177] (-2132.265) (-2139.545) * (-2135.039) (-2137.027) (-2140.359) [-2130.760] -- 0:02:43
268500 -- (-2143.276) (-2134.407) [-2131.814] (-2134.675) * (-2136.889) [-2134.228] (-2137.797) (-2134.162) -- 0:02:43
269000 -- (-2140.705) (-2134.077) [-2129.244] (-2135.619) * [-2136.858] (-2142.257) (-2135.907) (-2138.667) -- 0:02:43
269500 -- (-2136.338) (-2138.296) (-2130.130) [-2133.504] * (-2134.493) [-2137.922] (-2130.471) (-2135.246) -- 0:02:42
270000 -- (-2134.415) (-2135.160) (-2130.384) [-2136.124] * [-2133.755] (-2138.759) (-2137.199) (-2146.911) -- 0:02:42
Average standard deviation of split frequencies: 0.002903
270500 -- [-2130.352] (-2137.326) (-2136.922) (-2140.088) * (-2136.436) (-2134.734) (-2133.249) [-2131.328] -- 0:02:41
271000 -- (-2132.281) (-2134.236) [-2134.500] (-2135.311) * (-2138.081) (-2132.935) [-2131.295] (-2132.595) -- 0:02:44
271500 -- (-2136.119) [-2137.876] (-2133.199) (-2135.130) * (-2135.730) (-2133.231) [-2131.835] (-2134.618) -- 0:02:43
272000 -- (-2135.437) (-2140.401) [-2138.414] (-2132.062) * (-2136.310) (-2135.589) (-2131.909) [-2136.874] -- 0:02:43
272500 -- [-2136.849] (-2139.195) (-2132.735) (-2134.369) * (-2133.174) [-2138.554] (-2136.510) (-2146.839) -- 0:02:42
273000 -- (-2131.891) (-2139.824) (-2133.815) [-2132.220] * (-2136.969) (-2140.611) [-2134.693] (-2135.363) -- 0:02:42
273500 -- [-2134.423] (-2134.328) (-2131.598) (-2137.408) * [-2132.925] (-2139.288) (-2132.979) (-2135.984) -- 0:02:42
274000 -- (-2133.056) (-2135.224) (-2133.820) [-2135.727] * (-2132.888) (-2134.136) (-2134.125) [-2137.333] -- 0:02:41
274500 -- [-2131.637] (-2133.806) (-2137.188) (-2138.274) * (-2134.507) (-2136.805) [-2136.009] (-2135.101) -- 0:02:41
275000 -- (-2133.534) (-2135.487) [-2135.830] (-2139.406) * (-2136.332) [-2136.880] (-2135.353) (-2133.094) -- 0:02:40
Average standard deviation of split frequencies: 0.004555
275500 -- [-2130.215] (-2140.832) (-2135.830) (-2143.691) * (-2135.221) (-2137.715) (-2130.661) [-2135.618] -- 0:02:43
276000 -- (-2136.218) (-2139.233) (-2137.141) [-2133.526] * [-2137.792] (-2136.810) (-2135.263) (-2137.154) -- 0:02:42
276500 -- (-2141.424) (-2137.278) [-2135.365] (-2138.046) * (-2137.671) (-2135.746) [-2132.981] (-2134.355) -- 0:02:42
277000 -- (-2132.274) (-2137.130) [-2132.237] (-2135.662) * (-2140.749) (-2131.881) [-2132.795] (-2137.596) -- 0:02:41
277500 -- (-2134.872) (-2135.580) [-2131.895] (-2141.147) * (-2133.940) (-2138.505) (-2135.566) [-2141.302] -- 0:02:41
278000 -- [-2132.203] (-2139.356) (-2135.229) (-2135.946) * (-2132.670) (-2136.421) (-2138.389) [-2131.287] -- 0:02:41
278500 -- (-2130.488) (-2136.751) (-2135.819) [-2135.357] * (-2130.291) [-2138.036] (-2130.753) (-2131.140) -- 0:02:40
279000 -- (-2135.834) (-2134.984) (-2139.811) [-2135.045] * (-2130.635) (-2138.871) (-2130.658) [-2132.182] -- 0:02:40
279500 -- (-2142.006) (-2135.546) (-2132.875) [-2129.300] * (-2133.232) (-2133.092) [-2134.529] (-2135.104) -- 0:02:39
280000 -- (-2139.824) (-2133.294) [-2134.827] (-2134.799) * [-2145.368] (-2133.875) (-2136.920) (-2141.788) -- 0:02:39
Average standard deviation of split frequencies: 0.004479
280500 -- (-2133.460) (-2132.769) (-2140.797) [-2138.586] * [-2134.933] (-2136.104) (-2132.231) (-2144.018) -- 0:02:41
281000 -- (-2136.244) (-2133.503) (-2137.459) [-2137.059] * (-2140.249) (-2137.033) (-2131.663) [-2137.023] -- 0:02:41
281500 -- [-2136.026] (-2141.029) (-2131.370) (-2134.739) * [-2135.478] (-2135.330) (-2138.731) (-2136.152) -- 0:02:40
282000 -- (-2140.167) [-2138.669] (-2136.626) (-2133.054) * (-2129.982) [-2133.076] (-2141.426) (-2137.737) -- 0:02:40
282500 -- [-2133.088] (-2140.508) (-2132.650) (-2138.536) * [-2130.774] (-2139.380) (-2137.645) (-2134.329) -- 0:02:40
283000 -- (-2136.455) (-2135.704) [-2134.812] (-2138.646) * [-2134.432] (-2139.390) (-2134.701) (-2138.517) -- 0:02:39
283500 -- (-2136.080) (-2133.630) [-2136.629] (-2135.900) * (-2131.792) (-2134.494) [-2136.233] (-2139.071) -- 0:02:39
284000 -- (-2137.671) (-2131.610) [-2136.826] (-2136.617) * (-2136.056) (-2137.040) (-2133.180) [-2132.772] -- 0:02:38
284500 -- (-2136.848) (-2141.529) (-2135.518) [-2131.544] * (-2134.773) (-2134.912) [-2134.568] (-2133.489) -- 0:02:38
285000 -- (-2133.229) [-2138.660] (-2133.417) (-2133.798) * (-2132.224) [-2135.675] (-2134.041) (-2138.582) -- 0:02:40
Average standard deviation of split frequencies: 0.001099
285500 -- [-2132.539] (-2132.048) (-2132.299) (-2134.091) * (-2132.357) (-2145.469) [-2137.207] (-2141.817) -- 0:02:40
286000 -- [-2130.839] (-2136.548) (-2137.873) (-2130.762) * [-2133.266] (-2135.787) (-2132.862) (-2132.198) -- 0:02:39
286500 -- [-2135.186] (-2136.247) (-2136.291) (-2136.424) * [-2132.987] (-2137.671) (-2131.632) (-2134.255) -- 0:02:39
287000 -- (-2133.427) (-2138.757) (-2133.657) [-2141.833] * (-2132.772) (-2139.944) (-2138.105) [-2133.062] -- 0:02:38
287500 -- (-2137.198) (-2131.642) [-2138.569] (-2136.596) * (-2140.519) (-2132.841) [-2137.656] (-2133.459) -- 0:02:38
288000 -- (-2134.964) [-2134.411] (-2140.145) (-2136.306) * (-2136.502) [-2140.778] (-2144.739) (-2137.078) -- 0:02:38
288500 -- (-2133.232) (-2137.076) [-2135.283] (-2137.087) * (-2127.607) (-2142.186) (-2132.820) [-2131.280] -- 0:02:37
289000 -- (-2139.217) (-2137.754) (-2131.607) [-2135.520] * (-2134.874) (-2135.810) [-2135.183] (-2134.659) -- 0:02:39
289500 -- (-2146.594) (-2130.802) [-2133.364] (-2136.967) * (-2132.667) (-2138.655) [-2131.950] (-2140.082) -- 0:02:39
290000 -- [-2138.456] (-2141.664) (-2137.524) (-2139.174) * (-2131.177) (-2140.394) [-2138.503] (-2134.619) -- 0:02:39
Average standard deviation of split frequencies: 0.003244
290500 -- (-2138.511) (-2134.495) [-2134.141] (-2133.393) * (-2131.309) (-2130.925) [-2130.741] (-2138.365) -- 0:02:38
291000 -- (-2139.391) (-2144.330) [-2135.088] (-2139.325) * (-2136.421) (-2136.205) [-2132.212] (-2138.398) -- 0:02:38
291500 -- (-2134.187) (-2137.439) (-2134.687) [-2142.491] * (-2132.633) [-2134.130] (-2131.048) (-2133.979) -- 0:02:37
292000 -- (-2133.277) (-2133.324) [-2134.223] (-2139.052) * (-2134.883) [-2132.184] (-2142.947) (-2133.576) -- 0:02:37
292500 -- (-2135.334) (-2132.868) (-2139.934) [-2131.742] * [-2132.720] (-2136.495) (-2135.044) (-2134.814) -- 0:02:37
293000 -- (-2134.307) [-2135.355] (-2138.723) (-2139.038) * [-2139.036] (-2138.178) (-2140.084) (-2133.686) -- 0:02:36
293500 -- (-2131.185) (-2135.035) (-2136.228) [-2132.666] * (-2140.456) [-2136.835] (-2137.967) (-2138.114) -- 0:02:38
294000 -- (-2137.918) [-2132.284] (-2136.275) (-2131.977) * [-2136.942] (-2134.005) (-2145.746) (-2134.367) -- 0:02:38
294500 -- (-2145.779) (-2134.247) (-2134.767) [-2134.708] * (-2135.681) (-2133.171) (-2139.864) [-2130.680] -- 0:02:38
295000 -- [-2137.029] (-2138.737) (-2130.745) (-2132.662) * (-2138.370) [-2137.884] (-2144.403) (-2132.950) -- 0:02:37
Average standard deviation of split frequencies: 0.000000
295500 -- [-2133.121] (-2131.761) (-2139.500) (-2135.484) * (-2133.928) [-2136.825] (-2134.313) (-2135.540) -- 0:02:37
296000 -- (-2137.722) [-2133.778] (-2133.876) (-2138.149) * (-2135.872) [-2133.667] (-2133.640) (-2132.737) -- 0:02:36
296500 -- (-2134.216) [-2129.808] (-2138.284) (-2136.426) * (-2135.480) (-2134.622) (-2142.022) [-2131.090] -- 0:02:36
297000 -- (-2134.182) (-2134.838) [-2131.997] (-2139.897) * [-2132.275] (-2131.852) (-2133.881) (-2140.797) -- 0:02:36
297500 -- (-2137.137) (-2140.589) [-2131.037] (-2133.834) * [-2138.658] (-2132.925) (-2142.115) (-2140.200) -- 0:02:35
298000 -- (-2140.788) (-2136.329) [-2134.411] (-2134.016) * (-2133.874) (-2130.125) (-2140.178) [-2132.079] -- 0:02:37
298500 -- (-2131.274) [-2137.031] (-2142.583) (-2138.806) * [-2137.009] (-2137.245) (-2136.246) (-2144.543) -- 0:02:37
299000 -- (-2131.657) (-2132.976) [-2134.039] (-2135.110) * (-2133.192) (-2141.727) (-2141.066) [-2134.350] -- 0:02:37
299500 -- [-2131.903] (-2133.765) (-2132.078) (-2134.043) * (-2129.411) [-2135.636] (-2137.387) (-2139.213) -- 0:02:36
300000 -- [-2137.209] (-2131.657) (-2137.456) (-2136.674) * (-2132.123) (-2132.005) (-2136.996) [-2140.232] -- 0:02:36
Average standard deviation of split frequencies: 0.003136
300500 -- (-2139.052) (-2132.296) [-2135.450] (-2134.163) * (-2136.620) [-2129.593] (-2133.453) (-2137.280) -- 0:02:35
301000 -- (-2136.142) (-2133.496) [-2135.967] (-2133.272) * (-2136.161) (-2135.378) (-2137.578) [-2137.097] -- 0:02:35
301500 -- (-2132.058) [-2134.381] (-2138.459) (-2134.823) * (-2135.600) (-2138.086) [-2135.192] (-2134.257) -- 0:02:35
302000 -- [-2130.866] (-2140.649) (-2133.080) (-2132.348) * (-2138.029) (-2142.435) (-2143.118) [-2133.354] -- 0:02:34
302500 -- (-2133.775) (-2134.650) [-2130.383] (-2139.910) * (-2136.909) (-2136.959) [-2139.073] (-2130.992) -- 0:02:36
303000 -- (-2135.210) [-2132.870] (-2129.804) (-2131.801) * (-2136.376) (-2135.504) [-2132.823] (-2132.543) -- 0:02:36
303500 -- (-2133.666) (-2133.620) (-2135.590) [-2135.559] * [-2133.261] (-2136.405) (-2129.866) (-2131.309) -- 0:02:36
304000 -- (-2135.953) (-2136.808) (-2137.036) [-2132.669] * (-2130.280) (-2142.104) (-2132.572) [-2132.672] -- 0:02:35
304500 -- (-2142.243) (-2137.755) (-2137.964) [-2141.370] * [-2132.089] (-2140.509) (-2146.296) (-2135.403) -- 0:02:35
305000 -- (-2138.178) (-2136.293) [-2133.095] (-2134.408) * (-2133.204) (-2135.479) [-2132.206] (-2134.340) -- 0:02:34
Average standard deviation of split frequencies: 0.003081
305500 -- (-2134.003) (-2135.069) [-2133.423] (-2135.820) * (-2136.088) [-2132.608] (-2137.914) (-2133.120) -- 0:02:34
306000 -- (-2137.648) (-2138.228) [-2141.637] (-2135.612) * (-2134.531) (-2136.117) [-2134.362] (-2131.938) -- 0:02:34
306500 -- (-2138.024) [-2134.864] (-2135.394) (-2141.265) * (-2142.042) (-2136.523) [-2138.093] (-2136.352) -- 0:02:33
307000 -- (-2135.156) [-2133.145] (-2131.689) (-2143.775) * (-2137.325) (-2137.057) [-2135.851] (-2138.152) -- 0:02:35
307500 -- (-2140.235) [-2134.602] (-2138.214) (-2143.520) * [-2135.712] (-2136.996) (-2141.434) (-2137.232) -- 0:02:35
308000 -- [-2134.772] (-2137.025) (-2134.139) (-2138.233) * (-2136.525) (-2137.428) (-2134.745) [-2138.094] -- 0:02:35
308500 -- (-2131.808) (-2140.550) (-2142.374) [-2132.867] * (-2139.590) [-2137.592] (-2130.030) (-2140.094) -- 0:02:34
309000 -- (-2133.975) [-2135.007] (-2137.773) (-2135.481) * (-2141.890) (-2138.856) [-2134.725] (-2132.741) -- 0:02:34
309500 -- (-2136.103) [-2135.376] (-2139.774) (-2138.246) * (-2143.630) [-2137.729] (-2142.003) (-2131.828) -- 0:02:33
310000 -- [-2134.192] (-2135.613) (-2137.239) (-2141.911) * [-2133.281] (-2143.291) (-2150.819) (-2132.835) -- 0:02:33
Average standard deviation of split frequencies: 0.006070
310500 -- (-2134.421) (-2133.379) [-2133.363] (-2135.996) * (-2139.187) (-2137.826) (-2136.993) [-2133.024] -- 0:02:33
311000 -- (-2137.462) (-2134.953) [-2133.434] (-2132.304) * (-2135.615) (-2131.511) [-2135.429] (-2133.310) -- 0:02:32
311500 -- (-2136.126) (-2134.635) [-2132.156] (-2134.044) * (-2133.127) (-2132.778) [-2132.745] (-2140.750) -- 0:02:34
312000 -- (-2141.574) [-2133.814] (-2134.318) (-2131.192) * (-2142.645) (-2137.470) [-2135.194] (-2138.512) -- 0:02:34
312500 -- (-2135.182) (-2136.943) [-2133.187] (-2133.621) * [-2138.720] (-2139.763) (-2134.821) (-2135.830) -- 0:02:34
313000 -- (-2135.094) [-2135.565] (-2139.029) (-2138.660) * (-2136.199) (-2134.220) [-2134.998] (-2141.399) -- 0:02:33
313500 -- (-2138.260) [-2132.692] (-2131.611) (-2148.119) * (-2139.175) (-2132.881) [-2140.482] (-2134.753) -- 0:02:33
314000 -- (-2133.891) (-2134.222) [-2132.387] (-2133.559) * (-2138.626) (-2137.530) [-2135.281] (-2140.662) -- 0:02:32
314500 -- (-2134.177) (-2138.742) [-2134.414] (-2135.737) * (-2134.392) [-2135.848] (-2138.475) (-2136.616) -- 0:02:32
315000 -- [-2132.304] (-2132.801) (-2135.497) (-2135.789) * [-2136.128] (-2137.068) (-2130.637) (-2138.222) -- 0:02:32
Average standard deviation of split frequencies: 0.008453
315500 -- (-2135.211) (-2132.654) (-2139.434) [-2133.061] * (-2137.370) (-2137.120) (-2133.069) [-2135.959] -- 0:02:31
316000 -- [-2132.726] (-2131.732) (-2139.354) (-2130.895) * (-2137.474) [-2136.849] (-2131.954) (-2141.422) -- 0:02:33
316500 -- (-2132.656) (-2139.603) [-2144.048] (-2138.137) * (-2134.930) (-2138.499) [-2135.208] (-2141.380) -- 0:02:33
317000 -- (-2137.242) (-2138.272) (-2141.058) [-2139.626] * (-2139.901) (-2143.227) [-2135.615] (-2143.698) -- 0:02:32
317500 -- (-2131.656) (-2139.904) (-2139.345) [-2133.255] * [-2132.524] (-2143.494) (-2138.758) (-2137.233) -- 0:02:32
318000 -- (-2135.306) [-2137.562] (-2147.502) (-2133.456) * (-2133.191) (-2144.231) [-2132.923] (-2142.366) -- 0:02:32
318500 -- (-2133.697) (-2133.304) [-2132.550] (-2134.263) * [-2132.984] (-2139.788) (-2141.169) (-2138.564) -- 0:02:31
319000 -- (-2135.244) [-2132.760] (-2131.509) (-2132.806) * (-2130.756) (-2138.563) [-2133.764] (-2142.611) -- 0:02:31
319500 -- (-2137.924) (-2129.441) (-2136.236) [-2133.028] * (-2139.076) [-2137.866] (-2136.926) (-2142.276) -- 0:02:31
320000 -- [-2139.657] (-2140.532) (-2134.056) (-2135.134) * (-2133.991) (-2131.245) [-2134.884] (-2138.716) -- 0:02:30
Average standard deviation of split frequencies: 0.007350
320500 -- (-2143.894) (-2133.857) [-2132.685] (-2135.877) * (-2135.369) (-2140.095) (-2142.419) [-2137.652] -- 0:02:32
321000 -- [-2135.981] (-2137.764) (-2132.749) (-2135.602) * (-2134.226) [-2133.202] (-2141.028) (-2140.923) -- 0:02:32
321500 -- (-2136.689) [-2139.917] (-2138.329) (-2139.357) * (-2135.985) (-2134.272) (-2139.581) [-2132.582] -- 0:02:31
322000 -- [-2130.114] (-2143.676) (-2135.169) (-2131.336) * (-2135.070) (-2136.010) [-2139.020] (-2132.710) -- 0:02:31
322500 -- (-2132.929) (-2139.197) (-2132.829) [-2137.229] * [-2134.552] (-2134.638) (-2130.094) (-2137.365) -- 0:02:31
323000 -- (-2131.976) (-2133.291) [-2131.358] (-2134.393) * (-2134.557) (-2140.116) [-2136.442] (-2134.851) -- 0:02:30
323500 -- (-2137.217) (-2132.622) (-2136.573) [-2131.187] * [-2130.817] (-2142.456) (-2141.061) (-2133.681) -- 0:02:30
324000 -- (-2134.030) (-2137.992) (-2133.825) [-2132.781] * (-2137.972) (-2138.450) (-2133.431) [-2139.872] -- 0:02:30
324500 -- (-2137.014) [-2134.630] (-2143.415) (-2134.487) * (-2130.836) (-2142.470) (-2131.714) [-2136.787] -- 0:02:29
325000 -- (-2134.991) [-2134.107] (-2134.891) (-2131.721) * (-2134.909) (-2133.359) (-2135.517) [-2143.895] -- 0:02:31
Average standard deviation of split frequencies: 0.007712
325500 -- (-2138.007) (-2130.480) (-2133.816) [-2131.991] * [-2141.854] (-2134.522) (-2133.824) (-2144.917) -- 0:02:31
326000 -- (-2133.510) (-2131.456) (-2139.537) [-2136.233] * [-2134.967] (-2141.256) (-2129.972) (-2141.323) -- 0:02:30
326500 -- (-2135.211) (-2132.574) (-2140.281) [-2131.471] * [-2135.714] (-2135.859) (-2134.507) (-2132.378) -- 0:02:30
327000 -- [-2132.067] (-2140.974) (-2139.539) (-2136.633) * (-2136.453) [-2136.495] (-2136.048) (-2136.618) -- 0:02:30
327500 -- (-2134.701) [-2136.405] (-2131.815) (-2132.271) * [-2131.757] (-2137.405) (-2138.830) (-2131.190) -- 0:02:29
328000 -- (-2136.658) [-2134.211] (-2137.027) (-2133.969) * (-2134.235) (-2139.961) (-2136.782) [-2132.356] -- 0:02:29
328500 -- [-2135.233] (-2135.356) (-2134.863) (-2132.747) * [-2132.742] (-2131.986) (-2135.525) (-2140.043) -- 0:02:29
329000 -- (-2144.197) [-2131.872] (-2135.178) (-2130.325) * (-2136.172) (-2135.279) (-2138.651) [-2131.297] -- 0:02:28
329500 -- (-2134.959) (-2138.673) [-2133.863] (-2130.638) * [-2131.995] (-2136.155) (-2137.187) (-2136.397) -- 0:02:30
330000 -- [-2132.537] (-2132.581) (-2137.308) (-2132.306) * (-2129.200) [-2134.182] (-2136.872) (-2135.607) -- 0:02:30
Average standard deviation of split frequencies: 0.008554
330500 -- [-2136.659] (-2138.079) (-2133.841) (-2134.293) * [-2129.815] (-2136.150) (-2136.786) (-2131.639) -- 0:02:29
331000 -- [-2136.567] (-2132.031) (-2139.673) (-2134.117) * (-2133.254) [-2133.202] (-2141.192) (-2132.118) -- 0:02:29
331500 -- (-2138.629) [-2131.798] (-2138.662) (-2134.432) * (-2137.696) [-2135.546] (-2134.953) (-2132.224) -- 0:02:29
332000 -- [-2135.834] (-2134.140) (-2135.217) (-2135.425) * (-2135.898) (-2137.775) (-2134.483) [-2134.618] -- 0:02:28
332500 -- (-2141.500) (-2131.911) (-2134.552) [-2135.691] * (-2137.715) (-2132.592) [-2134.699] (-2133.956) -- 0:02:28
333000 -- (-2135.443) [-2137.596] (-2140.440) (-2139.621) * [-2136.775] (-2134.221) (-2142.620) (-2133.117) -- 0:02:28
333500 -- (-2137.045) [-2133.088] (-2139.537) (-2136.532) * (-2144.811) [-2132.024] (-2138.927) (-2130.344) -- 0:02:27
334000 -- (-2133.070) (-2135.369) (-2139.681) [-2134.674] * (-2136.429) [-2134.735] (-2143.205) (-2131.376) -- 0:02:27
334500 -- (-2138.653) [-2132.937] (-2134.332) (-2144.370) * [-2133.605] (-2132.540) (-2138.216) (-2132.194) -- 0:02:29
335000 -- [-2136.852] (-2133.277) (-2135.562) (-2135.657) * [-2129.391] (-2134.198) (-2136.147) (-2137.841) -- 0:02:28
Average standard deviation of split frequencies: 0.007483
335500 -- (-2138.348) [-2136.689] (-2140.300) (-2134.129) * (-2134.956) [-2136.490] (-2135.020) (-2134.544) -- 0:02:28
336000 -- (-2133.737) (-2136.499) [-2134.699] (-2135.074) * (-2133.621) (-2134.743) [-2134.375] (-2143.108) -- 0:02:28
336500 -- [-2132.891] (-2144.978) (-2132.367) (-2133.130) * (-2134.703) [-2130.707] (-2131.160) (-2135.001) -- 0:02:27
337000 -- [-2130.643] (-2133.400) (-2132.115) (-2139.770) * [-2135.001] (-2135.829) (-2131.827) (-2133.445) -- 0:02:27
337500 -- (-2134.260) [-2137.234] (-2133.670) (-2132.822) * (-2135.517) (-2132.274) (-2136.835) [-2131.467] -- 0:02:27
338000 -- (-2138.329) [-2132.399] (-2137.684) (-2133.173) * (-2131.002) (-2130.159) [-2132.520] (-2139.688) -- 0:02:26
338500 -- [-2131.453] (-2134.108) (-2136.989) (-2135.005) * (-2140.472) [-2137.268] (-2134.229) (-2134.395) -- 0:02:26
339000 -- (-2140.436) [-2132.605] (-2143.012) (-2143.390) * [-2139.777] (-2135.848) (-2134.806) (-2137.281) -- 0:02:28
339500 -- (-2140.584) (-2136.576) [-2137.582] (-2138.610) * (-2135.373) (-2142.663) (-2135.532) [-2136.392] -- 0:02:27
340000 -- (-2135.513) (-2133.529) (-2134.344) [-2135.257] * (-2140.660) [-2134.891] (-2134.037) (-2135.843) -- 0:02:27
Average standard deviation of split frequencies: 0.008303
340500 -- (-2133.955) [-2139.621] (-2140.456) (-2139.898) * [-2137.590] (-2136.886) (-2142.849) (-2134.803) -- 0:02:27
341000 -- (-2139.476) (-2134.933) [-2137.549] (-2134.896) * (-2136.226) (-2136.537) [-2133.062] (-2134.829) -- 0:02:26
341500 -- (-2136.739) (-2136.922) (-2132.904) [-2134.154] * (-2134.930) (-2141.683) [-2139.528] (-2139.722) -- 0:02:26
342000 -- (-2139.244) (-2139.338) (-2135.715) [-2134.376] * (-2132.096) (-2143.604) [-2132.146] (-2141.160) -- 0:02:26
342500 -- (-2134.526) (-2136.268) [-2132.844] (-2132.991) * [-2140.630] (-2138.610) (-2138.462) (-2134.068) -- 0:02:25
343000 -- (-2141.050) [-2136.567] (-2133.128) (-2134.756) * (-2131.377) (-2133.236) [-2134.858] (-2138.770) -- 0:02:25
343500 -- (-2137.223) (-2134.096) (-2140.264) [-2140.113] * (-2135.775) (-2134.158) [-2135.834] (-2144.728) -- 0:02:27
344000 -- (-2137.932) [-2132.276] (-2134.374) (-2135.008) * (-2134.742) (-2135.717) [-2136.708] (-2142.034) -- 0:02:26
344500 -- [-2136.979] (-2133.169) (-2135.796) (-2135.288) * (-2132.545) [-2134.311] (-2133.952) (-2148.283) -- 0:02:26
345000 -- (-2139.530) (-2139.037) [-2133.842] (-2139.176) * (-2139.506) [-2136.841] (-2137.295) (-2138.327) -- 0:02:26
Average standard deviation of split frequencies: 0.009083
345500 -- (-2138.348) (-2132.851) (-2135.712) [-2133.076] * (-2141.768) (-2137.173) (-2134.597) [-2132.918] -- 0:02:25
346000 -- (-2140.459) (-2135.845) (-2136.641) [-2135.573] * [-2130.823] (-2131.857) (-2137.376) (-2133.814) -- 0:02:25
346500 -- (-2136.326) [-2133.679] (-2134.386) (-2135.780) * [-2133.262] (-2129.620) (-2131.184) (-2138.103) -- 0:02:25
347000 -- (-2135.522) (-2133.916) (-2133.894) [-2136.564] * (-2138.131) (-2129.455) (-2139.535) [-2143.123] -- 0:02:24
347500 -- (-2143.730) [-2134.639] (-2131.993) (-2131.839) * (-2135.490) [-2132.170] (-2135.111) (-2135.777) -- 0:02:26
348000 -- (-2139.539) (-2136.272) (-2133.738) [-2138.806] * [-2143.797] (-2130.486) (-2130.960) (-2145.188) -- 0:02:26
348500 -- (-2137.925) (-2138.189) (-2139.811) [-2136.351] * (-2131.137) (-2136.073) (-2138.309) [-2142.286] -- 0:02:25
349000 -- (-2135.105) (-2137.013) [-2138.418] (-2133.939) * (-2131.530) [-2135.937] (-2138.113) (-2134.751) -- 0:02:25
349500 -- (-2135.070) (-2137.093) (-2136.136) [-2137.210] * (-2132.277) [-2134.749] (-2137.586) (-2138.810) -- 0:02:25
350000 -- (-2135.969) [-2136.995] (-2135.706) (-2135.021) * (-2130.648) (-2142.990) (-2140.665) [-2131.248] -- 0:02:24
Average standard deviation of split frequencies: 0.008962
350500 -- (-2142.617) (-2132.477) [-2136.831] (-2139.358) * (-2137.954) (-2135.013) [-2138.446] (-2133.109) -- 0:02:24
351000 -- (-2134.338) (-2135.781) (-2134.006) [-2139.195] * (-2140.301) [-2134.918] (-2137.675) (-2134.891) -- 0:02:24
351500 -- (-2140.335) (-2133.418) (-2132.226) [-2139.748] * [-2135.365] (-2132.842) (-2135.770) (-2133.928) -- 0:02:23
352000 -- (-2133.097) [-2135.843] (-2139.942) (-2134.119) * (-2132.373) (-2133.949) [-2134.296] (-2134.417) -- 0:02:25
352500 -- (-2135.712) (-2140.397) (-2136.686) [-2136.910] * [-2133.272] (-2134.814) (-2134.147) (-2133.601) -- 0:02:25
353000 -- (-2134.653) (-2135.878) [-2136.912] (-2133.060) * (-2133.040) (-2140.633) (-2136.295) [-2133.759] -- 0:02:24
353500 -- (-2136.092) [-2133.386] (-2140.773) (-2133.879) * [-2133.681] (-2133.317) (-2132.471) (-2139.299) -- 0:02:24
354000 -- [-2133.798] (-2135.735) (-2135.699) (-2133.160) * (-2140.071) (-2136.471) [-2134.103] (-2133.317) -- 0:02:24
354500 -- [-2133.105] (-2143.874) (-2133.363) (-2131.055) * (-2135.349) (-2137.091) (-2142.006) [-2133.022] -- 0:02:23
355000 -- [-2134.822] (-2130.340) (-2138.783) (-2136.722) * [-2137.249] (-2137.026) (-2139.615) (-2132.913) -- 0:02:23
Average standard deviation of split frequencies: 0.006179
355500 -- (-2138.951) (-2136.106) [-2135.520] (-2133.677) * [-2129.175] (-2134.604) (-2134.029) (-2135.338) -- 0:02:23
356000 -- [-2134.590] (-2138.558) (-2132.956) (-2134.311) * (-2134.234) (-2134.775) (-2134.577) [-2133.559] -- 0:02:22
356500 -- [-2131.194] (-2137.410) (-2135.954) (-2133.202) * (-2131.911) (-2132.599) (-2137.096) [-2132.349] -- 0:02:24
357000 -- (-2135.267) [-2138.082] (-2132.531) (-2133.466) * [-2131.035] (-2134.380) (-2134.743) (-2134.285) -- 0:02:24
357500 -- [-2130.809] (-2133.216) (-2135.488) (-2137.668) * [-2136.379] (-2139.968) (-2132.337) (-2132.826) -- 0:02:23
358000 -- (-2136.786) (-2137.538) [-2132.513] (-2133.138) * [-2132.063] (-2132.919) (-2137.472) (-2132.926) -- 0:02:23
358500 -- (-2139.660) (-2138.108) [-2135.208] (-2130.995) * [-2130.778] (-2139.100) (-2143.361) (-2139.432) -- 0:02:23
359000 -- (-2140.992) (-2139.996) [-2140.253] (-2131.228) * (-2136.794) [-2128.535] (-2131.841) (-2135.351) -- 0:02:22
359500 -- (-2134.579) [-2134.908] (-2136.004) (-2135.239) * [-2132.703] (-2133.037) (-2133.682) (-2138.100) -- 0:02:22
360000 -- (-2143.461) (-2134.908) (-2133.938) [-2131.779] * [-2133.666] (-2137.837) (-2138.320) (-2137.924) -- 0:02:22
Average standard deviation of split frequencies: 0.007842
360500 -- [-2140.812] (-2134.508) (-2133.364) (-2130.060) * [-2132.452] (-2143.731) (-2136.330) (-2140.526) -- 0:02:21
361000 -- (-2147.590) (-2142.496) [-2133.909] (-2135.265) * [-2133.073] (-2136.364) (-2141.023) (-2136.932) -- 0:02:23
361500 -- (-2136.570) [-2134.299] (-2137.271) (-2137.880) * (-2134.199) [-2136.202] (-2133.393) (-2133.512) -- 0:02:23
362000 -- (-2143.222) (-2133.760) [-2136.755] (-2134.055) * (-2136.353) (-2137.078) (-2139.405) [-2130.661] -- 0:02:22
362500 -- (-2134.201) (-2137.513) [-2134.758] (-2132.226) * (-2132.458) [-2134.493] (-2135.395) (-2130.048) -- 0:02:22
363000 -- (-2137.647) [-2137.749] (-2130.827) (-2138.146) * (-2138.912) [-2135.058] (-2134.078) (-2133.126) -- 0:02:22
363500 -- (-2132.531) (-2135.862) [-2132.236] (-2136.057) * (-2138.418) [-2135.456] (-2133.847) (-2135.850) -- 0:02:21
364000 -- (-2137.209) (-2143.736) [-2140.487] (-2131.833) * [-2131.127] (-2142.300) (-2131.446) (-2132.688) -- 0:02:21
364500 -- (-2134.273) (-2134.833) (-2140.557) [-2130.259] * (-2139.531) (-2136.290) [-2133.411] (-2137.942) -- 0:02:21
365000 -- (-2142.751) [-2135.851] (-2140.705) (-2133.967) * [-2130.941] (-2132.592) (-2132.462) (-2142.939) -- 0:02:20
Average standard deviation of split frequencies: 0.007728
365500 -- (-2143.289) (-2136.142) (-2133.355) [-2135.628] * (-2139.684) (-2134.017) [-2128.846] (-2135.522) -- 0:02:22
366000 -- [-2140.923] (-2136.292) (-2138.785) (-2131.842) * (-2139.468) (-2144.712) (-2139.698) [-2134.010] -- 0:02:22
366500 -- (-2133.070) (-2139.055) [-2133.761] (-2134.202) * (-2136.384) [-2134.241] (-2137.546) (-2137.509) -- 0:02:21
367000 -- (-2132.667) [-2136.245] (-2139.816) (-2140.746) * (-2142.266) [-2129.938] (-2140.016) (-2141.862) -- 0:02:21
367500 -- (-2133.212) [-2139.053] (-2139.464) (-2144.677) * (-2134.586) (-2140.160) [-2137.535] (-2137.789) -- 0:02:21
368000 -- [-2135.241] (-2146.848) (-2140.274) (-2142.823) * (-2140.640) (-2136.375) [-2137.372] (-2133.745) -- 0:02:20
368500 -- [-2136.028] (-2134.319) (-2140.542) (-2138.618) * (-2135.814) (-2136.056) [-2133.747] (-2137.140) -- 0:02:20
369000 -- (-2138.213) [-2139.166] (-2138.824) (-2133.120) * (-2137.031) [-2130.056] (-2136.979) (-2138.775) -- 0:02:20
369500 -- (-2131.859) (-2139.482) (-2137.357) [-2132.831] * (-2132.987) (-2135.964) (-2135.665) [-2133.962] -- 0:02:19
370000 -- (-2130.947) (-2131.494) [-2136.365] (-2132.518) * (-2129.273) [-2131.939] (-2132.917) (-2134.383) -- 0:02:21
Average standard deviation of split frequencies: 0.006783
370500 -- (-2136.054) (-2135.462) [-2137.827] (-2134.671) * [-2130.251] (-2137.378) (-2139.197) (-2134.690) -- 0:02:21
371000 -- (-2135.264) [-2133.876] (-2134.295) (-2137.483) * [-2135.270] (-2141.475) (-2138.650) (-2132.958) -- 0:02:20
371500 -- (-2133.223) [-2133.060] (-2134.070) (-2133.455) * [-2135.439] (-2135.273) (-2138.440) (-2133.358) -- 0:02:20
372000 -- (-2139.484) [-2136.694] (-2137.188) (-2135.194) * (-2138.756) (-2130.949) [-2135.919] (-2134.727) -- 0:02:20
372500 -- (-2134.667) (-2141.885) (-2145.924) [-2134.751] * [-2136.770] (-2135.580) (-2143.232) (-2131.348) -- 0:02:19
373000 -- (-2133.282) (-2134.933) [-2137.288] (-2136.807) * (-2140.040) [-2130.404] (-2135.937) (-2136.070) -- 0:02:19
373500 -- [-2132.464] (-2140.592) (-2134.476) (-2131.816) * (-2138.949) (-2131.816) [-2136.004] (-2135.097) -- 0:02:19
374000 -- (-2134.033) (-2133.632) [-2137.483] (-2133.384) * (-2136.868) (-2131.519) (-2132.934) [-2137.997] -- 0:02:18
374500 -- [-2131.674] (-2136.777) (-2142.277) (-2133.457) * (-2136.020) [-2135.365] (-2134.678) (-2136.110) -- 0:02:20
375000 -- [-2134.780] (-2137.209) (-2138.229) (-2137.143) * [-2133.379] (-2131.271) (-2137.979) (-2134.485) -- 0:02:20
Average standard deviation of split frequencies: 0.008358
375500 -- (-2134.266) (-2134.997) (-2140.473) [-2130.228] * (-2132.774) (-2131.610) [-2142.964] (-2141.705) -- 0:02:19
376000 -- (-2130.133) (-2136.747) (-2135.477) [-2132.290] * [-2134.967] (-2133.565) (-2135.656) (-2141.258) -- 0:02:19
376500 -- (-2132.208) (-2138.123) (-2136.857) [-2132.739] * (-2139.240) [-2137.600] (-2135.398) (-2143.051) -- 0:02:19
377000 -- [-2138.650] (-2142.850) (-2137.880) (-2137.967) * [-2129.643] (-2136.402) (-2130.874) (-2143.330) -- 0:02:18
377500 -- (-2136.030) (-2135.965) (-2137.967) [-2133.955] * (-2134.948) (-2137.570) (-2132.309) [-2133.534] -- 0:02:18
378000 -- (-2136.956) [-2133.657] (-2136.784) (-2137.464) * (-2136.302) (-2129.650) [-2132.160] (-2139.010) -- 0:02:18
378500 -- (-2140.580) (-2143.567) (-2139.303) [-2136.802] * (-2140.566) (-2134.637) [-2131.180] (-2134.958) -- 0:02:17
379000 -- (-2136.492) [-2136.469] (-2135.435) (-2141.293) * (-2135.729) (-2137.778) [-2132.730] (-2133.249) -- 0:02:19
379500 -- (-2140.944) (-2135.226) (-2137.234) [-2136.656] * (-2136.951) (-2138.655) [-2129.408] (-2142.013) -- 0:02:18
380000 -- (-2136.211) (-2132.727) [-2138.481] (-2132.167) * (-2133.683) (-2139.414) [-2135.161] (-2137.105) -- 0:02:18
Average standard deviation of split frequencies: 0.005779
380500 -- (-2137.212) (-2138.036) (-2133.650) [-2133.638] * (-2136.426) [-2137.478] (-2138.854) (-2137.812) -- 0:02:18
381000 -- (-2134.288) [-2131.537] (-2133.839) (-2138.460) * [-2137.760] (-2138.933) (-2138.243) (-2132.464) -- 0:02:18
381500 -- (-2134.051) [-2139.551] (-2135.354) (-2135.058) * [-2132.332] (-2135.862) (-2132.671) (-2136.187) -- 0:02:17
382000 -- (-2135.857) (-2138.110) (-2137.371) [-2134.051] * (-2135.535) (-2132.313) [-2132.177] (-2134.946) -- 0:02:17
382500 -- [-2137.497] (-2132.236) (-2139.647) (-2137.041) * [-2129.583] (-2138.265) (-2134.017) (-2138.475) -- 0:02:17
383000 -- (-2129.781) [-2134.668] (-2137.937) (-2131.889) * (-2130.860) (-2131.370) [-2132.987] (-2131.120) -- 0:02:16
383500 -- [-2133.717] (-2136.079) (-2136.793) (-2136.497) * (-2136.842) (-2141.471) (-2137.879) [-2130.300] -- 0:02:18
384000 -- (-2136.221) (-2135.770) (-2139.178) [-2134.525] * (-2140.062) [-2134.695] (-2135.953) (-2133.671) -- 0:02:17
384500 -- (-2135.111) (-2138.804) [-2133.237] (-2143.814) * (-2135.498) (-2133.427) [-2136.451] (-2131.204) -- 0:02:17
385000 -- (-2133.730) (-2139.350) [-2131.060] (-2138.256) * (-2137.668) (-2133.252) (-2134.345) [-2131.907] -- 0:02:17
Average standard deviation of split frequencies: 0.005699
385500 -- (-2134.996) (-2138.283) [-2135.416] (-2133.713) * (-2128.929) (-2138.016) (-2135.711) [-2135.795] -- 0:02:17
386000 -- (-2137.656) (-2136.961) (-2136.752) [-2134.904] * [-2136.267] (-2133.200) (-2135.492) (-2135.673) -- 0:02:16
386500 -- [-2137.467] (-2144.517) (-2138.264) (-2135.733) * (-2136.778) [-2131.802] (-2138.667) (-2135.837) -- 0:02:16
387000 -- [-2135.045] (-2140.590) (-2132.860) (-2134.759) * (-2132.233) (-2140.343) [-2130.462] (-2137.269) -- 0:02:16
387500 -- (-2139.349) (-2135.217) (-2133.210) [-2133.480] * (-2139.998) (-2138.522) (-2139.220) [-2135.120] -- 0:02:15
388000 -- [-2134.583] (-2135.672) (-2138.249) (-2133.880) * (-2132.539) [-2131.125] (-2140.511) (-2135.997) -- 0:02:17
388500 -- (-2135.574) (-2136.728) (-2145.672) [-2131.491] * (-2133.747) (-2133.035) [-2134.378] (-2133.041) -- 0:02:16
389000 -- [-2134.758] (-2134.165) (-2136.827) (-2144.822) * (-2133.492) [-2131.652] (-2132.459) (-2142.658) -- 0:02:16
389500 -- [-2131.547] (-2140.742) (-2136.759) (-2133.440) * (-2136.850) (-2131.125) [-2134.868] (-2141.294) -- 0:02:16
390000 -- [-2131.385] (-2142.860) (-2138.682) (-2136.181) * (-2130.943) [-2132.370] (-2137.059) (-2139.738) -- 0:02:16
Average standard deviation of split frequencies: 0.004424
390500 -- (-2136.422) [-2141.269] (-2134.251) (-2140.603) * (-2133.373) [-2133.948] (-2132.582) (-2136.291) -- 0:02:15
391000 -- (-2134.494) (-2143.374) (-2137.152) [-2130.199] * (-2133.076) [-2134.018] (-2142.890) (-2139.940) -- 0:02:15
391500 -- (-2133.607) (-2146.419) [-2139.224] (-2135.373) * (-2134.276) (-2133.025) (-2135.648) [-2133.075] -- 0:02:15
392000 -- (-2132.129) [-2140.081] (-2129.890) (-2138.621) * (-2145.040) [-2133.303] (-2133.906) (-2132.547) -- 0:02:14
392500 -- [-2132.202] (-2139.933) (-2132.989) (-2139.383) * (-2139.041) [-2136.345] (-2138.671) (-2135.643) -- 0:02:16
393000 -- (-2133.931) (-2136.819) [-2138.233] (-2137.219) * (-2134.756) (-2135.773) [-2134.398] (-2131.815) -- 0:02:15
393500 -- [-2131.079] (-2140.674) (-2143.287) (-2135.771) * (-2141.911) (-2133.231) (-2137.250) [-2131.515] -- 0:02:15
394000 -- [-2134.031] (-2137.981) (-2135.953) (-2137.957) * (-2139.526) (-2133.271) [-2136.720] (-2135.991) -- 0:02:15
394500 -- (-2131.131) (-2138.480) (-2137.788) [-2134.319] * (-2146.182) [-2135.898] (-2134.421) (-2136.726) -- 0:02:15
395000 -- (-2145.348) (-2131.132) (-2140.464) [-2131.480] * (-2138.395) (-2134.318) [-2138.579] (-2138.365) -- 0:02:14
Average standard deviation of split frequencies: 0.002778
395500 -- (-2139.856) [-2134.839] (-2143.342) (-2136.249) * (-2141.780) (-2136.357) [-2136.775] (-2146.890) -- 0:02:14
396000 -- [-2132.151] (-2131.110) (-2140.656) (-2145.491) * (-2135.079) [-2136.131] (-2139.591) (-2137.266) -- 0:02:14
396500 -- (-2136.457) (-2133.010) (-2149.961) [-2134.705] * (-2142.067) (-2138.909) [-2137.950] (-2142.926) -- 0:02:13
397000 -- (-2134.669) (-2134.676) (-2143.357) [-2136.927] * [-2138.994] (-2144.394) (-2141.678) (-2138.001) -- 0:02:15
397500 -- (-2135.724) (-2135.126) [-2148.503] (-2143.676) * (-2132.264) (-2137.961) (-2142.049) [-2135.558] -- 0:02:14
398000 -- (-2138.131) [-2131.712] (-2143.817) (-2140.237) * (-2137.211) [-2135.422] (-2139.177) (-2137.656) -- 0:02:14
398500 -- [-2133.795] (-2131.252) (-2141.485) (-2138.120) * (-2133.941) (-2130.839) (-2139.023) [-2130.936] -- 0:02:14
399000 -- (-2136.203) [-2130.946] (-2138.234) (-2136.647) * (-2140.620) (-2131.999) (-2139.321) [-2132.412] -- 0:02:14
399500 -- [-2136.281] (-2134.300) (-2137.532) (-2133.506) * (-2135.591) (-2132.769) (-2139.246) [-2135.159] -- 0:02:13
400000 -- (-2136.031) (-2134.425) [-2135.619] (-2134.521) * (-2130.995) [-2133.195] (-2138.797) (-2136.638) -- 0:02:13
Average standard deviation of split frequencies: 0.001961
400500 -- [-2135.733] (-2132.547) (-2132.822) (-2141.538) * (-2138.248) [-2132.959] (-2134.449) (-2138.987) -- 0:02:13
401000 -- (-2135.244) (-2133.810) (-2138.325) [-2135.215] * (-2138.614) [-2134.780] (-2133.863) (-2145.542) -- 0:02:12
401500 -- (-2131.620) [-2137.798] (-2134.942) (-2135.243) * (-2138.160) (-2139.157) [-2133.738] (-2147.664) -- 0:02:14
402000 -- (-2132.329) (-2139.395) (-2137.575) [-2134.718] * (-2145.794) (-2132.662) [-2133.642] (-2135.864) -- 0:02:13
402500 -- [-2133.973] (-2144.840) (-2131.160) (-2133.433) * (-2141.698) [-2135.317] (-2132.694) (-2134.831) -- 0:02:13
403000 -- (-2135.600) (-2138.991) [-2134.102] (-2134.372) * (-2137.570) (-2134.605) [-2131.480] (-2134.926) -- 0:02:13
403500 -- (-2136.224) (-2134.798) [-2137.834] (-2133.330) * [-2135.603] (-2139.404) (-2140.647) (-2130.559) -- 0:02:13
404000 -- (-2131.593) (-2139.123) [-2133.140] (-2140.899) * (-2135.006) (-2133.708) (-2133.208) [-2131.521] -- 0:02:12
404500 -- (-2134.392) (-2135.452) [-2131.391] (-2137.225) * [-2133.290] (-2137.327) (-2133.587) (-2136.290) -- 0:02:12
405000 -- [-2136.233] (-2135.124) (-2130.983) (-2138.075) * [-2135.330] (-2132.656) (-2137.206) (-2133.193) -- 0:02:12
Average standard deviation of split frequencies: 0.002709
405500 -- (-2131.950) (-2140.202) (-2133.615) [-2133.075] * [-2133.841] (-2131.810) (-2140.483) (-2140.493) -- 0:02:11
406000 -- (-2137.469) (-2138.472) (-2136.232) [-2131.731] * (-2133.888) [-2129.342] (-2132.225) (-2138.069) -- 0:02:13
406500 -- (-2135.131) (-2134.724) (-2136.356) [-2137.932] * [-2129.585] (-2140.918) (-2130.925) (-2138.194) -- 0:02:12
407000 -- (-2139.913) (-2139.880) [-2131.254] (-2136.471) * (-2133.840) [-2130.883] (-2140.649) (-2140.982) -- 0:02:12
407500 -- (-2133.967) (-2136.892) [-2137.818] (-2137.576) * (-2130.298) [-2136.686] (-2138.408) (-2133.881) -- 0:02:12
408000 -- (-2141.645) (-2136.703) [-2134.372] (-2135.783) * [-2134.156] (-2137.556) (-2137.012) (-2141.405) -- 0:02:12
408500 -- [-2133.552] (-2139.907) (-2141.371) (-2135.388) * (-2139.660) (-2136.466) (-2136.569) [-2131.969] -- 0:02:11
409000 -- (-2140.095) (-2132.518) (-2137.562) [-2133.912] * (-2140.588) (-2132.553) [-2132.357] (-2139.454) -- 0:02:11
409500 -- [-2138.960] (-2134.945) (-2144.907) (-2134.688) * [-2135.864] (-2137.829) (-2134.783) (-2132.511) -- 0:02:11
410000 -- [-2131.626] (-2133.660) (-2141.711) (-2134.142) * (-2148.513) (-2135.009) (-2135.250) [-2134.800] -- 0:02:10
Average standard deviation of split frequencies: 0.000383
410500 -- (-2138.419) [-2135.595] (-2140.562) (-2133.994) * (-2139.618) (-2135.469) (-2137.649) [-2132.396] -- 0:02:12
411000 -- [-2135.122] (-2133.676) (-2136.314) (-2141.708) * (-2140.235) [-2137.882] (-2138.951) (-2141.814) -- 0:02:11
411500 -- (-2134.775) [-2132.005] (-2143.028) (-2138.389) * (-2135.273) [-2134.717] (-2136.730) (-2142.424) -- 0:02:11
412000 -- [-2131.795] (-2134.130) (-2136.756) (-2137.345) * (-2135.189) [-2132.892] (-2136.334) (-2147.719) -- 0:02:11
412500 -- (-2133.565) [-2136.592] (-2131.471) (-2137.049) * [-2135.397] (-2139.321) (-2132.004) (-2144.329) -- 0:02:11
413000 -- (-2133.755) (-2133.817) [-2135.429] (-2135.272) * (-2133.500) [-2129.850] (-2136.350) (-2145.143) -- 0:02:10
413500 -- (-2131.601) [-2136.164] (-2140.156) (-2137.034) * (-2141.120) (-2132.193) [-2137.569] (-2137.958) -- 0:02:10
414000 -- (-2132.849) [-2133.604] (-2132.062) (-2136.479) * (-2137.058) (-2133.554) [-2131.614] (-2139.790) -- 0:02:10
414500 -- (-2135.007) (-2137.491) [-2139.270] (-2138.830) * (-2130.126) [-2138.620] (-2132.839) (-2135.717) -- 0:02:09
415000 -- [-2135.313] (-2140.726) (-2138.137) (-2138.128) * [-2133.278] (-2134.458) (-2131.135) (-2143.304) -- 0:02:11
Average standard deviation of split frequencies: 0.001133
415500 -- [-2137.852] (-2134.841) (-2141.924) (-2139.303) * (-2131.237) [-2135.227] (-2143.394) (-2133.587) -- 0:02:10
416000 -- (-2142.044) (-2135.169) (-2136.664) [-2134.760] * (-2135.080) (-2136.790) [-2132.698] (-2136.210) -- 0:02:10
416500 -- (-2148.914) (-2136.990) (-2135.242) [-2134.794] * [-2134.835] (-2135.309) (-2137.765) (-2135.414) -- 0:02:10
417000 -- [-2131.830] (-2142.096) (-2139.128) (-2131.769) * (-2138.672) (-2135.104) (-2131.815) [-2131.608] -- 0:02:10
417500 -- [-2134.601] (-2134.003) (-2136.951) (-2134.761) * (-2130.464) (-2130.456) (-2142.790) [-2134.367] -- 0:02:09
418000 -- [-2134.157] (-2135.093) (-2131.865) (-2131.844) * (-2133.427) (-2131.307) [-2141.172] (-2135.593) -- 0:02:09
418500 -- (-2136.932) (-2135.887) (-2135.808) [-2133.190] * [-2131.106] (-2134.307) (-2132.687) (-2134.398) -- 0:02:09
419000 -- (-2131.450) [-2136.164] (-2142.707) (-2131.532) * (-2133.245) (-2132.826) (-2133.211) [-2137.506] -- 0:02:08
419500 -- [-2135.055] (-2138.600) (-2139.229) (-2138.111) * (-2136.086) (-2134.844) (-2133.611) [-2133.615] -- 0:02:10
420000 -- [-2133.491] (-2141.264) (-2135.942) (-2134.765) * (-2137.207) [-2133.888] (-2134.937) (-2137.139) -- 0:02:09
Average standard deviation of split frequencies: 0.000747
420500 -- (-2136.073) (-2145.247) (-2131.781) [-2134.696] * [-2136.078] (-2141.022) (-2141.136) (-2144.191) -- 0:02:09
421000 -- (-2137.758) [-2136.710] (-2136.560) (-2135.828) * (-2134.480) (-2135.938) (-2137.506) [-2131.564] -- 0:02:09
421500 -- (-2135.404) (-2133.674) [-2137.675] (-2140.735) * [-2130.150] (-2135.162) (-2135.130) (-2134.435) -- 0:02:09
422000 -- [-2130.793] (-2133.558) (-2134.083) (-2136.722) * (-2132.003) (-2138.023) (-2133.286) [-2137.697] -- 0:02:08
422500 -- (-2133.841) (-2141.146) [-2136.579] (-2139.510) * [-2133.026] (-2145.070) (-2132.375) (-2138.454) -- 0:02:08
423000 -- (-2137.137) [-2133.641] (-2136.878) (-2132.556) * [-2134.154] (-2129.046) (-2136.263) (-2140.354) -- 0:02:08
423500 -- (-2138.958) [-2139.901] (-2134.794) (-2139.867) * (-2134.147) (-2135.754) (-2132.007) [-2129.890] -- 0:02:07
424000 -- (-2133.244) (-2135.278) (-2135.555) [-2141.640] * [-2132.942] (-2134.348) (-2132.791) (-2130.409) -- 0:02:09
424500 -- (-2136.697) (-2134.466) [-2136.716] (-2137.762) * (-2133.471) (-2137.968) [-2131.176] (-2136.227) -- 0:02:08
425000 -- [-2131.977] (-2134.325) (-2133.629) (-2138.010) * (-2134.086) (-2138.927) (-2134.993) [-2135.673] -- 0:02:08
Average standard deviation of split frequencies: 0.000738
425500 -- (-2135.290) (-2135.860) (-2135.299) [-2141.011] * [-2131.972] (-2135.126) (-2134.354) (-2132.885) -- 0:02:08
426000 -- (-2136.215) (-2130.540) [-2132.993] (-2139.250) * [-2137.408] (-2137.413) (-2137.308) (-2131.095) -- 0:02:08
426500 -- (-2136.560) (-2131.270) (-2135.716) [-2131.133] * (-2137.323) [-2135.920] (-2143.081) (-2134.673) -- 0:02:07
427000 -- [-2133.695] (-2137.309) (-2134.884) (-2133.764) * (-2137.668) (-2134.430) (-2139.488) [-2133.648] -- 0:02:07
427500 -- (-2140.377) [-2138.388] (-2131.861) (-2135.128) * [-2134.540] (-2134.032) (-2136.603) (-2136.534) -- 0:02:07
428000 -- (-2131.421) (-2132.221) (-2136.605) [-2133.942] * [-2134.259] (-2131.660) (-2133.782) (-2133.808) -- 0:02:06
428500 -- (-2133.141) (-2137.560) (-2131.907) [-2141.985] * (-2142.283) [-2131.239] (-2134.428) (-2135.185) -- 0:02:08
429000 -- (-2132.610) (-2135.822) (-2134.581) [-2138.266] * (-2138.168) (-2137.892) (-2135.377) [-2134.665] -- 0:02:07
429500 -- (-2134.439) (-2135.310) [-2137.169] (-2132.223) * (-2132.308) (-2134.639) (-2135.912) [-2131.511] -- 0:02:07
430000 -- [-2137.509] (-2134.943) (-2134.537) (-2145.628) * (-2134.196) (-2136.263) [-2132.985] (-2136.162) -- 0:02:07
Average standard deviation of split frequencies: 0.001824
430500 -- (-2132.377) (-2132.764) [-2133.429] (-2139.870) * (-2140.520) (-2134.122) (-2134.310) [-2135.527] -- 0:02:06
431000 -- (-2138.404) [-2133.948] (-2135.751) (-2137.190) * (-2136.488) (-2136.966) [-2132.965] (-2137.417) -- 0:02:06
431500 -- [-2136.774] (-2132.109) (-2141.529) (-2136.708) * (-2133.347) (-2133.090) [-2134.157] (-2143.202) -- 0:02:06
432000 -- (-2140.253) (-2135.350) (-2137.398) [-2134.001] * [-2137.125] (-2132.437) (-2134.041) (-2132.066) -- 0:02:06
432500 -- (-2142.696) [-2133.753] (-2136.433) (-2137.697) * (-2138.069) [-2135.048] (-2134.289) (-2135.371) -- 0:02:05
433000 -- (-2141.216) [-2133.433] (-2136.339) (-2141.707) * (-2145.870) [-2135.634] (-2131.897) (-2139.167) -- 0:02:07
433500 -- (-2141.890) (-2132.037) [-2131.983] (-2139.158) * (-2135.002) (-2135.918) (-2132.137) [-2130.690] -- 0:02:06
434000 -- (-2133.605) (-2137.079) [-2136.304] (-2141.970) * (-2132.924) [-2134.178] (-2135.247) (-2134.539) -- 0:02:06
434500 -- [-2136.951] (-2137.215) (-2138.084) (-2138.430) * (-2139.896) [-2131.360] (-2140.701) (-2133.959) -- 0:02:06
435000 -- (-2139.744) (-2134.648) [-2137.379] (-2142.830) * (-2139.042) [-2130.976] (-2142.563) (-2134.115) -- 0:02:05
Average standard deviation of split frequencies: 0.003244
435500 -- [-2141.795] (-2138.613) (-2141.506) (-2145.018) * [-2135.496] (-2136.987) (-2147.610) (-2140.087) -- 0:02:05
436000 -- (-2137.981) (-2134.500) [-2140.953] (-2139.344) * (-2133.135) (-2142.250) [-2132.995] (-2140.831) -- 0:02:05
436500 -- (-2134.205) (-2132.765) [-2131.323] (-2138.973) * (-2133.116) (-2137.673) [-2135.763] (-2136.424) -- 0:02:05
437000 -- (-2138.639) [-2134.080] (-2130.811) (-2140.816) * [-2135.213] (-2136.629) (-2135.943) (-2144.741) -- 0:02:04
437500 -- (-2142.906) (-2133.576) [-2135.638] (-2132.804) * (-2146.422) (-2137.145) (-2134.172) [-2135.802] -- 0:02:06
438000 -- (-2136.945) (-2132.866) (-2132.176) [-2132.430] * (-2135.607) (-2137.375) [-2130.420] (-2138.477) -- 0:02:05
438500 -- (-2134.680) (-2134.500) [-2132.124] (-2136.152) * (-2138.589) (-2131.889) [-2133.785] (-2134.950) -- 0:02:05
439000 -- (-2140.456) [-2135.046] (-2129.716) (-2141.246) * (-2138.875) [-2133.014] (-2133.611) (-2135.919) -- 0:02:05
439500 -- (-2139.543) [-2134.875] (-2138.386) (-2132.278) * (-2132.698) (-2136.173) [-2136.031] (-2139.088) -- 0:02:04
440000 -- (-2140.715) (-2140.233) (-2137.440) [-2132.424] * (-2135.327) (-2134.656) [-2135.156] (-2135.263) -- 0:02:04
Average standard deviation of split frequencies: 0.002496
440500 -- (-2136.990) (-2139.884) (-2135.666) [-2132.758] * (-2138.985) (-2136.035) (-2132.844) [-2135.374] -- 0:02:04
441000 -- (-2141.155) (-2147.571) (-2134.118) [-2135.913] * (-2138.975) [-2135.341] (-2133.211) (-2135.970) -- 0:02:04
441500 -- (-2138.730) (-2141.459) [-2132.786] (-2141.526) * (-2133.327) (-2135.917) (-2132.466) [-2137.242] -- 0:02:03
442000 -- (-2132.717) [-2133.842] (-2134.800) (-2137.186) * [-2130.268] (-2148.903) (-2136.942) (-2133.268) -- 0:02:04
442500 -- (-2133.989) (-2140.294) [-2132.126] (-2134.206) * [-2133.894] (-2129.000) (-2134.941) (-2135.686) -- 0:02:04
443000 -- (-2137.318) [-2137.864] (-2137.472) (-2132.513) * (-2136.377) (-2140.019) [-2137.054] (-2131.841) -- 0:02:04
443500 -- (-2139.371) [-2139.815] (-2137.005) (-2132.238) * (-2134.563) (-2135.496) [-2136.878] (-2134.140) -- 0:02:04
444000 -- (-2131.618) [-2131.035] (-2146.609) (-2141.169) * (-2142.801) (-2133.662) (-2138.464) [-2133.174] -- 0:02:03
444500 -- (-2136.746) [-2135.127] (-2138.233) (-2135.674) * [-2139.700] (-2135.529) (-2131.659) (-2135.362) -- 0:02:03
445000 -- (-2142.445) (-2139.845) (-2133.656) [-2131.102] * (-2138.443) [-2136.654] (-2142.410) (-2136.694) -- 0:02:03
Average standard deviation of split frequencies: 0.003876
445500 -- (-2138.761) (-2136.198) (-2134.465) [-2131.565] * (-2134.408) (-2132.711) [-2134.234] (-2135.810) -- 0:02:03
446000 -- (-2136.520) (-2135.702) [-2134.049] (-2134.580) * [-2129.881] (-2143.322) (-2139.785) (-2137.224) -- 0:02:02
446500 -- [-2132.061] (-2138.556) (-2140.010) (-2133.924) * [-2136.214] (-2141.534) (-2139.419) (-2134.393) -- 0:02:03
447000 -- (-2141.373) [-2131.656] (-2138.824) (-2132.873) * [-2132.262] (-2141.449) (-2138.800) (-2135.482) -- 0:02:03
447500 -- [-2138.057] (-2137.778) (-2134.583) (-2134.745) * (-2135.991) [-2136.104] (-2139.960) (-2145.654) -- 0:02:03
448000 -- (-2134.078) (-2135.187) (-2144.489) [-2132.349] * (-2133.178) [-2137.006] (-2140.357) (-2133.935) -- 0:02:03
448500 -- (-2137.689) [-2133.901] (-2135.174) (-2137.421) * [-2134.993] (-2132.165) (-2130.447) (-2132.956) -- 0:02:02
449000 -- (-2130.441) [-2135.609] (-2133.099) (-2134.510) * (-2138.677) (-2134.540) (-2134.733) [-2140.306] -- 0:02:02
449500 -- (-2132.493) (-2133.173) [-2134.562] (-2136.455) * (-2138.133) [-2134.023] (-2136.692) (-2131.680) -- 0:02:02
450000 -- (-2134.171) (-2132.237) (-2132.192) [-2135.593] * (-2138.116) [-2135.911] (-2138.335) (-2138.714) -- 0:02:02
Average standard deviation of split frequencies: 0.003835
450500 -- (-2132.588) [-2132.732] (-2132.728) (-2131.804) * (-2139.726) (-2146.736) [-2139.190] (-2136.229) -- 0:02:01
451000 -- (-2136.682) (-2130.481) (-2136.033) [-2136.051] * (-2140.953) [-2137.297] (-2138.047) (-2135.236) -- 0:02:02
451500 -- (-2132.058) (-2135.086) [-2133.086] (-2132.653) * (-2133.502) [-2142.150] (-2134.969) (-2141.566) -- 0:02:02
452000 -- [-2133.013] (-2136.370) (-2132.693) (-2134.916) * (-2137.435) [-2135.235] (-2140.868) (-2144.244) -- 0:02:02
452500 -- [-2135.653] (-2141.514) (-2141.435) (-2136.040) * [-2136.084] (-2137.156) (-2137.545) (-2144.393) -- 0:02:02
453000 -- (-2142.124) (-2136.690) (-2141.512) [-2133.377] * [-2135.631] (-2141.587) (-2140.003) (-2131.542) -- 0:02:01
453500 -- (-2134.622) (-2135.619) (-2139.884) [-2134.434] * [-2137.574] (-2145.488) (-2131.011) (-2140.882) -- 0:02:01
454000 -- (-2133.384) (-2137.209) [-2135.163] (-2132.631) * (-2133.447) [-2137.304] (-2139.122) (-2135.242) -- 0:02:01
454500 -- (-2142.545) (-2135.466) (-2133.780) [-2132.829] * (-2137.489) [-2141.084] (-2138.286) (-2137.479) -- 0:02:01
455000 -- (-2138.430) (-2136.582) [-2132.475] (-2132.071) * (-2137.482) (-2132.704) [-2135.174] (-2143.202) -- 0:02:00
Average standard deviation of split frequencies: 0.002412
455500 -- (-2137.683) [-2138.468] (-2136.406) (-2141.309) * (-2132.624) (-2133.911) [-2133.151] (-2137.421) -- 0:02:01
456000 -- (-2138.468) (-2134.505) (-2129.998) [-2136.484] * (-2133.275) (-2138.444) (-2138.273) [-2137.421] -- 0:02:01
456500 -- (-2134.571) (-2132.148) (-2130.282) [-2134.788] * (-2132.524) (-2134.240) [-2132.559] (-2133.385) -- 0:02:01
457000 -- (-2136.175) (-2135.440) (-2141.483) [-2130.174] * [-2136.799] (-2135.490) (-2134.377) (-2131.261) -- 0:02:01
457500 -- (-2132.885) (-2141.830) [-2134.896] (-2136.612) * [-2135.920] (-2135.035) (-2132.181) (-2144.449) -- 0:02:00
458000 -- [-2133.019] (-2137.063) (-2138.477) (-2133.207) * (-2133.000) [-2131.313] (-2139.960) (-2139.722) -- 0:02:00
458500 -- (-2132.390) (-2131.387) (-2132.021) [-2137.082] * (-2137.500) (-2135.866) (-2140.643) [-2133.112] -- 0:02:00
459000 -- (-2135.708) [-2137.323] (-2144.914) (-2134.319) * (-2135.883) (-2133.074) [-2136.948] (-2132.931) -- 0:02:00
459500 -- (-2136.691) (-2135.832) [-2132.138] (-2141.078) * (-2134.728) [-2130.757] (-2139.544) (-2135.474) -- 0:01:59
460000 -- (-2135.118) (-2138.923) [-2134.244] (-2134.041) * [-2133.227] (-2131.752) (-2134.210) (-2138.228) -- 0:02:00
Average standard deviation of split frequencies: 0.003070
460500 -- (-2135.673) [-2137.914] (-2134.926) (-2132.605) * (-2150.668) [-2133.525] (-2130.369) (-2139.630) -- 0:02:00
461000 -- (-2133.835) (-2133.394) (-2136.087) [-2143.289] * (-2143.346) (-2133.317) [-2135.132] (-2141.058) -- 0:02:00
461500 -- [-2138.132] (-2135.580) (-2134.662) (-2135.917) * [-2134.463] (-2137.463) (-2137.771) (-2137.519) -- 0:02:00
462000 -- [-2131.670] (-2137.422) (-2137.670) (-2141.218) * (-2131.514) [-2138.024] (-2139.040) (-2138.431) -- 0:01:59
462500 -- (-2139.115) (-2139.091) [-2132.788] (-2138.027) * (-2138.659) [-2136.244] (-2137.422) (-2141.628) -- 0:01:59
463000 -- [-2136.736] (-2145.824) (-2134.828) (-2139.182) * (-2145.949) (-2134.412) (-2132.384) [-2142.428] -- 0:01:59
463500 -- (-2135.412) (-2132.922) [-2134.714] (-2135.105) * (-2134.829) [-2132.824] (-2138.222) (-2137.544) -- 0:01:59
464000 -- [-2133.156] (-2136.812) (-2133.386) (-2145.308) * (-2140.515) (-2138.488) (-2136.133) [-2137.017] -- 0:01:58
464500 -- (-2137.175) (-2135.832) [-2130.619] (-2140.784) * (-2143.038) (-2134.309) (-2134.006) [-2130.468] -- 0:01:59
465000 -- (-2133.586) (-2133.699) [-2134.457] (-2138.195) * (-2144.216) (-2134.731) (-2134.338) [-2131.695] -- 0:01:59
Average standard deviation of split frequencies: 0.005058
465500 -- (-2142.288) [-2136.365] (-2135.353) (-2144.100) * (-2140.204) (-2140.975) (-2136.722) [-2133.572] -- 0:01:59
466000 -- (-2146.079) (-2135.255) (-2132.910) [-2137.551] * (-2140.615) (-2135.794) (-2133.426) [-2133.742] -- 0:01:59
466500 -- (-2133.165) (-2133.547) [-2132.200] (-2136.531) * (-2136.916) (-2139.044) [-2133.082] (-2133.812) -- 0:01:58
467000 -- (-2131.460) [-2139.985] (-2132.731) (-2132.820) * (-2142.874) (-2141.544) [-2133.083] (-2134.708) -- 0:01:58
467500 -- [-2129.880] (-2136.119) (-2134.860) (-2136.310) * (-2134.434) (-2139.354) [-2135.010] (-2133.498) -- 0:01:58
468000 -- (-2129.792) (-2136.708) (-2135.803) [-2132.753] * (-2132.041) [-2138.345] (-2136.910) (-2131.408) -- 0:01:58
468500 -- (-2135.641) (-2133.616) [-2134.468] (-2133.249) * (-2133.991) [-2135.374] (-2132.394) (-2134.584) -- 0:01:57
469000 -- [-2139.814] (-2134.238) (-2134.687) (-2134.320) * (-2140.845) (-2134.137) [-2139.060] (-2137.278) -- 0:01:58
469500 -- (-2145.470) (-2135.895) (-2134.234) [-2135.139] * (-2135.823) [-2136.331] (-2131.298) (-2140.518) -- 0:01:58
470000 -- (-2144.448) (-2150.301) [-2143.935] (-2135.649) * (-2140.017) [-2140.086] (-2134.750) (-2137.642) -- 0:01:58
Average standard deviation of split frequencies: 0.005676
470500 -- [-2134.899] (-2137.576) (-2146.835) (-2135.338) * (-2134.931) (-2134.253) [-2134.678] (-2138.532) -- 0:01:58
471000 -- (-2138.538) [-2139.917] (-2137.425) (-2138.109) * (-2135.892) [-2136.775] (-2136.352) (-2137.618) -- 0:01:57
471500 -- (-2136.696) [-2136.726] (-2141.229) (-2130.010) * [-2134.270] (-2136.979) (-2142.972) (-2140.208) -- 0:01:57
472000 -- [-2136.432] (-2139.048) (-2139.882) (-2135.570) * (-2137.708) [-2137.308] (-2133.203) (-2137.293) -- 0:01:57
472500 -- (-2135.027) (-2138.442) (-2138.272) [-2131.163] * (-2129.321) (-2136.337) [-2135.358] (-2137.578) -- 0:01:57
473000 -- (-2137.663) (-2134.487) [-2133.202] (-2130.296) * [-2131.961] (-2134.454) (-2137.061) (-2143.271) -- 0:01:56
473500 -- (-2135.154) (-2134.340) [-2136.873] (-2136.042) * (-2130.562) (-2135.354) (-2139.053) [-2133.985] -- 0:01:57
474000 -- [-2132.224] (-2133.194) (-2139.237) (-2134.631) * (-2135.098) [-2132.495] (-2140.655) (-2134.366) -- 0:01:57
474500 -- (-2139.436) (-2143.431) (-2136.144) [-2133.032] * (-2135.792) [-2138.737] (-2137.737) (-2140.715) -- 0:01:57
475000 -- (-2134.103) [-2137.355] (-2133.847) (-2133.673) * (-2135.015) (-2137.429) (-2138.005) [-2135.809] -- 0:01:57
Average standard deviation of split frequencies: 0.006932
475500 -- [-2135.795] (-2138.549) (-2146.227) (-2132.887) * [-2129.746] (-2133.715) (-2135.213) (-2132.813) -- 0:01:56
476000 -- (-2138.993) (-2131.951) [-2135.306] (-2133.595) * (-2134.720) [-2135.440] (-2133.048) (-2133.076) -- 0:01:56
476500 -- (-2143.180) (-2132.857) [-2135.060] (-2139.283) * (-2135.613) [-2133.049] (-2138.154) (-2132.229) -- 0:01:56
477000 -- [-2134.285] (-2131.626) (-2136.553) (-2134.470) * (-2134.489) [-2139.399] (-2132.896) (-2136.496) -- 0:01:56
477500 -- (-2136.385) [-2131.674] (-2143.962) (-2136.324) * (-2143.386) (-2132.211) [-2136.463] (-2137.021) -- 0:01:55
478000 -- [-2136.400] (-2139.918) (-2144.531) (-2137.298) * (-2140.386) (-2132.398) (-2135.749) [-2140.182] -- 0:01:56
478500 -- (-2132.751) [-2132.115] (-2133.584) (-2134.600) * (-2137.639) [-2133.682] (-2139.802) (-2137.291) -- 0:01:56
479000 -- (-2133.428) [-2133.234] (-2143.485) (-2132.356) * (-2139.429) (-2139.785) (-2138.522) [-2131.587] -- 0:01:56
479500 -- [-2135.110] (-2136.263) (-2136.186) (-2136.659) * [-2135.599] (-2136.227) (-2134.264) (-2139.372) -- 0:01:56
480000 -- (-2135.303) (-2131.836) [-2133.765] (-2147.772) * (-2137.795) (-2133.336) (-2136.026) [-2135.306] -- 0:01:55
Average standard deviation of split frequencies: 0.006211
480500 -- (-2140.353) (-2134.338) [-2134.615] (-2138.794) * (-2138.512) (-2142.144) [-2139.848] (-2137.018) -- 0:01:55
481000 -- (-2131.442) (-2139.197) [-2137.022] (-2134.494) * [-2135.662] (-2136.578) (-2139.802) (-2130.301) -- 0:01:55
481500 -- (-2135.565) (-2135.802) [-2131.247] (-2136.317) * [-2136.810] (-2138.971) (-2136.872) (-2131.320) -- 0:01:55
482000 -- (-2136.635) (-2132.646) [-2133.619] (-2131.772) * [-2130.740] (-2137.222) (-2133.770) (-2132.097) -- 0:01:54
482500 -- (-2140.458) (-2132.302) [-2131.385] (-2137.770) * (-2134.047) (-2139.628) (-2137.451) [-2139.994] -- 0:01:55
483000 -- (-2136.303) (-2137.136) [-2134.127] (-2134.195) * (-2130.833) (-2138.377) [-2133.514] (-2136.484) -- 0:01:55
483500 -- (-2133.713) (-2134.711) [-2134.442] (-2136.561) * [-2130.946] (-2139.836) (-2131.149) (-2134.830) -- 0:01:55
484000 -- (-2132.696) (-2132.832) (-2141.317) [-2136.921] * [-2129.367] (-2136.974) (-2131.383) (-2141.536) -- 0:01:55
484500 -- [-2130.840] (-2135.674) (-2138.274) (-2134.457) * (-2132.256) (-2138.076) [-2132.995] (-2132.179) -- 0:01:54
485000 -- (-2135.575) [-2139.706] (-2137.182) (-2132.537) * (-2135.644) (-2134.323) [-2132.426] (-2135.912) -- 0:01:54
Average standard deviation of split frequencies: 0.004850
485500 -- (-2135.539) (-2142.190) [-2134.377] (-2139.139) * (-2146.832) (-2139.233) [-2135.905] (-2137.751) -- 0:01:54
486000 -- (-2144.430) [-2135.393] (-2135.138) (-2134.343) * (-2138.976) (-2136.267) (-2139.372) [-2134.179] -- 0:01:54
486500 -- [-2132.044] (-2135.037) (-2136.948) (-2135.727) * (-2135.263) [-2130.809] (-2136.508) (-2131.852) -- 0:01:53
487000 -- [-2134.567] (-2138.941) (-2143.159) (-2137.828) * (-2137.272) (-2140.130) [-2144.427] (-2130.939) -- 0:01:54
487500 -- (-2129.617) (-2139.979) (-2138.096) [-2138.490] * (-2138.095) [-2132.401] (-2142.467) (-2142.345) -- 0:01:54
488000 -- (-2137.071) (-2137.764) [-2136.805] (-2139.621) * (-2134.861) [-2130.624] (-2143.423) (-2135.800) -- 0:01:54
488500 -- (-2134.812) [-2135.963] (-2133.195) (-2136.778) * (-2135.002) (-2137.596) [-2134.705] (-2134.261) -- 0:01:54
489000 -- (-2135.412) (-2137.254) [-2136.896] (-2133.147) * (-2136.962) (-2137.831) (-2136.370) [-2134.738] -- 0:01:53
489500 -- [-2133.757] (-2135.847) (-2140.278) (-2135.194) * (-2136.398) (-2139.216) (-2129.623) [-2135.832] -- 0:01:53
490000 -- [-2131.976] (-2134.892) (-2144.069) (-2130.404) * (-2138.332) (-2136.102) [-2129.362] (-2138.897) -- 0:01:53
Average standard deviation of split frequencies: 0.003843
490500 -- (-2136.039) (-2140.067) (-2138.477) [-2138.705] * [-2133.701] (-2146.886) (-2131.451) (-2131.322) -- 0:01:53
491000 -- (-2133.890) [-2137.123] (-2133.910) (-2134.792) * (-2135.401) (-2136.010) [-2135.363] (-2136.767) -- 0:01:54
491500 -- [-2140.170] (-2135.097) (-2136.644) (-2134.735) * (-2129.430) (-2140.891) [-2132.141] (-2139.781) -- 0:01:53
492000 -- (-2143.814) (-2133.605) (-2136.954) [-2132.478] * (-2129.782) (-2139.384) [-2133.082] (-2138.814) -- 0:01:53
492500 -- (-2141.576) [-2136.690] (-2133.992) (-2139.801) * (-2134.706) (-2138.687) (-2132.117) [-2133.606] -- 0:01:53
493000 -- (-2141.981) (-2138.071) (-2136.272) [-2132.799] * (-2134.622) (-2133.636) (-2131.142) [-2131.958] -- 0:01:53
493500 -- (-2137.231) (-2134.676) [-2131.240] (-2138.550) * (-2135.164) (-2139.089) (-2132.749) [-2134.182] -- 0:01:52
494000 -- (-2136.527) (-2134.122) (-2138.562) [-2129.650] * (-2133.409) (-2140.192) [-2132.795] (-2136.039) -- 0:01:52
494500 -- (-2137.212) [-2136.096] (-2134.806) (-2137.787) * (-2134.582) (-2134.980) [-2137.248] (-2134.874) -- 0:01:52
495000 -- (-2131.898) (-2136.781) (-2138.063) [-2139.314] * (-2132.218) (-2130.910) (-2131.216) [-2137.560] -- 0:01:52
Average standard deviation of split frequencies: 0.004752
495500 -- (-2136.414) (-2139.515) [-2132.996] (-2140.580) * (-2132.051) (-2140.322) [-2134.363] (-2141.077) -- 0:01:53
496000 -- [-2128.625] (-2132.858) (-2135.063) (-2135.599) * [-2130.186] (-2133.806) (-2136.708) (-2142.088) -- 0:01:52
496500 -- (-2133.748) (-2138.951) (-2136.498) [-2131.496] * (-2129.655) (-2138.106) [-2134.011] (-2135.759) -- 0:01:52
497000 -- [-2136.632] (-2139.529) (-2135.839) (-2137.715) * (-2137.319) (-2133.398) (-2132.809) [-2134.875] -- 0:01:52
497500 -- [-2131.486] (-2143.236) (-2142.123) (-2134.233) * (-2139.935) (-2136.129) [-2135.234] (-2138.799) -- 0:01:52
498000 -- (-2137.210) [-2135.195] (-2129.104) (-2138.076) * (-2141.563) [-2139.752] (-2134.869) (-2135.967) -- 0:01:51
498500 -- (-2134.548) (-2137.136) [-2130.183] (-2142.015) * (-2133.614) (-2134.088) [-2133.562] (-2138.019) -- 0:01:51
499000 -- (-2134.507) (-2148.087) (-2136.205) [-2132.869] * (-2140.702) (-2133.175) (-2134.179) [-2133.779] -- 0:01:51
499500 -- (-2141.402) (-2130.612) (-2137.982) [-2135.393] * (-2136.570) [-2131.176] (-2135.669) (-2139.925) -- 0:01:51
500000 -- (-2136.231) [-2132.737] (-2132.773) (-2132.666) * (-2144.498) [-2134.642] (-2134.254) (-2131.091) -- 0:01:52
Average standard deviation of split frequencies: 0.004708
500500 -- (-2137.838) (-2140.286) (-2143.076) [-2132.695] * [-2135.031] (-2134.089) (-2134.351) (-2133.738) -- 0:01:51
501000 -- (-2136.217) (-2131.052) (-2138.241) [-2139.722] * (-2139.775) (-2137.068) (-2134.727) [-2135.818] -- 0:01:51
501500 -- (-2139.835) [-2132.999] (-2145.233) (-2136.328) * (-2137.639) (-2132.232) (-2138.607) [-2132.931] -- 0:01:51
502000 -- (-2133.035) [-2132.103] (-2141.163) (-2135.105) * (-2136.940) (-2135.616) (-2134.722) [-2138.227] -- 0:01:51
502500 -- (-2135.823) (-2135.941) (-2141.832) [-2134.095] * (-2133.960) [-2139.276] (-2135.110) (-2138.880) -- 0:01:50
503000 -- (-2138.764) (-2133.518) [-2133.501] (-2137.999) * [-2132.809] (-2132.314) (-2138.057) (-2133.617) -- 0:01:50
503500 -- [-2137.723] (-2134.678) (-2139.115) (-2131.184) * (-2134.469) (-2134.812) [-2134.213] (-2136.952) -- 0:01:50
504000 -- [-2132.707] (-2132.756) (-2138.450) (-2131.343) * (-2138.759) (-2133.687) (-2136.709) [-2136.511] -- 0:01:50
504500 -- (-2136.997) [-2130.879] (-2138.643) (-2137.169) * (-2136.269) (-2132.950) [-2138.625] (-2135.612) -- 0:01:50
505000 -- (-2135.604) [-2132.878] (-2133.204) (-2133.619) * (-2143.418) [-2131.696] (-2138.913) (-2141.307) -- 0:01:50
Average standard deviation of split frequencies: 0.003416
505500 -- [-2135.487] (-2134.728) (-2137.530) (-2138.909) * [-2137.025] (-2137.645) (-2132.372) (-2135.983) -- 0:01:50
506000 -- (-2144.376) (-2136.497) [-2136.405] (-2134.376) * (-2136.360) (-2129.199) [-2132.552] (-2137.091) -- 0:01:50
506500 -- (-2148.114) (-2129.640) (-2134.596) [-2135.014] * (-2135.017) (-2134.813) [-2138.912] (-2130.984) -- 0:01:50
507000 -- (-2136.611) (-2140.854) (-2137.369) [-2131.186] * (-2139.083) [-2136.047] (-2137.934) (-2130.565) -- 0:01:49
507500 -- (-2133.877) (-2143.456) [-2138.167] (-2136.839) * (-2137.760) (-2137.529) [-2135.690] (-2134.502) -- 0:01:49
508000 -- (-2137.331) (-2138.313) (-2139.342) [-2132.800] * [-2138.023] (-2142.083) (-2136.049) (-2136.523) -- 0:01:49
508500 -- (-2141.277) (-2138.321) (-2138.647) [-2138.123] * (-2135.093) [-2140.273] (-2140.337) (-2139.797) -- 0:01:49
509000 -- (-2141.243) (-2136.224) (-2142.591) [-2133.280] * (-2135.285) [-2139.002] (-2140.303) (-2140.295) -- 0:01:49
509500 -- (-2146.073) (-2137.699) (-2137.485) [-2135.856] * (-2139.859) (-2144.365) (-2134.916) [-2134.141] -- 0:01:49
510000 -- [-2139.875] (-2135.277) (-2138.210) (-2138.203) * (-2138.180) (-2133.674) [-2133.368] (-2134.264) -- 0:01:49
Average standard deviation of split frequencies: 0.003385
510500 -- (-2140.118) [-2138.059] (-2137.498) (-2133.864) * (-2139.390) [-2132.846] (-2130.121) (-2133.154) -- 0:01:49
511000 -- [-2137.035] (-2133.411) (-2134.176) (-2131.464) * (-2136.871) (-2137.745) (-2137.758) [-2132.530] -- 0:01:49
511500 -- (-2137.664) (-2138.558) (-2136.031) [-2136.185] * (-2137.867) (-2137.931) [-2132.563] (-2142.700) -- 0:01:48
512000 -- [-2132.950] (-2130.976) (-2136.985) (-2136.963) * (-2132.806) (-2136.595) [-2132.833] (-2139.114) -- 0:01:48
512500 -- [-2133.844] (-2131.944) (-2133.968) (-2139.223) * (-2140.346) [-2137.763] (-2136.781) (-2131.591) -- 0:01:48
513000 -- (-2138.574) (-2134.648) (-2138.608) [-2137.917] * (-2141.615) [-2135.889] (-2141.446) (-2137.213) -- 0:01:48
513500 -- (-2135.533) (-2143.239) (-2136.188) [-2135.877] * [-2140.680] (-2138.506) (-2134.889) (-2132.830) -- 0:01:48
514000 -- (-2138.885) [-2134.985] (-2138.839) (-2134.951) * (-2141.207) (-2141.832) (-2149.645) [-2137.227] -- 0:01:48
514500 -- [-2133.662] (-2134.197) (-2138.805) (-2135.168) * (-2140.280) (-2145.548) (-2133.831) [-2133.256] -- 0:01:48
515000 -- (-2141.113) (-2132.676) (-2131.089) [-2133.442] * [-2136.649] (-2143.099) (-2131.383) (-2134.495) -- 0:01:48
Average standard deviation of split frequencies: 0.005177
515500 -- [-2135.639] (-2135.630) (-2137.178) (-2133.062) * (-2138.302) (-2143.949) (-2143.245) [-2135.428] -- 0:01:48
516000 -- (-2135.812) [-2135.804] (-2141.304) (-2138.834) * [-2137.551] (-2138.730) (-2136.107) (-2141.366) -- 0:01:47
516500 -- (-2138.368) (-2134.026) [-2134.116] (-2143.350) * (-2132.673) (-2138.167) (-2135.730) [-2133.493] -- 0:01:47
517000 -- [-2138.360] (-2131.032) (-2137.202) (-2133.862) * (-2138.681) [-2134.093] (-2130.863) (-2138.961) -- 0:01:47
517500 -- (-2138.688) (-2141.695) (-2140.275) [-2132.782] * (-2137.111) (-2144.097) (-2133.443) [-2134.302] -- 0:01:47
518000 -- (-2139.717) (-2140.187) (-2134.620) [-2130.042] * (-2136.613) [-2142.842] (-2134.772) (-2141.934) -- 0:01:47
518500 -- (-2136.970) (-2135.661) (-2132.582) [-2133.139] * (-2131.664) [-2137.695] (-2135.583) (-2139.809) -- 0:01:47
519000 -- (-2135.391) [-2133.357] (-2131.982) (-2131.502) * (-2136.091) [-2131.789] (-2133.172) (-2138.938) -- 0:01:47
519500 -- [-2133.517] (-2134.007) (-2134.049) (-2137.047) * (-2142.830) (-2129.743) (-2133.377) [-2137.576] -- 0:01:47
520000 -- (-2135.251) (-2135.509) [-2136.649] (-2143.021) * (-2137.180) (-2139.871) (-2136.346) [-2136.651] -- 0:01:47
Average standard deviation of split frequencies: 0.006640
520500 -- (-2129.622) (-2136.274) (-2133.159) [-2137.173] * (-2137.101) (-2140.942) [-2133.567] (-2139.303) -- 0:01:46
521000 -- (-2137.976) (-2133.754) (-2138.825) [-2136.286] * (-2135.988) (-2130.740) [-2134.836] (-2136.506) -- 0:01:46
521500 -- (-2145.455) (-2135.875) (-2142.802) [-2133.457] * (-2134.598) (-2136.700) [-2134.192] (-2137.925) -- 0:01:46
522000 -- [-2132.009] (-2132.738) (-2136.416) (-2135.859) * (-2133.330) (-2132.266) [-2136.916] (-2143.069) -- 0:01:46
522500 -- (-2133.554) [-2137.963] (-2138.422) (-2133.184) * [-2135.532] (-2132.804) (-2136.335) (-2134.019) -- 0:01:46
523000 -- (-2136.125) (-2137.688) [-2137.217] (-2138.791) * (-2135.788) [-2138.037] (-2139.769) (-2136.752) -- 0:01:46
523500 -- [-2133.903] (-2134.381) (-2130.623) (-2135.723) * (-2135.009) (-2145.942) [-2136.750] (-2137.913) -- 0:01:46
524000 -- (-2135.216) [-2136.456] (-2135.534) (-2134.307) * (-2133.361) (-2132.825) (-2137.593) [-2132.744] -- 0:01:46
524500 -- (-2141.716) [-2130.950] (-2133.570) (-2133.975) * (-2134.571) (-2141.093) (-2136.264) [-2136.748] -- 0:01:46
525000 -- [-2135.002] (-2132.241) (-2130.296) (-2136.187) * (-2131.085) (-2134.001) [-2130.842] (-2136.389) -- 0:01:45
Average standard deviation of split frequencies: 0.006572
525500 -- (-2136.669) [-2132.073] (-2133.948) (-2133.376) * (-2140.706) (-2133.929) (-2135.752) [-2137.423] -- 0:01:45
526000 -- (-2137.692) [-2136.744] (-2132.365) (-2135.208) * (-2138.399) (-2138.872) [-2136.020] (-2133.580) -- 0:01:45
526500 -- (-2135.185) (-2134.439) (-2133.101) [-2136.459] * (-2140.242) [-2133.365] (-2133.364) (-2132.538) -- 0:01:45
527000 -- [-2134.131] (-2138.605) (-2138.112) (-2137.079) * (-2139.761) (-2137.940) (-2132.541) [-2133.117] -- 0:01:45
527500 -- (-2136.908) [-2134.655] (-2133.741) (-2134.430) * (-2134.845) [-2130.763] (-2131.099) (-2138.151) -- 0:01:45
528000 -- [-2135.449] (-2134.956) (-2136.010) (-2132.953) * (-2138.089) (-2131.897) (-2132.347) [-2137.969] -- 0:01:45
528500 -- [-2134.510] (-2138.412) (-2135.522) (-2135.135) * (-2134.870) (-2132.227) (-2137.902) [-2132.950] -- 0:01:45
529000 -- (-2135.413) [-2133.695] (-2132.498) (-2135.210) * (-2130.529) (-2133.127) (-2137.992) [-2136.385] -- 0:01:45
529500 -- [-2134.261] (-2133.003) (-2136.209) (-2131.995) * (-2133.878) [-2136.647] (-2137.211) (-2136.578) -- 0:01:44
530000 -- (-2133.417) [-2133.799] (-2130.160) (-2130.915) * [-2134.252] (-2136.589) (-2137.839) (-2134.943) -- 0:01:44
Average standard deviation of split frequencies: 0.007107
530500 -- [-2132.512] (-2138.621) (-2133.131) (-2132.819) * [-2136.969] (-2141.419) (-2135.328) (-2133.781) -- 0:01:44
531000 -- (-2133.568) (-2142.640) (-2136.216) [-2130.986] * (-2135.814) (-2137.649) [-2133.876] (-2141.909) -- 0:01:44
531500 -- (-2143.956) (-2140.834) [-2131.384] (-2141.432) * (-2137.762) (-2133.721) (-2130.942) [-2131.852] -- 0:01:44
532000 -- (-2140.205) (-2136.651) [-2133.314] (-2140.858) * (-2136.135) [-2133.891] (-2131.459) (-2140.121) -- 0:01:44
532500 -- [-2138.889] (-2142.953) (-2135.508) (-2135.284) * (-2136.317) (-2136.567) (-2141.191) [-2137.152] -- 0:01:44
533000 -- [-2135.747] (-2143.261) (-2133.157) (-2139.072) * (-2139.940) (-2133.936) [-2136.380] (-2134.369) -- 0:01:44
533500 -- (-2136.173) (-2139.256) [-2130.140] (-2143.433) * (-2135.839) (-2136.716) [-2136.701] (-2135.063) -- 0:01:44
534000 -- (-2133.449) [-2136.174] (-2136.439) (-2138.119) * (-2137.543) [-2131.494] (-2131.165) (-2131.316) -- 0:01:43
534500 -- (-2133.353) (-2132.445) (-2131.618) [-2141.338] * [-2143.380] (-2135.694) (-2138.606) (-2139.667) -- 0:01:43
535000 -- (-2136.398) (-2135.996) [-2136.752] (-2134.580) * (-2139.001) (-2133.428) [-2136.665] (-2135.266) -- 0:01:43
Average standard deviation of split frequencies: 0.005863
535500 -- (-2133.945) (-2131.350) (-2136.222) [-2135.557] * [-2137.423] (-2132.139) (-2138.974) (-2136.018) -- 0:01:43
536000 -- (-2135.883) (-2128.643) [-2130.844] (-2141.496) * (-2138.713) [-2133.643] (-2135.023) (-2138.671) -- 0:01:43
536500 -- [-2139.496] (-2131.999) (-2133.208) (-2145.687) * (-2140.587) (-2137.383) (-2130.888) [-2134.530] -- 0:01:43
537000 -- (-2138.587) [-2134.784] (-2133.770) (-2138.320) * (-2138.950) (-2144.003) (-2136.081) [-2134.253] -- 0:01:43
537500 -- (-2137.145) (-2131.756) (-2133.270) [-2135.652] * (-2142.684) (-2142.418) [-2138.371] (-2135.010) -- 0:01:43
538000 -- (-2131.786) [-2135.138] (-2132.585) (-2137.613) * [-2138.520] (-2133.516) (-2135.944) (-2137.486) -- 0:01:43
538500 -- (-2136.606) (-2137.137) (-2134.061) [-2134.364] * (-2132.497) [-2135.441] (-2136.090) (-2134.123) -- 0:01:42
539000 -- (-2141.348) [-2132.409] (-2137.025) (-2132.519) * [-2136.733] (-2134.861) (-2138.922) (-2134.991) -- 0:01:42
539500 -- (-2139.168) [-2132.787] (-2137.600) (-2135.587) * (-2135.133) [-2134.542] (-2134.181) (-2132.099) -- 0:01:42
540000 -- (-2140.613) [-2134.814] (-2137.479) (-2133.921) * [-2134.757] (-2136.324) (-2129.244) (-2141.169) -- 0:01:42
Average standard deviation of split frequencies: 0.005813
540500 -- [-2132.067] (-2141.574) (-2136.868) (-2140.767) * (-2132.736) [-2131.871] (-2139.054) (-2140.339) -- 0:01:42
541000 -- (-2136.010) (-2133.993) (-2135.161) [-2134.246] * (-2138.075) (-2136.381) [-2136.530] (-2139.782) -- 0:01:42
541500 -- (-2133.711) (-2136.840) [-2134.970] (-2137.134) * (-2138.136) [-2138.054] (-2139.202) (-2138.260) -- 0:01:42
542000 -- (-2136.113) (-2134.981) (-2135.936) [-2133.943] * (-2136.176) (-2137.299) [-2132.385] (-2136.264) -- 0:01:42
542500 -- (-2134.319) (-2132.223) [-2139.954] (-2130.235) * (-2137.910) (-2142.971) [-2135.402] (-2134.662) -- 0:01:42
543000 -- (-2137.312) (-2138.484) [-2133.687] (-2135.119) * (-2139.862) (-2136.254) [-2134.060] (-2136.014) -- 0:01:41
543500 -- (-2137.615) (-2139.844) (-2132.345) [-2132.610] * (-2131.041) (-2133.476) [-2133.739] (-2134.975) -- 0:01:41
544000 -- [-2135.970] (-2131.843) (-2132.999) (-2140.016) * (-2134.368) (-2136.099) [-2134.196] (-2133.780) -- 0:01:41
544500 -- (-2137.931) (-2136.830) [-2134.818] (-2135.804) * (-2138.754) (-2136.317) [-2133.743] (-2138.090) -- 0:01:41
545000 -- (-2138.376) [-2132.765] (-2139.162) (-2130.680) * (-2144.760) (-2133.161) [-2137.545] (-2140.198) -- 0:01:41
Average standard deviation of split frequencies: 0.006331
545500 -- (-2133.129) [-2132.166] (-2135.018) (-2139.161) * (-2133.858) [-2139.662] (-2137.398) (-2135.959) -- 0:01:41
546000 -- (-2143.661) (-2137.152) (-2140.901) [-2131.648] * (-2134.668) [-2134.526] (-2136.950) (-2135.711) -- 0:01:41
546500 -- (-2135.031) (-2133.817) (-2137.709) [-2134.071] * (-2134.362) (-2134.128) (-2135.693) [-2134.076] -- 0:01:41
547000 -- [-2131.335] (-2132.173) (-2139.340) (-2140.869) * (-2135.159) [-2136.421] (-2141.010) (-2138.680) -- 0:01:41
547500 -- (-2131.316) (-2132.215) [-2137.492] (-2133.232) * (-2140.009) [-2131.798] (-2133.052) (-2136.423) -- 0:01:40
548000 -- [-2132.297] (-2136.111) (-2134.257) (-2130.946) * (-2135.487) (-2137.308) [-2135.361] (-2138.400) -- 0:01:40
548500 -- [-2133.707] (-2144.791) (-2136.977) (-2133.886) * (-2137.283) [-2134.735] (-2143.749) (-2141.029) -- 0:01:40
549000 -- (-2135.395) (-2140.686) (-2143.326) [-2135.538] * (-2134.949) (-2133.061) [-2132.795] (-2137.947) -- 0:01:40
549500 -- (-2135.495) (-2136.223) (-2134.956) [-2133.610] * (-2136.296) (-2138.693) (-2135.247) [-2129.464] -- 0:01:40
550000 -- (-2137.587) (-2138.341) (-2137.562) [-2133.156] * (-2136.925) [-2135.750] (-2134.008) (-2132.204) -- 0:01:40
Average standard deviation of split frequencies: 0.006278
550500 -- (-2133.160) (-2139.974) (-2135.035) [-2135.192] * (-2133.382) [-2134.345] (-2135.362) (-2132.345) -- 0:01:40
551000 -- (-2139.434) [-2136.366] (-2136.194) (-2137.066) * [-2133.005] (-2131.876) (-2135.785) (-2135.999) -- 0:01:40
551500 -- (-2133.482) (-2133.807) (-2138.784) [-2134.048] * (-2133.032) (-2136.572) [-2130.591] (-2144.146) -- 0:01:40
552000 -- (-2135.841) (-2136.931) (-2139.053) [-2134.004] * [-2137.931] (-2131.245) (-2135.343) (-2138.210) -- 0:01:39
552500 -- (-2131.512) (-2136.686) [-2139.360] (-2150.093) * (-2131.401) (-2141.193) [-2135.701] (-2135.865) -- 0:01:39
553000 -- (-2134.745) (-2140.476) (-2140.132) [-2135.231] * [-2134.877] (-2139.664) (-2136.868) (-2133.127) -- 0:01:39
553500 -- (-2139.951) (-2134.734) (-2137.147) [-2134.760] * (-2133.829) [-2134.844] (-2132.701) (-2135.412) -- 0:01:39
554000 -- (-2139.589) (-2137.270) [-2142.460] (-2132.664) * (-2133.008) (-2134.178) (-2133.530) [-2137.185] -- 0:01:39
554500 -- (-2131.247) [-2139.312] (-2139.377) (-2135.250) * (-2137.283) (-2144.113) (-2138.322) [-2139.745] -- 0:01:39
555000 -- (-2142.669) (-2135.131) (-2132.795) [-2130.803] * (-2136.837) (-2137.153) [-2142.069] (-2137.287) -- 0:01:39
Average standard deviation of split frequencies: 0.004522
555500 -- (-2137.650) [-2133.379] (-2135.152) (-2128.585) * (-2135.387) (-2134.011) (-2146.255) [-2134.144] -- 0:01:39
556000 -- (-2141.900) (-2136.997) (-2141.767) [-2136.064] * (-2135.213) [-2135.888] (-2142.828) (-2138.261) -- 0:01:39
556500 -- (-2140.669) (-2139.547) (-2134.133) [-2130.720] * (-2135.470) (-2133.623) (-2138.167) [-2138.140] -- 0:01:38
557000 -- (-2131.598) [-2129.464] (-2139.369) (-2136.601) * (-2137.285) (-2138.210) (-2135.622) [-2137.908] -- 0:01:38
557500 -- [-2135.515] (-2133.833) (-2134.730) (-2138.863) * [-2138.398] (-2136.052) (-2135.797) (-2138.525) -- 0:01:38
558000 -- (-2134.597) (-2134.230) [-2133.317] (-2139.556) * [-2131.463] (-2142.428) (-2132.046) (-2138.462) -- 0:01:38
558500 -- (-2132.523) [-2132.922] (-2131.031) (-2134.856) * (-2137.199) (-2142.588) [-2134.607] (-2141.499) -- 0:01:38
559000 -- [-2132.078] (-2142.279) (-2140.103) (-2137.374) * (-2132.077) (-2136.470) [-2130.525] (-2141.856) -- 0:01:38
559500 -- (-2135.709) (-2131.769) [-2134.641] (-2141.946) * (-2137.010) (-2134.865) (-2129.697) [-2131.852] -- 0:01:38
560000 -- (-2132.929) (-2143.082) [-2136.405] (-2139.370) * (-2137.657) (-2133.866) [-2134.231] (-2137.199) -- 0:01:38
Average standard deviation of split frequencies: 0.005605
560500 -- [-2136.394] (-2137.458) (-2134.683) (-2137.735) * (-2139.679) (-2136.099) (-2136.560) [-2134.494] -- 0:01:38
561000 -- [-2135.350] (-2134.740) (-2142.658) (-2134.885) * [-2131.306] (-2135.409) (-2132.984) (-2135.782) -- 0:01:37
561500 -- [-2133.478] (-2132.446) (-2136.461) (-2132.322) * (-2134.967) (-2139.126) [-2133.700] (-2140.016) -- 0:01:37
562000 -- (-2132.071) (-2138.845) (-2135.231) [-2136.531] * (-2131.883) [-2137.137] (-2138.821) (-2134.207) -- 0:01:37
562500 -- (-2134.697) [-2141.603] (-2134.451) (-2132.044) * (-2139.628) [-2138.104] (-2135.028) (-2134.045) -- 0:01:37
563000 -- (-2140.423) (-2137.154) (-2131.437) [-2135.476] * (-2136.847) (-2140.267) [-2132.096] (-2137.954) -- 0:01:37
563500 -- [-2131.235] (-2132.547) (-2130.975) (-2135.405) * (-2139.320) (-2138.337) (-2138.674) [-2137.977] -- 0:01:37
564000 -- [-2132.519] (-2135.094) (-2141.718) (-2134.628) * [-2136.976] (-2138.260) (-2136.185) (-2139.208) -- 0:01:37
564500 -- (-2140.830) [-2136.471] (-2135.798) (-2145.519) * (-2138.016) (-2141.172) (-2137.982) [-2137.256] -- 0:01:37
565000 -- (-2130.244) (-2132.815) [-2130.924] (-2136.232) * (-2133.072) [-2135.433] (-2135.711) (-2133.566) -- 0:01:37
Average standard deviation of split frequencies: 0.008884
565500 -- (-2138.883) (-2136.360) [-2136.305] (-2136.713) * (-2131.958) (-2133.129) (-2137.759) [-2132.389] -- 0:01:36
566000 -- (-2132.812) [-2137.872] (-2138.872) (-2137.230) * (-2142.874) [-2136.479] (-2136.918) (-2134.921) -- 0:01:36
566500 -- (-2132.384) (-2135.619) (-2133.129) [-2136.653] * [-2139.198] (-2132.145) (-2134.989) (-2131.156) -- 0:01:36
567000 -- (-2136.854) (-2133.461) [-2131.775] (-2135.961) * (-2138.140) [-2136.167] (-2135.707) (-2133.598) -- 0:01:36
567500 -- [-2135.351] (-2135.541) (-2131.938) (-2135.443) * (-2138.018) (-2137.587) (-2137.793) [-2135.377] -- 0:01:36
568000 -- [-2133.755] (-2132.026) (-2129.095) (-2137.750) * (-2143.059) (-2134.352) [-2133.366] (-2132.801) -- 0:01:36
568500 -- [-2132.284] (-2131.307) (-2132.992) (-2134.457) * (-2138.324) (-2130.049) (-2131.649) [-2131.042] -- 0:01:36
569000 -- (-2134.463) [-2141.873] (-2133.259) (-2139.586) * (-2136.469) (-2132.589) [-2138.697] (-2136.918) -- 0:01:36
569500 -- [-2131.743] (-2132.657) (-2133.104) (-2134.495) * (-2138.517) [-2136.777] (-2134.757) (-2138.351) -- 0:01:36
570000 -- (-2134.275) (-2132.265) (-2138.274) [-2136.918] * (-2135.650) [-2132.100] (-2131.331) (-2138.471) -- 0:01:35
Average standard deviation of split frequencies: 0.007710
570500 -- (-2135.125) [-2131.720] (-2134.476) (-2134.944) * (-2133.779) (-2129.377) (-2140.613) [-2139.844] -- 0:01:35
571000 -- (-2136.119) [-2138.891] (-2138.906) (-2135.747) * (-2134.250) [-2134.330] (-2137.769) (-2135.779) -- 0:01:35
571500 -- (-2137.040) (-2136.946) [-2137.453] (-2135.498) * (-2134.887) (-2139.940) (-2134.476) [-2135.487] -- 0:01:35
572000 -- (-2133.776) (-2136.461) (-2136.016) [-2133.637] * (-2137.382) (-2130.925) [-2132.113] (-2139.444) -- 0:01:35
572500 -- [-2134.191] (-2131.078) (-2132.707) (-2136.166) * (-2136.301) (-2135.754) (-2134.201) [-2132.174] -- 0:01:35
573000 -- (-2139.317) (-2133.599) [-2136.704] (-2140.986) * (-2134.089) (-2145.634) (-2134.192) [-2137.740] -- 0:01:35
573500 -- (-2136.189) (-2137.404) (-2132.683) [-2132.121] * (-2136.899) (-2141.307) [-2138.277] (-2141.983) -- 0:01:35
574000 -- (-2139.543) (-2135.388) (-2136.659) [-2134.747] * [-2134.044] (-2135.076) (-2137.594) (-2130.613) -- 0:01:34
574500 -- (-2133.154) (-2136.678) (-2133.563) [-2135.501] * (-2133.331) (-2131.052) [-2136.546] (-2135.191) -- 0:01:34
575000 -- (-2133.940) [-2137.968] (-2132.409) (-2136.375) * (-2131.224) [-2131.051] (-2134.263) (-2133.697) -- 0:01:34
Average standard deviation of split frequencies: 0.006002
575500 -- [-2133.454] (-2133.419) (-2135.802) (-2136.034) * (-2139.460) [-2132.147] (-2138.701) (-2140.395) -- 0:01:34
576000 -- [-2133.177] (-2134.694) (-2135.161) (-2139.133) * [-2134.556] (-2134.071) (-2134.431) (-2137.411) -- 0:01:34
576500 -- (-2132.926) [-2135.186] (-2134.588) (-2129.147) * (-2131.565) (-2135.768) [-2131.928] (-2135.868) -- 0:01:34
577000 -- (-2132.924) [-2131.225] (-2141.014) (-2134.482) * (-2132.072) [-2134.118] (-2136.953) (-2132.778) -- 0:01:34
577500 -- [-2133.408] (-2142.206) (-2137.466) (-2133.497) * (-2133.308) (-2135.572) [-2137.363] (-2133.067) -- 0:01:34
578000 -- [-2130.650] (-2135.495) (-2128.129) (-2138.076) * (-2133.412) (-2141.779) [-2135.103] (-2132.325) -- 0:01:34
578500 -- (-2132.520) (-2136.909) [-2137.520] (-2133.774) * (-2136.135) (-2144.218) [-2135.946] (-2134.382) -- 0:01:33
579000 -- [-2137.960] (-2137.906) (-2137.269) (-2131.893) * (-2142.262) [-2135.384] (-2135.403) (-2135.224) -- 0:01:33
579500 -- (-2139.744) (-2130.692) (-2134.590) [-2130.298] * (-2133.303) (-2136.439) [-2134.276] (-2141.804) -- 0:01:33
580000 -- (-2135.405) [-2138.406] (-2135.831) (-2130.907) * (-2131.981) (-2141.872) (-2138.813) [-2136.979] -- 0:01:33
Average standard deviation of split frequencies: 0.006495
580500 -- (-2137.754) [-2130.898] (-2132.136) (-2130.832) * (-2134.273) (-2137.563) (-2133.921) [-2136.152] -- 0:01:33
581000 -- (-2134.144) [-2130.903] (-2134.997) (-2129.963) * [-2133.346] (-2136.474) (-2135.869) (-2133.610) -- 0:01:33
581500 -- (-2135.791) (-2133.109) (-2129.616) [-2132.805] * (-2139.334) [-2132.210] (-2135.270) (-2137.307) -- 0:01:33
582000 -- (-2138.048) (-2133.367) (-2133.123) [-2137.272] * (-2135.442) [-2137.732] (-2130.317) (-2141.046) -- 0:01:33
582500 -- (-2138.527) [-2135.253] (-2137.647) (-2138.044) * (-2140.241) (-2141.018) [-2132.179] (-2140.843) -- 0:01:33
583000 -- (-2134.481) [-2131.891] (-2133.801) (-2146.372) * (-2135.284) [-2132.923] (-2134.881) (-2134.818) -- 0:01:32
583500 -- (-2135.094) (-2133.023) (-2136.078) [-2138.557] * (-2139.039) [-2135.942] (-2135.099) (-2139.565) -- 0:01:32
584000 -- (-2134.470) (-2135.301) (-2132.967) [-2139.217] * (-2134.165) (-2138.385) [-2138.039] (-2139.748) -- 0:01:32
584500 -- (-2140.854) (-2137.042) (-2131.336) [-2131.742] * (-2138.448) [-2137.798] (-2139.807) (-2133.922) -- 0:01:32
585000 -- [-2135.199] (-2138.194) (-2139.302) (-2135.697) * (-2138.051) (-2133.398) [-2133.872] (-2137.495) -- 0:01:32
Average standard deviation of split frequencies: 0.004827
585500 -- (-2131.439) [-2135.519] (-2138.597) (-2135.181) * (-2143.822) (-2140.165) (-2137.801) [-2131.088] -- 0:01:32
586000 -- (-2138.829) [-2145.178] (-2135.630) (-2135.498) * (-2132.966) (-2132.246) (-2139.762) [-2137.198] -- 0:01:32
586500 -- (-2136.244) [-2133.800] (-2132.902) (-2131.786) * (-2132.035) (-2136.064) (-2137.508) [-2136.707] -- 0:01:32
587000 -- (-2132.885) [-2135.871] (-2132.367) (-2136.284) * (-2133.907) (-2131.723) (-2128.695) [-2134.682] -- 0:01:32
587500 -- (-2134.914) [-2130.742] (-2131.117) (-2135.511) * (-2133.374) (-2140.074) (-2134.893) [-2137.768] -- 0:01:31
588000 -- (-2134.066) (-2132.769) (-2133.692) [-2137.298] * [-2133.158] (-2137.691) (-2138.698) (-2138.071) -- 0:01:31
588500 -- [-2133.468] (-2134.047) (-2141.792) (-2132.798) * (-2143.221) (-2133.182) (-2133.342) [-2131.911] -- 0:01:31
589000 -- [-2135.591] (-2130.184) (-2134.789) (-2131.849) * (-2140.448) (-2141.115) (-2134.205) [-2132.998] -- 0:01:31
589500 -- (-2131.745) (-2133.506) (-2133.892) [-2135.967] * (-2143.210) [-2133.793] (-2136.299) (-2133.944) -- 0:01:31
590000 -- (-2131.806) (-2131.456) (-2134.846) [-2133.566] * (-2135.754) (-2134.327) (-2132.340) [-2132.499] -- 0:01:31
Average standard deviation of split frequencies: 0.004256
590500 -- [-2131.384] (-2135.582) (-2134.975) (-2135.680) * (-2134.995) [-2131.422] (-2132.357) (-2134.730) -- 0:01:31
591000 -- (-2135.551) (-2148.727) (-2135.636) [-2131.755] * (-2134.493) (-2133.270) (-2134.887) [-2135.152] -- 0:01:31
591500 -- (-2133.223) [-2135.483] (-2146.022) (-2136.313) * [-2131.571] (-2134.965) (-2130.285) (-2137.124) -- 0:01:31
592000 -- [-2135.507] (-2144.386) (-2138.693) (-2137.245) * (-2133.290) (-2140.329) (-2137.309) [-2136.097] -- 0:01:30
592500 -- [-2147.200] (-2138.607) (-2137.429) (-2131.944) * (-2137.582) (-2131.886) (-2136.156) [-2141.806] -- 0:01:30
593000 -- (-2144.352) [-2141.239] (-2142.512) (-2134.789) * [-2135.207] (-2133.622) (-2135.685) (-2140.491) -- 0:01:30
593500 -- [-2139.778] (-2137.092) (-2136.392) (-2135.800) * [-2135.779] (-2136.191) (-2138.090) (-2136.388) -- 0:01:30
594000 -- (-2138.268) (-2135.526) [-2131.525] (-2141.988) * (-2133.130) [-2141.363] (-2132.119) (-2132.619) -- 0:01:30
594500 -- (-2133.627) [-2131.803] (-2134.955) (-2141.042) * (-2130.093) (-2137.551) (-2135.628) [-2133.461] -- 0:01:30
595000 -- (-2131.908) (-2136.131) [-2135.515] (-2139.525) * (-2139.703) [-2129.093] (-2133.984) (-2134.347) -- 0:01:30
Average standard deviation of split frequencies: 0.003164
595500 -- (-2139.313) (-2137.220) [-2133.022] (-2143.373) * (-2139.751) [-2137.957] (-2136.748) (-2133.636) -- 0:01:30
596000 -- (-2141.250) (-2131.621) (-2133.908) [-2136.068] * [-2145.842] (-2143.225) (-2135.296) (-2140.703) -- 0:01:30
596500 -- [-2133.168] (-2138.866) (-2133.795) (-2135.974) * (-2144.425) [-2135.805] (-2133.099) (-2134.867) -- 0:01:29
597000 -- [-2129.954] (-2138.840) (-2133.419) (-2139.456) * (-2139.339) [-2134.380] (-2133.245) (-2132.264) -- 0:01:29
597500 -- (-2134.229) [-2133.690] (-2133.650) (-2136.316) * (-2134.660) (-2134.635) (-2141.325) [-2139.565] -- 0:01:29
598000 -- [-2133.670] (-2137.958) (-2136.208) (-2135.024) * (-2134.547) (-2136.720) [-2135.624] (-2137.626) -- 0:01:29
598500 -- (-2140.670) (-2139.397) [-2138.011] (-2138.294) * (-2136.561) [-2133.148] (-2134.333) (-2132.198) -- 0:01:29
599000 -- [-2134.165] (-2136.554) (-2135.707) (-2138.709) * [-2136.377] (-2134.796) (-2130.469) (-2130.399) -- 0:01:29
599500 -- (-2138.253) (-2138.678) (-2131.753) [-2133.211] * (-2131.090) [-2134.771] (-2139.138) (-2133.611) -- 0:01:29
600000 -- (-2140.259) (-2143.796) [-2132.922] (-2133.376) * (-2133.998) (-2133.507) (-2137.225) [-2136.459] -- 0:01:29
Average standard deviation of split frequencies: 0.004970
600500 -- (-2130.957) [-2133.801] (-2138.177) (-2139.277) * (-2134.417) (-2131.416) (-2134.231) [-2137.264] -- 0:01:29
601000 -- (-2134.166) (-2137.121) (-2136.179) [-2131.721] * (-2134.694) [-2132.448] (-2129.582) (-2142.487) -- 0:01:28
601500 -- (-2135.043) [-2135.150] (-2143.127) (-2141.412) * (-2141.432) (-2135.529) (-2136.682) [-2136.804] -- 0:01:28
602000 -- (-2138.328) [-2133.946] (-2153.272) (-2136.485) * (-2137.478) (-2133.575) (-2137.799) [-2138.446] -- 0:01:28
602500 -- (-2137.749) (-2135.018) (-2144.308) [-2134.448] * (-2135.380) (-2131.761) (-2135.048) [-2136.509] -- 0:01:28
603000 -- (-2142.591) (-2133.694) (-2139.065) [-2133.404] * (-2133.848) (-2133.804) [-2133.365] (-2132.384) -- 0:01:28
603500 -- (-2135.058) (-2138.488) (-2134.232) [-2133.067] * [-2133.292] (-2141.140) (-2135.281) (-2140.128) -- 0:01:28
604000 -- (-2132.487) (-2138.020) [-2131.073] (-2136.887) * [-2132.669] (-2142.948) (-2132.521) (-2141.602) -- 0:01:28
604500 -- (-2131.447) (-2131.098) [-2139.582] (-2132.445) * (-2139.160) [-2137.104] (-2137.207) (-2141.069) -- 0:01:28
605000 -- (-2134.490) (-2129.934) [-2132.801] (-2134.650) * (-2136.639) (-2134.992) (-2140.282) [-2136.040] -- 0:01:28
Average standard deviation of split frequencies: 0.005964
605500 -- (-2135.095) (-2129.813) [-2133.420] (-2138.092) * (-2131.230) [-2135.279] (-2134.683) (-2134.111) -- 0:01:27
606000 -- (-2136.689) (-2132.065) (-2130.476) [-2136.485] * (-2133.838) (-2135.143) [-2133.336] (-2141.645) -- 0:01:27
606500 -- (-2141.843) (-2139.930) [-2133.933] (-2143.353) * (-2138.031) (-2141.217) [-2132.581] (-2138.666) -- 0:01:27
607000 -- (-2137.216) (-2141.970) [-2135.468] (-2136.810) * (-2138.859) (-2138.891) [-2136.858] (-2132.443) -- 0:01:27
607500 -- (-2148.640) (-2139.398) (-2134.507) [-2138.317] * (-2139.737) (-2137.548) (-2137.495) [-2132.945] -- 0:01:27
608000 -- [-2139.349] (-2134.476) (-2134.570) (-2138.711) * [-2142.545] (-2132.784) (-2139.556) (-2137.557) -- 0:01:27
608500 -- (-2133.580) [-2136.209] (-2133.256) (-2134.576) * [-2131.616] (-2133.889) (-2135.005) (-2135.227) -- 0:01:27
609000 -- (-2132.918) (-2135.829) [-2134.711] (-2133.158) * (-2134.156) (-2132.515) [-2134.101] (-2135.685) -- 0:01:27
609500 -- (-2131.868) (-2135.493) [-2131.424] (-2138.664) * (-2135.202) (-2131.398) (-2133.766) [-2129.736] -- 0:01:27
610000 -- (-2137.542) (-2138.300) (-2131.917) [-2136.486] * [-2134.944] (-2142.283) (-2136.589) (-2132.357) -- 0:01:26
Average standard deviation of split frequencies: 0.004889
610500 -- (-2134.676) (-2135.851) (-2133.264) [-2137.640] * (-2139.430) (-2130.894) (-2136.004) [-2134.224] -- 0:01:26
611000 -- (-2138.116) (-2138.510) (-2134.036) [-2135.371] * [-2135.120] (-2139.970) (-2133.304) (-2137.060) -- 0:01:26
611500 -- (-2139.754) [-2130.771] (-2135.972) (-2132.910) * (-2135.909) [-2130.188] (-2131.906) (-2137.652) -- 0:01:26
612000 -- [-2136.072] (-2137.275) (-2138.662) (-2134.534) * [-2135.176] (-2136.995) (-2138.102) (-2132.419) -- 0:01:26
612500 -- (-2134.590) (-2141.748) (-2137.384) [-2136.464] * (-2138.882) (-2136.937) [-2132.724] (-2136.425) -- 0:01:26
613000 -- (-2134.643) (-2136.643) [-2132.957] (-2138.158) * (-2133.203) [-2139.936] (-2140.031) (-2133.146) -- 0:01:26
613500 -- (-2134.321) [-2131.236] (-2137.698) (-2135.825) * (-2137.356) (-2136.335) [-2130.464] (-2136.332) -- 0:01:26
614000 -- (-2143.889) (-2134.250) [-2133.643] (-2134.280) * (-2144.979) [-2134.245] (-2134.721) (-2138.558) -- 0:01:26
614500 -- (-2136.392) [-2134.972] (-2134.641) (-2134.296) * (-2134.939) (-2133.512) (-2133.747) [-2138.462] -- 0:01:25
615000 -- (-2141.128) (-2142.984) [-2138.570] (-2133.143) * (-2133.447) [-2133.379] (-2137.578) (-2135.166) -- 0:01:25
Average standard deviation of split frequencies: 0.005867
615500 -- [-2135.911] (-2140.692) (-2141.075) (-2134.472) * (-2137.582) (-2134.895) (-2136.830) [-2134.450] -- 0:01:25
616000 -- (-2138.489) (-2139.423) (-2132.382) [-2132.650] * (-2131.960) [-2140.323] (-2131.052) (-2132.146) -- 0:01:25
616500 -- [-2140.039] (-2135.977) (-2133.258) (-2147.462) * (-2134.506) (-2130.796) [-2137.690] (-2135.294) -- 0:01:25
617000 -- (-2134.959) (-2132.388) [-2131.778] (-2141.626) * [-2137.306] (-2131.728) (-2137.327) (-2131.680) -- 0:01:25
617500 -- (-2139.416) (-2134.447) [-2135.485] (-2137.645) * (-2134.104) [-2132.019] (-2132.727) (-2137.663) -- 0:01:25
618000 -- [-2130.981] (-2131.411) (-2133.444) (-2136.286) * (-2137.255) (-2131.971) (-2133.283) [-2131.095] -- 0:01:25
618500 -- (-2135.131) [-2138.111] (-2130.935) (-2140.915) * (-2132.066) [-2136.476] (-2136.481) (-2138.302) -- 0:01:25
619000 -- (-2137.003) (-2134.970) [-2133.808] (-2132.627) * (-2137.308) [-2137.821] (-2134.366) (-2134.222) -- 0:01:24
619500 -- (-2138.468) [-2135.099] (-2136.634) (-2134.575) * [-2128.974] (-2133.831) (-2139.253) (-2137.667) -- 0:01:24
620000 -- (-2143.347) (-2137.526) [-2135.844] (-2134.923) * (-2138.957) (-2135.519) (-2142.598) [-2130.448] -- 0:01:24
Average standard deviation of split frequencies: 0.003798
620500 -- [-2137.585] (-2137.483) (-2133.583) (-2139.922) * (-2140.270) (-2137.303) (-2135.691) [-2138.430] -- 0:01:24
621000 -- [-2133.107] (-2134.832) (-2133.451) (-2134.955) * [-2135.772] (-2131.160) (-2138.585) (-2142.543) -- 0:01:24
621500 -- (-2130.617) [-2132.792] (-2130.052) (-2136.033) * [-2133.875] (-2138.797) (-2141.790) (-2136.254) -- 0:01:24
622000 -- (-2136.538) [-2139.433] (-2140.625) (-2137.629) * (-2133.308) [-2137.234] (-2136.905) (-2134.072) -- 0:01:24
622500 -- [-2135.757] (-2140.695) (-2139.045) (-2147.582) * (-2133.942) (-2141.518) (-2136.060) [-2132.772] -- 0:01:24
623000 -- (-2134.861) (-2136.146) [-2136.266] (-2140.218) * (-2133.294) [-2134.576] (-2138.513) (-2133.896) -- 0:01:24
623500 -- (-2133.756) (-2132.976) (-2133.392) [-2139.704] * (-2131.860) (-2131.821) [-2137.224] (-2141.185) -- 0:01:23
624000 -- [-2137.681] (-2145.423) (-2133.965) (-2135.688) * (-2134.839) (-2132.767) (-2136.134) [-2133.671] -- 0:01:23
624500 -- (-2138.826) (-2147.884) [-2137.804] (-2135.752) * [-2134.782] (-2133.929) (-2138.860) (-2136.823) -- 0:01:23
625000 -- (-2142.961) (-2140.545) (-2137.675) [-2132.997] * [-2133.201] (-2131.147) (-2133.095) (-2139.125) -- 0:01:23
Average standard deviation of split frequencies: 0.004769
625500 -- (-2142.018) (-2139.297) (-2139.183) [-2135.232] * [-2135.146] (-2138.784) (-2137.517) (-2135.077) -- 0:01:23
626000 -- (-2143.491) (-2141.106) (-2136.449) [-2136.737] * (-2132.597) [-2133.339] (-2136.491) (-2131.301) -- 0:01:23
626500 -- (-2144.321) [-2142.380] (-2131.122) (-2132.442) * (-2135.668) [-2130.151] (-2136.784) (-2134.363) -- 0:01:23
627000 -- (-2133.655) (-2138.470) [-2136.922] (-2133.925) * (-2136.292) (-2133.419) (-2142.028) [-2132.665] -- 0:01:23
627500 -- (-2135.981) [-2136.159] (-2135.519) (-2131.914) * (-2135.065) (-2141.535) [-2134.979] (-2136.340) -- 0:01:23
628000 -- (-2137.257) (-2141.427) (-2135.250) [-2139.938] * (-2134.071) [-2139.988] (-2139.932) (-2140.264) -- 0:01:22
628500 -- [-2136.727] (-2135.720) (-2131.010) (-2141.519) * (-2134.556) (-2137.268) (-2136.005) [-2132.120] -- 0:01:22
629000 -- (-2138.994) (-2134.939) (-2133.092) [-2137.026] * (-2131.161) (-2140.703) [-2138.410] (-2139.653) -- 0:01:22
629500 -- (-2135.213) (-2142.348) (-2140.451) [-2129.583] * [-2132.058] (-2138.753) (-2135.816) (-2136.571) -- 0:01:22
630000 -- (-2137.181) (-2130.968) [-2138.194] (-2141.496) * (-2134.713) (-2134.664) (-2132.460) [-2133.108] -- 0:01:22
Average standard deviation of split frequencies: 0.008222
630500 -- (-2140.787) (-2134.438) (-2134.949) [-2132.249] * (-2134.191) (-2136.386) [-2132.265] (-2132.020) -- 0:01:22
631000 -- (-2144.196) (-2138.815) [-2130.963] (-2141.045) * (-2133.801) [-2134.707] (-2137.231) (-2136.394) -- 0:01:22
631500 -- (-2140.030) [-2133.076] (-2136.941) (-2135.833) * (-2137.256) (-2140.203) [-2135.082] (-2139.834) -- 0:01:22
632000 -- (-2134.125) (-2136.261) (-2139.238) [-2131.722] * (-2133.319) (-2136.085) [-2133.278] (-2144.748) -- 0:01:22
632500 -- (-2136.179) [-2142.962] (-2135.494) (-2133.749) * (-2141.682) [-2133.351] (-2135.333) (-2132.323) -- 0:01:21
633000 -- (-2138.463) (-2143.470) (-2139.505) [-2132.862] * (-2140.673) (-2134.550) (-2135.963) [-2133.382] -- 0:01:21
633500 -- [-2136.983] (-2140.420) (-2136.306) (-2133.904) * (-2136.488) [-2132.642] (-2136.194) (-2137.086) -- 0:01:21
634000 -- (-2137.054) (-2139.798) [-2136.409] (-2140.448) * [-2129.592] (-2136.248) (-2140.228) (-2133.199) -- 0:01:21
634500 -- [-2134.218] (-2138.359) (-2137.020) (-2133.654) * (-2137.940) (-2135.039) (-2140.169) [-2137.065] -- 0:01:21
635000 -- (-2133.509) (-2131.630) [-2134.947] (-2135.104) * (-2138.863) (-2137.772) (-2134.463) [-2135.728] -- 0:01:21
Average standard deviation of split frequencies: 0.008647
635500 -- (-2141.719) (-2136.645) (-2134.672) [-2137.078] * (-2138.060) (-2143.274) (-2132.067) [-2135.611] -- 0:01:21
636000 -- (-2134.724) (-2133.729) [-2131.489] (-2135.130) * (-2137.529) (-2136.991) [-2134.328] (-2132.993) -- 0:01:21
636500 -- [-2130.435] (-2139.176) (-2137.146) (-2134.944) * (-2131.359) (-2142.148) [-2130.265] (-2139.126) -- 0:01:21
637000 -- (-2132.796) (-2133.068) (-2134.081) [-2134.711] * (-2135.236) (-2130.043) [-2131.527] (-2134.916) -- 0:01:20
637500 -- (-2136.126) (-2133.722) [-2133.850] (-2134.053) * (-2133.339) (-2138.872) (-2131.057) [-2133.401] -- 0:01:20
638000 -- (-2137.700) (-2133.912) [-2132.081] (-2135.250) * (-2133.136) (-2138.896) (-2135.690) [-2136.809] -- 0:01:20
638500 -- [-2135.282] (-2139.386) (-2135.073) (-2136.134) * (-2134.306) (-2135.644) [-2133.159] (-2138.463) -- 0:01:20
639000 -- (-2141.959) [-2136.435] (-2134.704) (-2141.226) * (-2132.847) (-2134.270) (-2135.009) [-2139.267] -- 0:01:20
639500 -- (-2140.613) [-2130.985] (-2137.415) (-2137.530) * (-2139.350) (-2138.013) [-2133.251] (-2132.863) -- 0:01:20
640000 -- (-2135.719) (-2141.433) [-2132.089] (-2136.566) * (-2137.707) (-2136.815) (-2132.065) [-2139.660] -- 0:01:20
Average standard deviation of split frequencies: 0.007113
640500 -- (-2136.856) [-2142.920] (-2135.924) (-2143.095) * [-2134.469] (-2139.968) (-2136.486) (-2137.179) -- 0:01:20
641000 -- [-2136.372] (-2137.729) (-2138.540) (-2140.226) * [-2138.044] (-2129.955) (-2132.162) (-2137.925) -- 0:01:20
641500 -- (-2135.570) [-2131.726] (-2143.734) (-2142.712) * [-2134.827] (-2132.760) (-2132.440) (-2139.447) -- 0:01:19
642000 -- (-2137.281) [-2134.532] (-2135.440) (-2140.948) * (-2130.721) [-2136.503] (-2137.993) (-2140.786) -- 0:01:19
642500 -- (-2133.406) (-2134.568) (-2139.355) [-2134.274] * (-2134.269) (-2144.976) (-2141.334) [-2131.448] -- 0:01:19
643000 -- (-2137.729) [-2134.411] (-2141.424) (-2133.400) * (-2132.105) (-2137.596) [-2136.687] (-2134.243) -- 0:01:19
643500 -- (-2138.054) [-2133.942] (-2139.909) (-2134.599) * (-2135.612) (-2137.574) (-2137.843) [-2135.599] -- 0:01:19
644000 -- [-2137.752] (-2136.029) (-2137.532) (-2131.997) * (-2134.758) (-2133.421) (-2135.605) [-2139.080] -- 0:01:19
644500 -- (-2133.232) (-2140.398) (-2139.350) [-2133.049] * (-2136.790) (-2137.724) [-2134.768] (-2138.662) -- 0:01:19
645000 -- (-2140.561) (-2135.885) (-2132.846) [-2130.212] * (-2137.184) [-2136.980] (-2142.013) (-2131.949) -- 0:01:19
Average standard deviation of split frequencies: 0.008513
645500 -- (-2141.903) (-2142.706) [-2135.068] (-2132.391) * (-2137.520) (-2133.365) [-2132.892] (-2138.293) -- 0:01:19
646000 -- (-2132.688) (-2148.075) (-2139.735) [-2136.964] * (-2137.905) (-2137.251) (-2138.885) [-2133.616] -- 0:01:18
646500 -- (-2132.037) (-2135.753) (-2140.271) [-2130.719] * (-2135.771) (-2133.828) (-2131.683) [-2138.993] -- 0:01:18
647000 -- (-2135.542) (-2139.232) (-2136.656) [-2134.022] * (-2145.591) [-2139.981] (-2132.663) (-2135.587) -- 0:01:18
647500 -- (-2138.261) [-2135.004] (-2132.388) (-2135.265) * [-2139.082] (-2140.465) (-2142.007) (-2134.868) -- 0:01:18
648000 -- (-2134.414) (-2133.953) (-2131.202) [-2133.076] * (-2134.110) [-2131.183] (-2144.106) (-2140.595) -- 0:01:18
648500 -- [-2136.340] (-2141.236) (-2130.417) (-2138.681) * (-2133.283) (-2141.285) [-2143.106] (-2136.897) -- 0:01:18
649000 -- (-2132.375) (-2138.489) [-2131.730] (-2137.514) * [-2132.963] (-2140.633) (-2135.632) (-2134.175) -- 0:01:18
649500 -- (-2132.776) [-2136.936] (-2134.624) (-2135.038) * (-2133.877) (-2137.256) [-2137.176] (-2134.368) -- 0:01:18
650000 -- (-2142.396) [-2135.291] (-2137.008) (-2135.237) * (-2137.027) (-2133.742) (-2142.072) [-2135.323] -- 0:01:18
Average standard deviation of split frequencies: 0.009901
650500 -- (-2139.109) [-2136.032] (-2136.193) (-2135.824) * (-2133.117) [-2138.860] (-2136.769) (-2133.310) -- 0:01:17
651000 -- (-2135.999) [-2141.830] (-2134.059) (-2136.019) * (-2131.664) (-2135.244) [-2140.122] (-2138.523) -- 0:01:17
651500 -- (-2134.201) (-2138.653) (-2135.668) [-2137.384] * (-2135.465) (-2137.793) (-2133.624) [-2138.695] -- 0:01:17
652000 -- [-2139.412] (-2132.764) (-2146.182) (-2141.947) * (-2137.136) (-2134.359) [-2136.992] (-2136.695) -- 0:01:17
652500 -- (-2136.924) (-2139.630) (-2143.408) [-2134.247] * (-2141.082) (-2131.926) [-2131.135] (-2141.286) -- 0:01:17
653000 -- [-2135.173] (-2136.175) (-2143.376) (-2134.568) * (-2143.271) (-2135.845) [-2133.708] (-2136.910) -- 0:01:17
653500 -- [-2130.825] (-2133.890) (-2145.654) (-2133.256) * (-2132.145) (-2139.958) (-2134.178) [-2133.838] -- 0:01:17
654000 -- (-2139.094) (-2147.173) (-2145.335) [-2132.050] * (-2138.892) [-2137.047] (-2135.906) (-2135.403) -- 0:01:17
654500 -- (-2134.531) (-2153.707) [-2132.927] (-2134.621) * (-2137.010) (-2135.509) [-2131.334] (-2133.014) -- 0:01:17
655000 -- [-2134.839] (-2145.912) (-2133.782) (-2135.718) * (-2131.798) (-2140.244) [-2132.710] (-2133.265) -- 0:01:16
Average standard deviation of split frequencies: 0.010779
655500 -- [-2133.975] (-2134.276) (-2133.327) (-2139.155) * [-2137.060] (-2137.934) (-2131.548) (-2137.348) -- 0:01:16
656000 -- (-2133.693) (-2131.836) (-2136.667) [-2136.775] * (-2136.299) [-2135.206] (-2142.569) (-2133.679) -- 0:01:16
656500 -- [-2136.712] (-2132.901) (-2133.989) (-2136.538) * [-2135.457] (-2135.525) (-2136.969) (-2138.290) -- 0:01:16
657000 -- (-2133.640) (-2137.896) [-2133.648] (-2132.589) * (-2141.786) (-2138.014) [-2135.369] (-2134.475) -- 0:01:16
657500 -- (-2137.040) [-2136.953] (-2134.296) (-2143.457) * (-2142.809) (-2139.942) [-2132.857] (-2138.244) -- 0:01:16
658000 -- [-2133.932] (-2142.444) (-2137.545) (-2136.513) * (-2132.567) (-2143.297) [-2133.313] (-2142.128) -- 0:01:16
658500 -- (-2137.061) (-2138.099) (-2133.073) [-2133.577] * (-2134.461) (-2139.092) (-2132.041) [-2141.022] -- 0:01:16
659000 -- (-2136.924) [-2133.520] (-2135.069) (-2136.396) * (-2133.449) (-2135.765) [-2132.270] (-2137.341) -- 0:01:16
659500 -- (-2139.628) (-2131.555) (-2139.966) [-2131.987] * (-2136.023) (-2138.601) [-2132.577] (-2134.124) -- 0:01:15
660000 -- (-2141.445) (-2135.710) [-2130.519] (-2135.326) * [-2135.861] (-2137.293) (-2137.062) (-2131.060) -- 0:01:15
Average standard deviation of split frequencies: 0.011892
660500 -- (-2140.426) (-2134.369) (-2139.067) [-2134.632] * (-2131.817) [-2136.372] (-2144.059) (-2140.848) -- 0:01:15
661000 -- (-2137.620) (-2132.073) [-2136.907] (-2137.399) * (-2135.941) (-2134.623) (-2139.698) [-2138.026] -- 0:01:15
661500 -- (-2144.209) (-2138.100) (-2137.155) [-2135.780] * (-2134.771) (-2136.501) (-2131.771) [-2134.753] -- 0:01:15
662000 -- (-2141.772) [-2132.470] (-2131.078) (-2135.005) * (-2133.405) (-2130.780) [-2136.728] (-2138.438) -- 0:01:15
662500 -- (-2136.006) (-2131.799) [-2131.696] (-2137.073) * (-2137.762) [-2131.026] (-2135.527) (-2137.293) -- 0:01:15
663000 -- (-2135.930) (-2140.670) [-2134.141] (-2130.436) * (-2138.752) [-2132.848] (-2137.822) (-2135.310) -- 0:01:15
663500 -- [-2134.115] (-2137.120) (-2133.312) (-2138.491) * (-2131.931) [-2138.854] (-2131.851) (-2132.820) -- 0:01:15
664000 -- (-2131.906) [-2132.403] (-2129.697) (-2140.805) * (-2134.319) [-2134.537] (-2133.054) (-2133.928) -- 0:01:14
664500 -- (-2137.466) (-2132.569) (-2130.510) [-2136.330] * (-2141.540) (-2131.178) (-2135.072) [-2136.737] -- 0:01:14
665000 -- [-2135.378] (-2140.335) (-2132.814) (-2137.180) * [-2136.848] (-2138.322) (-2130.953) (-2135.255) -- 0:01:14
Average standard deviation of split frequencies: 0.012269
665500 -- (-2132.625) (-2142.806) (-2136.162) [-2138.591] * (-2136.786) [-2136.274] (-2134.487) (-2136.830) -- 0:01:14
666000 -- (-2133.794) (-2131.494) [-2131.350] (-2142.412) * (-2140.265) (-2143.488) [-2133.715] (-2135.895) -- 0:01:14
666500 -- (-2145.889) (-2133.018) [-2132.590] (-2141.605) * (-2136.088) (-2135.585) (-2135.698) [-2133.348] -- 0:01:14
667000 -- (-2139.700) [-2136.145] (-2133.579) (-2140.621) * (-2136.238) [-2134.812] (-2132.212) (-2135.676) -- 0:01:14
667500 -- (-2131.706) (-2136.568) (-2133.312) [-2133.256] * (-2131.373) (-2136.584) [-2134.164] (-2132.149) -- 0:01:14
668000 -- (-2135.984) [-2134.542] (-2138.920) (-2139.161) * (-2136.290) (-2133.710) (-2135.905) [-2135.054] -- 0:01:14
668500 -- (-2135.606) [-2136.235] (-2132.911) (-2136.950) * [-2131.869] (-2129.470) (-2143.140) (-2138.214) -- 0:01:13
669000 -- (-2131.938) [-2141.011] (-2133.792) (-2137.022) * (-2136.197) (-2134.245) (-2136.410) [-2131.438] -- 0:01:13
669500 -- (-2136.347) (-2134.584) (-2132.975) [-2130.828] * (-2133.250) (-2133.642) (-2132.503) [-2137.577] -- 0:01:13
670000 -- (-2138.353) (-2134.564) [-2137.135] (-2135.383) * (-2137.348) (-2138.286) [-2133.353] (-2136.103) -- 0:01:13
Average standard deviation of split frequencies: 0.011246
670500 -- (-2138.753) [-2130.409] (-2143.652) (-2135.559) * (-2134.581) (-2139.611) (-2134.396) [-2133.846] -- 0:01:13
671000 -- (-2139.577) [-2134.037] (-2134.973) (-2144.026) * (-2133.474) (-2134.205) (-2134.810) [-2132.396] -- 0:01:13
671500 -- (-2140.698) [-2130.871] (-2135.944) (-2147.457) * (-2134.174) (-2139.959) [-2133.574] (-2134.595) -- 0:01:13
672000 -- [-2135.664] (-2132.734) (-2143.813) (-2143.917) * (-2133.468) [-2135.077] (-2135.802) (-2144.183) -- 0:01:13
672500 -- (-2135.125) (-2130.600) [-2140.989] (-2137.573) * (-2134.715) (-2137.437) (-2130.271) [-2135.905] -- 0:01:13
673000 -- (-2138.515) (-2134.725) [-2134.485] (-2138.859) * [-2130.615] (-2135.659) (-2137.725) (-2140.516) -- 0:01:12
673500 -- (-2130.619) [-2139.208] (-2132.650) (-2139.485) * [-2133.439] (-2137.521) (-2134.831) (-2133.850) -- 0:01:12
674000 -- (-2135.941) [-2136.445] (-2138.927) (-2140.807) * (-2133.025) [-2134.163] (-2134.672) (-2134.170) -- 0:01:12
674500 -- [-2135.427] (-2133.030) (-2141.559) (-2138.374) * (-2136.488) (-2138.424) (-2132.711) [-2135.377] -- 0:01:12
675000 -- (-2135.852) (-2136.893) [-2134.600] (-2144.316) * [-2131.707] (-2143.180) (-2134.226) (-2137.908) -- 0:01:12
Average standard deviation of split frequencies: 0.010693
675500 -- (-2135.053) (-2141.405) [-2138.455] (-2138.917) * (-2137.284) [-2138.138] (-2133.983) (-2134.806) -- 0:01:12
676000 -- [-2140.089] (-2139.644) (-2131.048) (-2134.832) * [-2134.607] (-2143.199) (-2137.068) (-2137.232) -- 0:01:12
676500 -- (-2150.244) [-2137.150] (-2137.429) (-2131.679) * (-2136.940) (-2140.621) (-2143.051) [-2130.508] -- 0:01:12
677000 -- [-2138.208] (-2135.822) (-2133.340) (-2133.275) * (-2136.527) (-2137.557) (-2137.170) [-2135.123] -- 0:01:12
677500 -- (-2137.095) [-2133.607] (-2136.196) (-2132.515) * (-2137.511) (-2142.354) (-2137.606) [-2133.023] -- 0:01:11
678000 -- (-2142.209) [-2134.317] (-2133.392) (-2134.094) * (-2143.112) (-2137.999) (-2138.649) [-2131.367] -- 0:01:11
678500 -- (-2140.153) (-2137.166) (-2132.257) [-2135.296] * (-2133.189) (-2139.882) [-2136.220] (-2131.221) -- 0:01:11
679000 -- [-2134.678] (-2146.462) (-2130.917) (-2134.581) * (-2136.137) (-2135.020) [-2138.115] (-2137.575) -- 0:01:11
679500 -- (-2137.819) (-2138.869) (-2140.723) [-2136.006] * (-2134.574) [-2131.847] (-2133.403) (-2136.338) -- 0:01:11
680000 -- [-2138.927] (-2138.912) (-2133.073) (-2138.099) * (-2135.847) (-2136.140) (-2135.689) [-2134.685] -- 0:01:11
Average standard deviation of split frequencies: 0.009465
680500 -- (-2139.767) (-2141.084) [-2135.194] (-2130.901) * (-2142.182) (-2138.092) (-2138.217) [-2133.955] -- 0:01:11
681000 -- (-2136.012) (-2138.244) (-2131.542) [-2135.645] * [-2139.933] (-2141.391) (-2142.019) (-2138.434) -- 0:01:11
681500 -- [-2134.516] (-2146.116) (-2133.394) (-2137.096) * (-2133.909) [-2133.229] (-2132.147) (-2138.337) -- 0:01:11
682000 -- (-2137.696) (-2140.528) (-2133.544) [-2132.712] * (-2137.934) [-2131.857] (-2146.559) (-2130.187) -- 0:01:10
682500 -- [-2138.500] (-2140.856) (-2132.528) (-2136.142) * (-2132.905) (-2133.779) [-2134.853] (-2132.223) -- 0:01:10
683000 -- [-2136.781] (-2138.507) (-2132.744) (-2141.431) * (-2138.340) [-2135.354] (-2137.269) (-2133.890) -- 0:01:10
683500 -- (-2135.492) (-2137.360) (-2134.813) [-2134.997] * (-2136.557) [-2138.519] (-2134.266) (-2136.300) -- 0:01:10
684000 -- (-2138.445) (-2139.450) (-2135.120) [-2134.682] * (-2138.381) (-2147.115) (-2136.511) [-2134.250] -- 0:01:10
684500 -- [-2131.148] (-2135.736) (-2134.864) (-2129.648) * (-2137.682) (-2134.302) [-2137.283] (-2136.237) -- 0:01:10
685000 -- (-2137.137) [-2140.981] (-2132.397) (-2138.883) * (-2131.379) (-2136.985) [-2135.208] (-2138.370) -- 0:01:10
Average standard deviation of split frequencies: 0.008475
685500 -- (-2135.442) [-2137.084] (-2142.528) (-2139.724) * (-2138.604) (-2136.266) [-2133.530] (-2133.943) -- 0:01:10
686000 -- (-2138.853) (-2132.782) [-2135.446] (-2133.559) * (-2132.208) [-2135.415] (-2133.901) (-2138.701) -- 0:01:10
686500 -- (-2140.221) (-2133.123) [-2133.029] (-2137.404) * (-2134.497) [-2133.959] (-2139.403) (-2138.043) -- 0:01:09
687000 -- (-2137.317) [-2130.968] (-2133.326) (-2135.520) * (-2137.430) (-2132.250) [-2135.716] (-2135.933) -- 0:01:09
687500 -- [-2139.028] (-2133.142) (-2133.992) (-2135.404) * [-2136.629] (-2135.816) (-2130.718) (-2135.102) -- 0:01:09
688000 -- (-2132.221) [-2134.328] (-2132.017) (-2135.451) * (-2138.255) (-2135.330) (-2128.168) [-2134.256] -- 0:01:09
688500 -- [-2132.290] (-2130.322) (-2139.698) (-2139.462) * (-2138.063) (-2132.323) [-2139.334] (-2133.136) -- 0:01:09
689000 -- [-2135.128] (-2133.938) (-2133.377) (-2135.851) * (-2137.073) (-2136.136) (-2135.832) [-2136.053] -- 0:01:09
689500 -- [-2132.167] (-2133.946) (-2137.456) (-2136.332) * [-2132.081] (-2135.369) (-2133.081) (-2134.772) -- 0:01:09
690000 -- (-2138.138) (-2133.708) [-2133.985] (-2131.461) * [-2131.706] (-2133.612) (-2135.711) (-2142.894) -- 0:01:09
Average standard deviation of split frequencies: 0.008418
690500 -- [-2137.534] (-2141.066) (-2133.430) (-2139.342) * (-2135.731) [-2134.921] (-2135.294) (-2131.768) -- 0:01:09
691000 -- (-2132.375) (-2134.361) (-2136.146) [-2127.546] * (-2139.188) (-2136.336) (-2133.247) [-2139.175] -- 0:01:08
691500 -- (-2131.958) [-2137.827] (-2135.874) (-2133.744) * (-2139.843) (-2140.386) [-2134.718] (-2133.179) -- 0:01:08
692000 -- (-2135.468) (-2138.425) (-2130.622) [-2139.271] * (-2131.409) [-2137.189] (-2136.241) (-2134.121) -- 0:01:08
692500 -- (-2138.328) (-2139.814) (-2136.473) [-2132.439] * (-2139.595) [-2133.984] (-2139.143) (-2137.088) -- 0:01:08
693000 -- (-2136.680) [-2137.546] (-2138.526) (-2134.580) * (-2137.922) (-2136.347) [-2134.364] (-2132.657) -- 0:01:08
693500 -- (-2143.618) (-2132.627) [-2130.569] (-2139.153) * [-2133.053] (-2132.795) (-2132.237) (-2133.471) -- 0:01:08
694000 -- (-2137.825) (-2137.048) (-2136.378) [-2131.506] * (-2136.560) [-2140.096] (-2144.213) (-2136.747) -- 0:01:08
694500 -- [-2131.410] (-2132.610) (-2136.592) (-2137.334) * (-2138.515) [-2141.197] (-2132.183) (-2139.447) -- 0:01:08
695000 -- (-2132.840) (-2138.273) (-2140.341) [-2134.247] * (-2134.879) [-2141.529] (-2131.523) (-2130.859) -- 0:01:08
Average standard deviation of split frequencies: 0.009708
695500 -- (-2134.076) (-2134.152) [-2134.282] (-2131.409) * (-2133.407) (-2132.058) [-2132.982] (-2135.850) -- 0:01:07
696000 -- (-2132.566) (-2132.188) (-2133.591) [-2138.061] * (-2138.621) (-2133.790) (-2135.224) [-2135.823] -- 0:01:07
696500 -- (-2141.844) [-2135.443] (-2135.706) (-2140.870) * (-2134.433) (-2134.817) [-2139.033] (-2137.048) -- 0:01:07
697000 -- (-2133.628) (-2133.281) [-2134.766] (-2140.379) * [-2133.870] (-2138.553) (-2136.466) (-2138.068) -- 0:01:07
697500 -- (-2138.530) [-2134.060] (-2141.382) (-2130.264) * (-2138.744) (-2135.940) [-2135.116] (-2135.749) -- 0:01:07
698000 -- (-2135.598) (-2133.622) [-2132.851] (-2137.814) * (-2138.682) (-2134.714) [-2131.117] (-2137.638) -- 0:01:07
698500 -- (-2136.643) (-2137.742) (-2134.425) [-2132.013] * (-2136.120) (-2134.141) [-2134.392] (-2139.006) -- 0:01:07
699000 -- [-2133.692] (-2137.157) (-2133.213) (-2136.303) * (-2138.731) [-2130.457] (-2133.627) (-2135.737) -- 0:01:07
699500 -- (-2135.004) (-2135.100) (-2142.096) [-2138.082] * (-2141.346) [-2130.252] (-2137.367) (-2136.506) -- 0:01:07
700000 -- (-2136.390) (-2142.418) (-2145.723) [-2143.030] * [-2136.536] (-2132.504) (-2133.406) (-2137.419) -- 0:01:06
Average standard deviation of split frequencies: 0.009643
700500 -- (-2140.454) (-2136.637) [-2139.067] (-2136.523) * (-2139.725) (-2140.462) [-2133.449] (-2147.911) -- 0:01:06
701000 -- (-2135.887) [-2136.817] (-2136.067) (-2135.734) * (-2139.081) (-2138.971) [-2134.640] (-2136.510) -- 0:01:06
701500 -- [-2132.525] (-2135.386) (-2134.189) (-2139.478) * [-2136.370] (-2139.185) (-2136.404) (-2143.304) -- 0:01:06
702000 -- [-2131.663] (-2139.165) (-2133.357) (-2132.253) * [-2135.954] (-2138.074) (-2136.995) (-2137.648) -- 0:01:06
702500 -- (-2137.638) (-2139.722) [-2136.923] (-2135.492) * (-2136.046) [-2133.316] (-2136.494) (-2138.263) -- 0:01:06
703000 -- (-2130.266) (-2140.758) [-2130.768] (-2135.913) * (-2129.333) (-2134.408) (-2137.280) [-2131.456] -- 0:01:06
703500 -- (-2133.038) (-2135.497) [-2135.210] (-2135.278) * (-2134.315) (-2142.353) (-2135.569) [-2136.421] -- 0:01:06
704000 -- (-2139.155) [-2130.241] (-2144.798) (-2143.477) * (-2132.603) (-2136.871) [-2135.582] (-2136.163) -- 0:01:06
704500 -- (-2134.804) [-2137.729] (-2133.497) (-2140.072) * (-2131.996) (-2137.816) (-2134.733) [-2131.024] -- 0:01:05
705000 -- (-2139.459) (-2142.369) (-2138.454) [-2136.434] * (-2136.913) [-2131.673] (-2136.308) (-2137.675) -- 0:01:05
Average standard deviation of split frequencies: 0.010016
705500 -- (-2140.049) [-2134.708] (-2135.008) (-2138.523) * (-2136.760) (-2136.372) [-2139.407] (-2137.518) -- 0:01:05
706000 -- (-2136.123) [-2134.608] (-2131.596) (-2136.628) * (-2134.620) [-2139.863] (-2138.204) (-2135.264) -- 0:01:05
706500 -- (-2137.151) (-2134.889) (-2135.865) [-2137.959] * (-2137.856) (-2141.123) [-2135.183] (-2135.809) -- 0:01:05
707000 -- (-2137.744) (-2143.255) [-2130.987] (-2136.799) * (-2133.404) (-2134.189) [-2131.375] (-2139.977) -- 0:01:05
707500 -- [-2130.897] (-2138.739) (-2140.439) (-2135.669) * (-2135.115) [-2134.831] (-2143.809) (-2139.103) -- 0:01:05
708000 -- [-2134.286] (-2136.720) (-2139.140) (-2136.238) * [-2132.854] (-2138.020) (-2140.607) (-2132.017) -- 0:01:05
708500 -- (-2131.263) (-2140.184) (-2128.857) [-2135.975] * [-2134.150] (-2139.641) (-2137.394) (-2137.127) -- 0:01:05
709000 -- (-2137.158) [-2133.490] (-2141.014) (-2132.524) * (-2134.270) [-2130.901] (-2132.649) (-2136.111) -- 0:01:04
709500 -- [-2129.647] (-2141.474) (-2133.629) (-2139.025) * [-2136.763] (-2133.815) (-2132.857) (-2129.888) -- 0:01:04
710000 -- [-2135.318] (-2136.208) (-2135.262) (-2134.708) * [-2134.020] (-2137.789) (-2140.523) (-2137.023) -- 0:01:04
Average standard deviation of split frequencies: 0.010834
710500 -- (-2131.775) (-2137.101) [-2136.647] (-2136.252) * (-2131.396) (-2129.282) (-2139.983) [-2133.634] -- 0:01:04
711000 -- [-2132.837] (-2132.070) (-2135.190) (-2138.253) * (-2137.236) (-2134.152) [-2134.997] (-2132.687) -- 0:01:04
711500 -- (-2137.245) (-2138.511) [-2131.419] (-2146.534) * (-2135.385) (-2133.182) (-2132.614) [-2132.795] -- 0:01:04
712000 -- [-2133.494] (-2136.200) (-2133.824) (-2135.301) * (-2136.028) [-2129.594] (-2136.995) (-2135.717) -- 0:01:04
712500 -- (-2130.858) (-2133.874) (-2139.394) [-2135.475] * [-2131.914] (-2136.767) (-2134.870) (-2136.142) -- 0:01:04
713000 -- (-2132.767) [-2135.120] (-2133.917) (-2132.447) * (-2134.013) (-2136.738) (-2135.179) [-2134.127] -- 0:01:04
713500 -- (-2129.997) [-2131.335] (-2133.853) (-2132.623) * (-2134.839) (-2138.502) [-2138.084] (-2131.914) -- 0:01:03
714000 -- (-2132.191) (-2132.414) [-2134.125] (-2134.678) * (-2138.054) (-2135.200) (-2136.751) [-2129.510] -- 0:01:03
714500 -- [-2132.057] (-2144.318) (-2138.216) (-2133.183) * [-2136.443] (-2133.540) (-2139.363) (-2134.977) -- 0:01:03
715000 -- (-2133.934) [-2130.733] (-2137.059) (-2133.805) * (-2134.109) (-2134.161) (-2131.795) [-2133.887] -- 0:01:03
Average standard deviation of split frequencies: 0.009876
715500 -- (-2135.179) (-2133.605) (-2138.409) [-2135.958] * [-2135.810] (-2133.550) (-2139.880) (-2140.677) -- 0:01:03
716000 -- (-2139.715) (-2133.514) [-2138.603] (-2137.955) * [-2136.005] (-2135.435) (-2131.817) (-2143.822) -- 0:01:03
716500 -- (-2139.105) [-2135.673] (-2133.075) (-2140.652) * (-2132.891) (-2133.520) (-2137.338) [-2130.745] -- 0:01:03
717000 -- (-2135.525) (-2133.302) [-2133.818] (-2133.577) * (-2139.662) (-2135.676) [-2137.165] (-2131.944) -- 0:01:03
717500 -- (-2136.366) (-2135.786) (-2137.963) [-2140.424] * [-2132.178] (-2138.132) (-2143.863) (-2137.166) -- 0:01:02
718000 -- (-2130.014) (-2138.448) [-2137.751] (-2134.358) * (-2133.515) (-2131.152) [-2133.641] (-2139.272) -- 0:01:02
718500 -- (-2137.224) (-2134.600) (-2132.367) [-2132.415] * (-2132.843) [-2134.784] (-2134.755) (-2135.113) -- 0:01:02
719000 -- (-2133.931) (-2136.717) (-2140.133) [-2130.866] * (-2133.352) (-2134.109) [-2133.940] (-2140.559) -- 0:01:02
719500 -- (-2138.361) (-2142.737) [-2138.833] (-2130.961) * [-2128.544] (-2137.764) (-2132.314) (-2136.003) -- 0:01:02
720000 -- [-2133.344] (-2138.635) (-2138.268) (-2131.687) * (-2131.219) (-2131.806) [-2129.952] (-2132.702) -- 0:01:02
Average standard deviation of split frequencies: 0.009376
720500 -- (-2136.022) (-2133.539) [-2142.261] (-2137.255) * [-2133.734] (-2139.072) (-2137.419) (-2135.274) -- 0:01:02
721000 -- (-2139.027) [-2132.534] (-2135.001) (-2142.408) * [-2132.125] (-2131.542) (-2130.541) (-2134.406) -- 0:01:02
721500 -- [-2135.923] (-2136.790) (-2132.329) (-2135.122) * [-2135.647] (-2137.083) (-2133.635) (-2134.949) -- 0:01:02
722000 -- [-2134.793] (-2140.255) (-2134.097) (-2135.542) * (-2138.428) [-2133.633] (-2135.729) (-2139.417) -- 0:01:01
722500 -- (-2134.611) (-2137.617) (-2143.164) [-2131.566] * (-2136.041) (-2138.248) [-2133.906] (-2129.372) -- 0:01:01
723000 -- (-2136.011) (-2133.653) [-2135.359] (-2133.217) * (-2140.159) (-2131.086) (-2129.658) [-2132.902] -- 0:01:01
723500 -- (-2135.410) [-2138.585] (-2133.476) (-2134.316) * (-2132.611) [-2136.899] (-2142.818) (-2138.379) -- 0:01:01
724000 -- [-2142.230] (-2131.674) (-2137.287) (-2137.613) * (-2136.281) (-2134.118) (-2136.086) [-2134.803] -- 0:01:01
724500 -- (-2141.107) [-2135.704] (-2133.209) (-2142.217) * (-2137.068) (-2134.389) [-2139.142] (-2145.201) -- 0:01:01
725000 -- (-2138.868) (-2138.378) [-2134.912] (-2132.598) * (-2133.604) [-2135.098] (-2134.370) (-2134.901) -- 0:01:01
Average standard deviation of split frequencies: 0.009740
725500 -- [-2136.676] (-2136.126) (-2140.315) (-2135.303) * (-2134.270) [-2136.187] (-2141.070) (-2142.624) -- 0:01:01
726000 -- (-2134.922) [-2132.427] (-2138.993) (-2139.169) * [-2131.984] (-2135.757) (-2132.614) (-2139.846) -- 0:01:01
726500 -- (-2135.091) (-2132.285) (-2136.366) [-2133.107] * (-2140.385) (-2137.921) [-2131.955] (-2139.369) -- 0:01:00
727000 -- (-2135.667) (-2131.193) [-2134.576] (-2130.973) * (-2134.485) (-2139.530) (-2134.301) [-2141.050] -- 0:01:00
727500 -- (-2140.176) (-2134.340) [-2134.316] (-2129.345) * (-2128.901) (-2143.111) [-2134.439] (-2136.578) -- 0:01:00
728000 -- (-2139.797) (-2132.145) [-2131.634] (-2136.011) * (-2133.765) (-2137.480) (-2133.569) [-2139.318] -- 0:01:00
728500 -- (-2140.638) [-2132.846] (-2135.223) (-2141.095) * (-2137.736) [-2142.523] (-2141.829) (-2134.169) -- 0:01:00
729000 -- (-2137.656) (-2135.723) [-2137.377] (-2140.391) * (-2134.879) (-2132.228) [-2133.869] (-2135.073) -- 0:01:00
729500 -- (-2134.888) (-2136.897) [-2134.328] (-2142.499) * [-2133.738] (-2137.367) (-2135.652) (-2136.252) -- 0:01:00
730000 -- (-2138.090) (-2135.077) [-2138.831] (-2142.636) * (-2137.693) (-2132.440) [-2138.957] (-2132.815) -- 0:01:00
Average standard deviation of split frequencies: 0.007527
730500 -- (-2137.270) [-2138.220] (-2141.484) (-2137.804) * (-2137.046) (-2133.450) (-2145.163) [-2133.921] -- 0:01:00
731000 -- [-2134.251] (-2131.243) (-2135.339) (-2134.768) * (-2133.562) (-2136.429) [-2134.805] (-2132.282) -- 0:00:59
731500 -- (-2135.112) [-2138.420] (-2137.511) (-2141.268) * [-2137.022] (-2133.031) (-2136.459) (-2136.066) -- 0:00:59
732000 -- [-2139.697] (-2139.180) (-2134.052) (-2132.709) * (-2133.612) [-2134.733] (-2131.828) (-2139.754) -- 0:00:59
732500 -- (-2137.357) (-2133.473) [-2132.970] (-2138.424) * (-2139.266) [-2130.815] (-2135.071) (-2133.845) -- 0:00:59
733000 -- (-2134.666) (-2133.220) [-2132.470] (-2140.488) * (-2137.509) (-2138.234) (-2138.048) [-2132.801] -- 0:00:59
733500 -- [-2131.539] (-2140.197) (-2136.204) (-2143.665) * (-2135.299) (-2139.226) [-2128.976] (-2135.306) -- 0:00:59
734000 -- (-2134.411) [-2131.203] (-2134.846) (-2141.384) * (-2136.647) [-2138.270] (-2138.853) (-2139.767) -- 0:00:59
734500 -- [-2136.260] (-2134.950) (-2131.869) (-2141.813) * (-2133.078) [-2136.033] (-2141.776) (-2135.768) -- 0:00:59
735000 -- [-2134.109] (-2138.564) (-2131.457) (-2139.498) * [-2132.691] (-2148.569) (-2135.332) (-2140.040) -- 0:00:59
Average standard deviation of split frequencies: 0.007472
735500 -- (-2139.231) [-2131.943] (-2132.998) (-2134.891) * (-2131.887) [-2144.116] (-2134.626) (-2137.725) -- 0:00:58
736000 -- (-2139.718) (-2138.366) [-2133.134] (-2133.473) * [-2136.856] (-2136.252) (-2139.098) (-2137.396) -- 0:00:58
736500 -- (-2135.956) (-2137.201) [-2131.764] (-2134.094) * [-2132.575] (-2133.896) (-2137.894) (-2136.426) -- 0:00:58
737000 -- (-2138.502) (-2137.746) [-2131.800] (-2137.031) * (-2134.620) (-2138.063) (-2134.561) [-2132.565] -- 0:00:58
737500 -- (-2138.839) [-2134.695] (-2140.254) (-2135.956) * (-2134.298) (-2140.240) [-2129.315] (-2132.770) -- 0:00:58
738000 -- [-2143.730] (-2131.061) (-2133.769) (-2133.566) * (-2138.451) (-2133.689) [-2132.651] (-2138.237) -- 0:00:58
738500 -- (-2137.505) (-2139.161) (-2134.864) [-2133.505] * (-2132.267) (-2139.651) [-2133.087] (-2135.123) -- 0:00:58
739000 -- (-2130.146) (-2144.196) [-2135.334] (-2138.230) * (-2140.785) (-2137.298) [-2134.804] (-2143.147) -- 0:00:58
739500 -- (-2137.185) (-2132.556) (-2133.378) [-2132.841] * (-2134.890) (-2150.697) [-2141.095] (-2141.251) -- 0:00:58
740000 -- (-2135.951) (-2133.722) [-2132.135] (-2135.423) * (-2137.813) [-2137.776] (-2137.935) (-2138.918) -- 0:00:57
Average standard deviation of split frequencies: 0.009123
740500 -- (-2134.244) (-2136.030) (-2137.412) [-2132.637] * [-2132.671] (-2133.041) (-2136.156) (-2139.336) -- 0:00:57
741000 -- (-2133.946) (-2136.158) [-2133.450] (-2136.519) * (-2138.162) (-2136.702) (-2142.560) [-2131.870] -- 0:00:57
741500 -- (-2135.189) [-2136.487] (-2130.492) (-2133.082) * (-2136.234) (-2129.461) (-2140.791) [-2131.066] -- 0:00:57
742000 -- [-2137.706] (-2134.619) (-2138.334) (-2136.899) * [-2135.278] (-2130.819) (-2136.794) (-2134.715) -- 0:00:57
742500 -- [-2137.230] (-2141.570) (-2133.659) (-2132.596) * (-2133.647) [-2131.368] (-2137.862) (-2145.146) -- 0:00:57
743000 -- (-2135.796) [-2134.793] (-2132.017) (-2136.182) * [-2141.069] (-2137.346) (-2139.964) (-2140.193) -- 0:00:57
743500 -- (-2132.826) (-2136.315) [-2136.369] (-2136.899) * (-2137.789) [-2135.169] (-2141.676) (-2138.005) -- 0:00:57
744000 -- [-2133.971] (-2129.490) (-2140.343) (-2133.044) * (-2135.908) (-2133.456) [-2135.427] (-2133.359) -- 0:00:57
744500 -- (-2134.163) (-2129.714) [-2135.916] (-2134.893) * (-2137.186) (-2133.460) [-2134.966] (-2139.467) -- 0:00:56
745000 -- (-2135.922) (-2132.745) [-2138.347] (-2140.500) * (-2135.923) (-2135.636) [-2138.421] (-2140.800) -- 0:00:56
Average standard deviation of split frequencies: 0.009057
745500 -- (-2139.721) (-2144.435) [-2138.300] (-2141.016) * (-2132.490) [-2134.584] (-2132.673) (-2134.764) -- 0:00:56
746000 -- (-2133.060) (-2134.132) [-2134.584] (-2144.627) * (-2136.730) (-2136.069) (-2134.269) [-2132.102] -- 0:00:56
746500 -- (-2140.893) [-2133.941] (-2131.722) (-2138.784) * (-2133.905) [-2132.912] (-2137.353) (-2136.801) -- 0:00:56
747000 -- (-2133.620) (-2133.739) [-2134.199] (-2140.991) * [-2131.752] (-2133.828) (-2140.831) (-2139.159) -- 0:00:56
747500 -- [-2135.167] (-2141.154) (-2132.499) (-2139.404) * [-2132.604] (-2135.367) (-2138.241) (-2134.454) -- 0:00:56
748000 -- [-2133.036] (-2132.672) (-2138.040) (-2140.894) * (-2135.826) (-2132.950) [-2134.967] (-2132.801) -- 0:00:56
748500 -- (-2134.584) (-2137.939) [-2135.112] (-2137.099) * (-2137.626) (-2134.384) [-2135.204] (-2133.749) -- 0:00:56
749000 -- [-2135.328] (-2137.360) (-2143.394) (-2135.524) * (-2130.118) (-2137.035) (-2136.947) [-2131.780] -- 0:00:55
749500 -- [-2131.130] (-2136.478) (-2148.668) (-2137.609) * (-2133.182) [-2135.310] (-2136.249) (-2136.629) -- 0:00:55
750000 -- (-2140.938) (-2138.476) (-2134.596) [-2134.132] * [-2136.957] (-2130.021) (-2134.427) (-2136.179) -- 0:00:55
Average standard deviation of split frequencies: 0.009001
750500 -- (-2132.181) (-2143.133) (-2131.275) [-2131.327] * (-2131.769) (-2132.441) [-2134.526] (-2133.960) -- 0:00:55
751000 -- [-2134.023] (-2130.709) (-2135.002) (-2139.342) * (-2133.790) (-2135.961) [-2130.506] (-2135.102) -- 0:00:55
751500 -- [-2132.555] (-2137.341) (-2131.833) (-2136.925) * (-2134.944) (-2132.825) [-2135.459] (-2136.459) -- 0:00:55
752000 -- (-2138.580) (-2138.184) [-2136.482] (-2133.748) * [-2134.512] (-2135.888) (-2135.487) (-2133.718) -- 0:00:55
752500 -- (-2139.789) (-2135.006) [-2133.594] (-2138.786) * (-2138.206) (-2138.407) (-2130.655) [-2131.000] -- 0:00:55
753000 -- (-2134.495) (-2136.207) (-2132.686) [-2137.406] * (-2138.360) (-2140.265) (-2133.495) [-2134.536] -- 0:00:55
753500 -- (-2134.249) [-2132.213] (-2133.103) (-2137.353) * (-2138.584) (-2136.024) (-2141.786) [-2132.870] -- 0:00:54
754000 -- (-2136.991) (-2131.758) (-2137.551) [-2133.744] * (-2132.070) (-2135.652) [-2134.258] (-2135.985) -- 0:00:54
754500 -- (-2146.009) [-2139.742] (-2136.012) (-2135.990) * (-2136.638) (-2139.243) (-2135.070) [-2134.071] -- 0:00:54
755000 -- [-2133.179] (-2132.070) (-2142.457) (-2137.267) * (-2132.928) (-2133.638) [-2137.850] (-2139.867) -- 0:00:54
Average standard deviation of split frequencies: 0.009145
755500 -- [-2141.818] (-2132.444) (-2132.133) (-2138.661) * (-2131.485) [-2137.115] (-2136.346) (-2130.629) -- 0:00:54
756000 -- [-2137.665] (-2135.785) (-2134.412) (-2137.743) * (-2132.100) (-2141.490) [-2136.969] (-2138.978) -- 0:00:54
756500 -- (-2139.760) (-2137.276) [-2130.199] (-2140.070) * (-2132.846) (-2134.036) (-2139.558) [-2136.391] -- 0:00:54
757000 -- (-2138.962) (-2131.894) (-2138.093) [-2137.336] * [-2134.284] (-2134.308) (-2133.962) (-2148.330) -- 0:00:54
757500 -- [-2137.604] (-2133.502) (-2131.823) (-2136.842) * (-2132.212) (-2135.885) [-2135.432] (-2138.614) -- 0:00:54
758000 -- (-2140.129) (-2134.854) [-2134.465] (-2138.089) * [-2130.581] (-2133.402) (-2135.711) (-2139.589) -- 0:00:53
758500 -- [-2133.899] (-2135.327) (-2132.375) (-2136.865) * (-2134.174) [-2133.064] (-2135.932) (-2137.597) -- 0:00:53
759000 -- (-2138.522) (-2137.213) [-2132.916] (-2135.058) * (-2133.632) [-2135.135] (-2134.932) (-2135.515) -- 0:00:53
759500 -- (-2145.826) (-2128.494) (-2136.074) [-2137.177] * (-2139.259) (-2133.611) (-2148.434) [-2134.780] -- 0:00:53
760000 -- (-2136.709) [-2134.962] (-2133.351) (-2138.475) * (-2141.633) (-2141.318) [-2133.052] (-2137.229) -- 0:00:53
Average standard deviation of split frequencies: 0.008676
760500 -- (-2135.871) (-2136.397) (-2133.038) [-2139.437] * (-2140.163) (-2132.975) [-2133.706] (-2144.235) -- 0:00:53
761000 -- (-2133.544) [-2133.872] (-2140.504) (-2132.927) * (-2137.035) (-2135.924) (-2136.634) [-2137.698] -- 0:00:53
761500 -- (-2141.011) (-2138.433) (-2136.290) [-2135.930] * (-2134.314) [-2141.579] (-2131.212) (-2136.799) -- 0:00:53
762000 -- (-2131.784) [-2141.945] (-2140.095) (-2134.820) * (-2140.010) (-2135.721) (-2138.392) [-2135.522] -- 0:00:53
762500 -- (-2139.375) [-2134.419] (-2138.264) (-2133.083) * (-2136.152) [-2135.715] (-2136.638) (-2136.535) -- 0:00:52
763000 -- (-2136.943) [-2135.732] (-2137.971) (-2137.504) * (-2137.454) (-2132.493) (-2136.691) [-2137.027] -- 0:00:52
763500 -- (-2133.642) [-2134.326] (-2137.558) (-2130.286) * [-2131.155] (-2137.875) (-2143.536) (-2136.120) -- 0:00:52
764000 -- (-2137.159) (-2133.066) [-2138.191] (-2129.919) * (-2136.513) (-2138.048) (-2136.398) [-2132.284] -- 0:00:52
764500 -- (-2130.800) (-2130.912) [-2133.858] (-2136.936) * (-2133.920) [-2136.412] (-2140.253) (-2138.792) -- 0:00:52
765000 -- (-2140.347) (-2135.820) [-2132.592] (-2131.130) * (-2142.001) (-2135.668) (-2135.904) [-2131.314] -- 0:00:52
Average standard deviation of split frequencies: 0.009026
765500 -- (-2137.151) [-2135.070] (-2132.712) (-2137.410) * [-2139.482] (-2133.819) (-2140.279) (-2137.823) -- 0:00:52
766000 -- (-2139.854) (-2130.767) (-2135.877) [-2136.125] * (-2137.077) (-2139.396) [-2131.339] (-2141.522) -- 0:00:52
766500 -- (-2134.386) (-2134.003) (-2137.122) [-2133.712] * (-2132.412) (-2134.174) (-2130.410) [-2131.383] -- 0:00:52
767000 -- (-2131.379) (-2140.388) [-2141.381] (-2134.619) * (-2131.675) (-2136.461) (-2136.234) [-2132.504] -- 0:00:51
767500 -- [-2134.844] (-2132.929) (-2134.737) (-2134.770) * (-2131.802) [-2132.474] (-2142.283) (-2128.891) -- 0:00:51
768000 -- (-2134.087) (-2134.732) [-2137.335] (-2136.959) * (-2139.278) (-2134.227) (-2137.348) [-2135.407] -- 0:00:51
768500 -- (-2138.193) (-2131.589) [-2132.151] (-2133.207) * (-2137.358) [-2133.112] (-2139.507) (-2139.669) -- 0:00:51
769000 -- (-2135.843) (-2134.801) (-2130.666) [-2137.943] * (-2134.632) (-2134.256) [-2137.946] (-2150.511) -- 0:00:51
769500 -- (-2135.490) (-2139.198) [-2141.072] (-2133.920) * [-2136.033] (-2136.523) (-2138.648) (-2136.998) -- 0:00:51
770000 -- (-2137.473) (-2136.747) (-2139.487) [-2134.952] * (-2135.116) [-2137.207] (-2133.743) (-2137.068) -- 0:00:51
Average standard deviation of split frequencies: 0.008564
770500 -- [-2139.555] (-2140.277) (-2141.428) (-2138.900) * (-2134.659) [-2136.197] (-2132.840) (-2133.813) -- 0:00:51
771000 -- [-2134.855] (-2133.283) (-2137.146) (-2135.860) * [-2136.818] (-2138.485) (-2137.194) (-2138.677) -- 0:00:51
771500 -- (-2131.355) (-2135.257) (-2133.648) [-2131.125] * [-2137.248] (-2137.229) (-2135.900) (-2134.013) -- 0:00:50
772000 -- (-2132.565) [-2138.426] (-2138.072) (-2138.077) * [-2129.635] (-2133.750) (-2141.667) (-2134.856) -- 0:00:50
772500 -- [-2139.601] (-2137.460) (-2139.334) (-2135.918) * (-2131.914) [-2133.115] (-2135.175) (-2132.155) -- 0:00:50
773000 -- [-2133.688] (-2132.871) (-2135.434) (-2134.469) * (-2130.724) (-2130.049) [-2134.118] (-2134.552) -- 0:00:50
773500 -- (-2132.691) (-2137.061) (-2139.417) [-2134.411] * [-2134.166] (-2136.272) (-2137.981) (-2134.600) -- 0:00:50
774000 -- [-2131.332] (-2133.910) (-2137.819) (-2131.770) * (-2133.134) (-2131.472) [-2138.234] (-2133.032) -- 0:00:50
774500 -- (-2134.795) (-2140.711) (-2134.084) [-2134.568] * [-2134.261] (-2137.246) (-2133.788) (-2135.394) -- 0:00:50
775000 -- (-2135.235) (-2134.098) (-2141.284) [-2135.258] * (-2139.138) [-2135.909] (-2138.673) (-2134.729) -- 0:00:50
Average standard deviation of split frequencies: 0.008707
775500 -- (-2139.762) (-2142.224) (-2133.868) [-2135.618] * [-2131.846] (-2132.520) (-2135.648) (-2134.058) -- 0:00:50
776000 -- (-2136.610) (-2139.663) (-2135.381) [-2135.144] * (-2136.549) (-2131.988) (-2131.611) [-2135.941] -- 0:00:49
776500 -- (-2132.515) (-2139.650) [-2134.664] (-2136.749) * (-2137.898) [-2135.554] (-2140.364) (-2143.168) -- 0:00:49
777000 -- (-2132.766) (-2143.465) (-2134.717) [-2133.496] * [-2138.037] (-2134.644) (-2141.681) (-2135.791) -- 0:00:49
777500 -- [-2136.808] (-2133.756) (-2135.899) (-2134.187) * (-2138.238) (-2130.492) [-2136.543] (-2132.881) -- 0:00:49
778000 -- (-2137.825) (-2139.958) (-2134.926) [-2137.003] * (-2141.954) (-2138.614) [-2133.135] (-2130.757) -- 0:00:49
778500 -- (-2135.518) (-2132.247) [-2133.185] (-2134.892) * (-2144.806) [-2130.033] (-2135.207) (-2133.993) -- 0:00:49
779000 -- [-2136.851] (-2135.652) (-2136.684) (-2142.701) * (-2137.321) (-2132.777) (-2137.438) [-2137.017] -- 0:00:49
779500 -- [-2137.803] (-2132.502) (-2137.734) (-2136.090) * (-2137.605) (-2131.086) [-2135.359] (-2134.805) -- 0:00:49
780000 -- (-2136.624) (-2138.356) (-2133.935) [-2130.116] * (-2138.546) (-2142.183) [-2136.066] (-2135.646) -- 0:00:49
Average standard deviation of split frequencies: 0.008655
780500 -- (-2133.498) (-2132.805) (-2139.283) [-2132.992] * (-2132.664) (-2141.952) [-2130.989] (-2137.295) -- 0:00:48
781000 -- (-2132.861) (-2139.443) (-2133.688) [-2133.509] * [-2136.290] (-2132.629) (-2130.964) (-2135.322) -- 0:00:48
781500 -- [-2139.376] (-2135.854) (-2135.024) (-2137.273) * (-2135.118) [-2133.427] (-2140.266) (-2135.591) -- 0:00:48
782000 -- (-2136.113) (-2136.141) [-2133.102] (-2140.928) * (-2141.286) [-2131.549] (-2134.529) (-2138.724) -- 0:00:48
782500 -- [-2135.033] (-2134.123) (-2137.544) (-2141.485) * (-2135.921) (-2132.523) [-2137.571] (-2135.966) -- 0:00:48
783000 -- (-2132.060) [-2133.253] (-2137.812) (-2134.785) * (-2132.772) (-2139.358) [-2137.513] (-2136.205) -- 0:00:48
783500 -- (-2136.401) (-2136.558) [-2134.190] (-2135.209) * (-2141.799) [-2135.793] (-2136.962) (-2139.422) -- 0:00:48
784000 -- (-2135.412) (-2136.176) (-2131.619) [-2136.429] * (-2138.120) [-2134.145] (-2137.026) (-2139.983) -- 0:00:48
784500 -- (-2131.408) [-2135.442] (-2141.182) (-2134.897) * (-2135.558) [-2135.456] (-2137.551) (-2142.908) -- 0:00:48
785000 -- [-2135.977] (-2134.855) (-2132.673) (-2137.766) * (-2131.743) (-2137.186) (-2133.113) [-2135.084] -- 0:00:47
Average standard deviation of split frequencies: 0.007797
785500 -- (-2133.274) (-2132.389) [-2134.241] (-2136.333) * [-2133.241] (-2132.814) (-2133.881) (-2135.920) -- 0:00:47
786000 -- (-2133.186) (-2135.224) (-2140.038) [-2135.394] * [-2133.762] (-2138.681) (-2133.428) (-2136.310) -- 0:00:47
786500 -- [-2133.206] (-2134.196) (-2136.052) (-2139.589) * (-2141.227) [-2133.720] (-2139.125) (-2142.048) -- 0:00:47
787000 -- (-2132.291) (-2136.320) [-2137.454] (-2133.124) * (-2134.607) [-2136.851] (-2138.214) (-2136.210) -- 0:00:47
787500 -- (-2133.282) [-2132.344] (-2148.134) (-2142.200) * [-2131.985] (-2136.520) (-2138.350) (-2133.091) -- 0:00:47
788000 -- (-2136.960) (-2135.898) [-2139.518] (-2135.216) * (-2138.783) [-2132.724] (-2132.869) (-2136.271) -- 0:00:47
788500 -- [-2132.083] (-2132.424) (-2138.070) (-2133.216) * (-2131.610) (-2132.135) (-2132.849) [-2133.200] -- 0:00:47
789000 -- (-2138.729) (-2135.054) (-2132.855) [-2130.978] * (-2132.568) [-2136.885] (-2135.551) (-2133.103) -- 0:00:47
789500 -- (-2135.867) (-2138.451) [-2134.613] (-2136.539) * (-2133.839) [-2133.456] (-2138.972) (-2135.897) -- 0:00:46
790000 -- (-2133.112) [-2141.950] (-2137.021) (-2133.371) * (-2135.833) [-2134.379] (-2137.202) (-2137.394) -- 0:00:46
Average standard deviation of split frequencies: 0.008744
790500 -- (-2130.979) [-2137.898] (-2133.236) (-2135.118) * (-2133.766) (-2131.189) (-2141.927) [-2137.991] -- 0:00:46
791000 -- (-2137.895) (-2141.383) [-2132.512] (-2137.990) * [-2135.252] (-2141.431) (-2134.497) (-2131.935) -- 0:00:46
791500 -- (-2131.519) (-2140.580) [-2130.567] (-2133.855) * (-2133.367) [-2137.847] (-2133.200) (-2137.722) -- 0:00:46
792000 -- (-2133.468) [-2138.221] (-2133.693) (-2136.835) * (-2139.876) [-2146.123] (-2136.407) (-2138.104) -- 0:00:46
792500 -- (-2134.723) [-2134.455] (-2139.631) (-2137.151) * (-2138.976) (-2132.678) [-2134.369] (-2136.209) -- 0:00:46
793000 -- (-2136.644) (-2132.936) [-2135.910] (-2134.010) * [-2141.019] (-2138.149) (-2133.103) (-2138.644) -- 0:00:46
793500 -- (-2136.201) (-2138.491) (-2136.375) [-2133.236] * (-2136.892) [-2137.214] (-2133.135) (-2148.857) -- 0:00:46
794000 -- [-2137.225] (-2133.231) (-2137.483) (-2136.084) * (-2135.405) [-2135.099] (-2138.706) (-2143.627) -- 0:00:45
794500 -- [-2135.843] (-2131.144) (-2138.582) (-2133.949) * (-2132.475) (-2141.085) [-2139.325] (-2134.254) -- 0:00:45
795000 -- [-2134.652] (-2133.030) (-2132.418) (-2135.544) * [-2132.137] (-2137.900) (-2135.100) (-2132.941) -- 0:00:45
Average standard deviation of split frequencies: 0.008686
795500 -- [-2134.018] (-2132.297) (-2138.601) (-2133.171) * (-2136.088) (-2135.649) (-2130.573) [-2130.309] -- 0:00:45
796000 -- (-2133.006) (-2131.580) (-2139.322) [-2136.288] * [-2135.669] (-2129.971) (-2145.492) (-2132.971) -- 0:00:45
796500 -- (-2137.623) (-2130.838) (-2137.581) [-2137.218] * (-2132.522) (-2136.427) (-2134.371) [-2134.020] -- 0:00:45
797000 -- (-2135.717) [-2136.318] (-2135.295) (-2136.298) * (-2138.689) (-2134.581) (-2134.187) [-2132.286] -- 0:00:45
797500 -- (-2132.454) (-2134.574) (-2132.679) [-2140.832] * (-2136.245) [-2132.713] (-2134.795) (-2138.367) -- 0:00:45
798000 -- (-2131.737) (-2137.161) [-2133.526] (-2136.488) * (-2134.485) [-2131.583] (-2136.556) (-2133.279) -- 0:00:45
798500 -- (-2130.569) (-2145.946) [-2133.545] (-2141.473) * (-2133.380) [-2130.193] (-2137.216) (-2136.785) -- 0:00:44
799000 -- (-2131.465) (-2140.398) [-2132.750] (-2149.375) * [-2134.446] (-2137.666) (-2141.652) (-2133.660) -- 0:00:44
799500 -- [-2136.081] (-2134.784) (-2135.608) (-2132.594) * (-2138.082) (-2132.148) [-2134.681] (-2133.424) -- 0:00:44
800000 -- (-2137.013) (-2135.245) [-2133.459] (-2135.374) * (-2132.172) [-2134.815] (-2136.573) (-2135.070) -- 0:00:44
Average standard deviation of split frequencies: 0.008243
800500 -- (-2134.556) (-2134.723) [-2136.793] (-2132.271) * (-2134.815) [-2139.973] (-2134.406) (-2140.334) -- 0:00:44
801000 -- [-2131.240] (-2133.013) (-2134.862) (-2138.764) * (-2143.257) (-2133.062) (-2138.009) [-2137.808] -- 0:00:44
801500 -- (-2135.323) [-2130.634] (-2133.362) (-2139.455) * (-2145.538) (-2135.553) (-2138.702) [-2136.841] -- 0:00:44
802000 -- (-2139.218) (-2135.367) (-2130.784) [-2136.047] * (-2134.833) [-2134.435] (-2140.406) (-2134.467) -- 0:00:44
802500 -- [-2134.421] (-2133.806) (-2135.546) (-2138.999) * (-2132.877) [-2136.266] (-2134.712) (-2133.826) -- 0:00:44
803000 -- (-2141.063) (-2136.917) (-2132.800) [-2136.525] * (-2139.658) (-2146.514) (-2135.718) [-2133.922] -- 0:00:43
803500 -- (-2132.016) [-2133.851] (-2137.013) (-2132.278) * (-2135.906) (-2138.228) (-2137.039) [-2130.522] -- 0:00:43
804000 -- (-2134.699) (-2134.818) [-2136.681] (-2139.544) * (-2139.355) (-2136.880) [-2135.890] (-2138.640) -- 0:00:43
804500 -- (-2138.337) [-2131.687] (-2136.111) (-2144.776) * [-2132.735] (-2136.702) (-2135.964) (-2134.765) -- 0:00:43
805000 -- (-2133.650) [-2131.584] (-2137.626) (-2148.638) * (-2139.863) (-2139.456) (-2137.038) [-2134.723] -- 0:00:43
Average standard deviation of split frequencies: 0.006629
805500 -- (-2133.292) [-2132.526] (-2143.211) (-2131.843) * (-2136.424) [-2129.046] (-2135.203) (-2136.477) -- 0:00:43
806000 -- (-2133.121) (-2136.165) (-2143.492) [-2134.028] * (-2132.899) [-2134.588] (-2136.944) (-2138.588) -- 0:00:43
806500 -- (-2132.222) [-2133.783] (-2136.016) (-2133.838) * [-2130.706] (-2133.113) (-2136.910) (-2133.996) -- 0:00:43
807000 -- (-2131.649) [-2132.880] (-2134.346) (-2134.579) * (-2131.023) [-2135.493] (-2134.005) (-2135.996) -- 0:00:43
807500 -- [-2135.450] (-2135.465) (-2138.192) (-2135.449) * (-2134.230) (-2133.725) (-2137.577) [-2132.663] -- 0:00:42
808000 -- [-2132.560] (-2137.236) (-2138.971) (-2147.707) * [-2130.433] (-2130.401) (-2132.368) (-2143.215) -- 0:00:42
808500 -- (-2133.829) (-2136.750) [-2136.710] (-2135.252) * [-2130.206] (-2135.952) (-2143.534) (-2138.670) -- 0:00:42
809000 -- (-2135.055) [-2134.765] (-2132.341) (-2137.944) * [-2140.078] (-2138.973) (-2140.674) (-2137.940) -- 0:00:42
809500 -- (-2131.894) [-2135.534] (-2140.207) (-2134.549) * (-2136.745) (-2134.069) [-2131.472] (-2133.158) -- 0:00:42
810000 -- (-2134.589) (-2135.484) (-2141.246) [-2133.836] * [-2130.503] (-2134.087) (-2137.641) (-2137.580) -- 0:00:42
Average standard deviation of split frequencies: 0.008335
810500 -- (-2137.337) (-2129.284) [-2132.725] (-2132.726) * [-2133.933] (-2135.616) (-2131.754) (-2137.625) -- 0:00:42
811000 -- (-2136.317) (-2133.119) (-2137.261) [-2138.492] * (-2133.513) [-2130.838] (-2136.086) (-2153.158) -- 0:00:42
811500 -- (-2136.027) [-2134.244] (-2130.667) (-2138.370) * [-2136.582] (-2137.482) (-2131.046) (-2144.746) -- 0:00:42
812000 -- (-2131.905) (-2135.493) (-2133.722) [-2136.393] * (-2139.537) (-2138.976) [-2133.308] (-2141.854) -- 0:00:41
812500 -- [-2134.585] (-2134.978) (-2137.474) (-2134.734) * [-2134.986] (-2130.371) (-2139.229) (-2135.103) -- 0:00:41
813000 -- (-2131.043) (-2131.384) [-2142.115] (-2133.141) * (-2144.978) (-2134.609) [-2131.603] (-2135.739) -- 0:00:41
813500 -- (-2135.456) (-2133.600) [-2130.205] (-2132.363) * (-2135.398) [-2132.670] (-2134.326) (-2132.535) -- 0:00:41
814000 -- (-2134.517) (-2139.776) (-2130.358) [-2135.956] * [-2136.054] (-2132.847) (-2130.494) (-2137.170) -- 0:00:41
814500 -- (-2134.323) (-2139.600) [-2137.896] (-2139.923) * (-2141.262) [-2131.384] (-2132.050) (-2135.273) -- 0:00:41
815000 -- [-2131.685] (-2140.401) (-2135.764) (-2139.276) * (-2139.849) (-2138.694) (-2131.966) [-2136.489] -- 0:00:41
Average standard deviation of split frequencies: 0.007510
815500 -- (-2135.113) [-2135.857] (-2134.229) (-2137.562) * (-2138.651) [-2136.111] (-2135.738) (-2135.775) -- 0:00:41
816000 -- (-2136.328) [-2132.777] (-2139.744) (-2138.908) * (-2132.678) (-2136.462) (-2142.398) [-2130.272] -- 0:00:41
816500 -- (-2136.004) (-2145.589) (-2139.191) [-2134.155] * [-2132.627] (-2137.033) (-2135.968) (-2138.104) -- 0:00:40
817000 -- (-2136.062) [-2133.166] (-2143.020) (-2133.675) * [-2131.951] (-2137.548) (-2139.441) (-2137.158) -- 0:00:40
817500 -- (-2136.175) (-2137.948) (-2132.942) [-2134.686] * (-2141.848) [-2135.607] (-2134.666) (-2136.220) -- 0:00:40
818000 -- [-2137.822] (-2140.555) (-2137.587) (-2135.906) * [-2134.394] (-2137.829) (-2144.872) (-2138.851) -- 0:00:40
818500 -- (-2138.027) (-2137.995) (-2135.553) [-2132.207] * [-2137.170] (-2132.657) (-2135.712) (-2140.956) -- 0:00:40
819000 -- (-2138.577) (-2137.248) (-2136.197) [-2130.854] * [-2133.218] (-2139.643) (-2144.289) (-2132.703) -- 0:00:40
819500 -- (-2146.623) (-2134.087) (-2135.204) [-2134.276] * [-2133.478] (-2142.199) (-2140.078) (-2135.137) -- 0:00:40
820000 -- (-2135.397) (-2140.320) [-2136.755] (-2137.620) * (-2140.269) (-2138.739) (-2139.126) [-2136.903] -- 0:00:40
Average standard deviation of split frequencies: 0.007467
820500 -- [-2136.101] (-2133.135) (-2139.256) (-2134.703) * (-2136.272) (-2139.575) (-2139.451) [-2137.855] -- 0:00:40
821000 -- (-2134.339) (-2135.616) (-2139.700) [-2129.981] * [-2136.166] (-2139.304) (-2132.291) (-2136.778) -- 0:00:39
821500 -- (-2139.679) [-2131.268] (-2151.419) (-2134.212) * [-2132.056] (-2136.969) (-2132.475) (-2137.716) -- 0:00:39
822000 -- (-2129.832) [-2131.872] (-2143.806) (-2138.633) * (-2134.551) (-2138.231) [-2133.658] (-2136.732) -- 0:00:39
822500 -- (-2132.992) [-2132.818] (-2141.168) (-2136.560) * [-2134.926] (-2138.670) (-2137.527) (-2139.173) -- 0:00:39
823000 -- [-2134.375] (-2134.573) (-2140.447) (-2136.283) * [-2131.409] (-2139.178) (-2130.016) (-2146.630) -- 0:00:39
823500 -- [-2133.957] (-2137.039) (-2136.277) (-2137.525) * (-2135.197) [-2132.272] (-2138.911) (-2135.853) -- 0:00:39
824000 -- (-2133.274) (-2140.594) [-2135.002] (-2131.883) * (-2134.979) [-2132.907] (-2133.095) (-2135.658) -- 0:00:39
824500 -- [-2133.701] (-2133.642) (-2135.200) (-2133.453) * [-2134.175] (-2141.464) (-2132.575) (-2137.017) -- 0:00:39
825000 -- (-2133.081) (-2132.621) (-2140.844) [-2130.066] * (-2134.381) (-2139.842) [-2130.713] (-2134.755) -- 0:00:39
Average standard deviation of split frequencies: 0.005517
825500 -- (-2135.016) [-2133.586] (-2133.529) (-2144.704) * (-2143.166) (-2140.078) [-2131.784] (-2131.893) -- 0:00:38
826000 -- (-2135.409) (-2136.632) (-2131.503) [-2134.452] * (-2134.093) (-2135.839) (-2132.336) [-2135.538] -- 0:00:38
826500 -- (-2132.461) [-2134.677] (-2133.229) (-2139.906) * (-2140.409) (-2133.808) (-2132.459) [-2132.754] -- 0:00:38
827000 -- (-2140.001) (-2132.539) [-2138.901] (-2132.027) * [-2136.061] (-2140.288) (-2132.051) (-2141.481) -- 0:00:38
827500 -- (-2136.336) (-2135.447) [-2134.065] (-2133.620) * [-2134.268] (-2135.734) (-2138.488) (-2137.358) -- 0:00:38
828000 -- (-2133.713) (-2134.689) (-2137.958) [-2134.278] * (-2134.919) (-2137.671) (-2134.811) [-2135.492] -- 0:00:38
828500 -- (-2137.504) (-2136.821) (-2140.640) [-2131.582] * (-2131.853) (-2136.487) (-2135.243) [-2133.862] -- 0:00:38
829000 -- [-2134.906] (-2135.720) (-2140.440) (-2134.930) * (-2144.705) (-2140.366) (-2136.160) [-2138.359] -- 0:00:38
829500 -- [-2132.054] (-2138.845) (-2143.349) (-2138.400) * [-2142.764] (-2135.748) (-2134.515) (-2134.903) -- 0:00:38
830000 -- [-2132.482] (-2136.490) (-2136.380) (-2134.198) * (-2134.624) (-2135.559) (-2139.356) [-2131.621] -- 0:00:37
Average standard deviation of split frequencies: 0.006243
830500 -- [-2132.868] (-2131.954) (-2136.350) (-2134.778) * [-2132.865] (-2134.342) (-2131.277) (-2137.313) -- 0:00:37
831000 -- (-2136.882) (-2133.700) [-2132.334] (-2134.560) * [-2135.679] (-2137.092) (-2137.523) (-2140.904) -- 0:00:37
831500 -- [-2137.140] (-2135.420) (-2132.456) (-2131.520) * (-2142.430) [-2134.853] (-2136.010) (-2140.857) -- 0:00:37
832000 -- (-2137.573) (-2136.516) (-2132.883) [-2133.014] * (-2139.382) (-2130.770) [-2134.133] (-2133.628) -- 0:00:37
832500 -- [-2136.425] (-2136.598) (-2139.201) (-2135.289) * (-2140.778) (-2136.196) (-2135.495) [-2132.024] -- 0:00:37
833000 -- (-2136.323) (-2134.730) [-2133.901] (-2139.534) * (-2140.363) (-2136.440) (-2139.532) [-2132.996] -- 0:00:37
833500 -- (-2136.069) (-2137.837) (-2132.505) [-2139.289] * (-2140.140) [-2129.986] (-2136.786) (-2138.537) -- 0:00:37
834000 -- [-2134.740] (-2132.508) (-2135.929) (-2137.928) * (-2141.673) [-2133.133] (-2134.946) (-2138.051) -- 0:00:37
834500 -- (-2137.546) [-2132.007] (-2136.234) (-2136.425) * (-2133.610) (-2138.886) (-2136.434) [-2133.332] -- 0:00:36
835000 -- (-2131.522) (-2139.668) [-2136.083] (-2143.814) * (-2133.000) (-2135.708) [-2130.296] (-2134.957) -- 0:00:36
Average standard deviation of split frequencies: 0.006203
835500 -- (-2141.703) (-2135.514) [-2135.202] (-2136.506) * (-2133.982) [-2131.503] (-2139.623) (-2136.952) -- 0:00:36
836000 -- (-2137.856) (-2137.334) (-2132.470) [-2132.890] * [-2131.337] (-2135.286) (-2136.900) (-2140.435) -- 0:00:36
836500 -- (-2136.217) (-2134.765) [-2132.028] (-2135.425) * [-2129.562] (-2139.896) (-2141.741) (-2138.983) -- 0:00:36
837000 -- (-2134.697) (-2139.369) (-2148.351) [-2131.849] * [-2137.432] (-2138.155) (-2135.991) (-2133.792) -- 0:00:36
837500 -- (-2136.573) [-2132.455] (-2135.818) (-2138.709) * (-2142.136) [-2134.904] (-2138.789) (-2138.857) -- 0:00:36
838000 -- [-2135.531] (-2133.783) (-2142.891) (-2132.499) * (-2138.939) [-2139.506] (-2133.275) (-2139.046) -- 0:00:36
838500 -- (-2139.963) [-2137.462] (-2144.199) (-2134.668) * (-2147.194) (-2134.024) [-2132.651] (-2142.926) -- 0:00:36
839000 -- (-2138.097) (-2131.275) (-2147.216) [-2136.866] * (-2137.234) [-2129.876] (-2134.185) (-2144.192) -- 0:00:35
839500 -- (-2137.506) (-2133.131) (-2138.338) [-2132.437] * (-2139.875) (-2141.047) [-2130.651] (-2133.603) -- 0:00:35
840000 -- [-2137.249] (-2131.780) (-2140.032) (-2134.650) * [-2138.258] (-2138.267) (-2140.308) (-2132.129) -- 0:00:35
Average standard deviation of split frequencies: 0.006542
840500 -- (-2142.443) (-2132.103) (-2133.578) [-2130.648] * (-2141.107) (-2135.804) [-2135.872] (-2130.562) -- 0:00:35
841000 -- [-2132.692] (-2137.133) (-2137.104) (-2135.310) * (-2134.244) (-2136.285) [-2132.615] (-2132.191) -- 0:00:35
841500 -- (-2133.031) (-2142.577) [-2134.011] (-2132.944) * (-2138.992) (-2136.669) (-2131.281) [-2131.678] -- 0:00:35
842000 -- (-2136.704) (-2137.085) [-2140.700] (-2132.957) * (-2136.967) [-2141.225] (-2131.633) (-2132.148) -- 0:00:35
842500 -- [-2135.237] (-2134.523) (-2132.044) (-2133.952) * (-2134.051) [-2136.671] (-2133.612) (-2133.205) -- 0:00:35
843000 -- (-2134.046) (-2134.242) [-2131.759] (-2145.531) * (-2136.438) (-2133.563) [-2131.212] (-2142.771) -- 0:00:35
843500 -- (-2131.740) [-2139.880] (-2133.580) (-2136.132) * (-2133.171) (-2133.192) [-2136.893] (-2140.334) -- 0:00:34
844000 -- [-2132.786] (-2135.926) (-2140.290) (-2136.320) * (-2140.915) (-2131.686) (-2134.152) [-2132.888] -- 0:00:34
844500 -- (-2136.873) (-2131.748) [-2133.588] (-2133.582) * (-2137.538) [-2134.584] (-2135.480) (-2134.780) -- 0:00:34
845000 -- (-2135.978) [-2137.493] (-2136.934) (-2136.077) * (-2137.946) [-2136.609] (-2143.922) (-2132.571) -- 0:00:34
Average standard deviation of split frequencies: 0.005944
845500 -- (-2137.640) (-2129.946) (-2137.699) [-2141.580] * (-2135.575) (-2140.078) (-2134.909) [-2133.452] -- 0:00:34
846000 -- [-2142.926] (-2131.445) (-2141.196) (-2138.243) * [-2136.325] (-2143.660) (-2134.734) (-2138.549) -- 0:00:34
846500 -- [-2138.978] (-2138.752) (-2139.650) (-2139.523) * (-2143.412) (-2137.829) (-2139.704) [-2142.243] -- 0:00:34
847000 -- (-2136.711) (-2130.844) (-2135.166) [-2139.744] * (-2138.299) [-2132.534] (-2133.401) (-2137.519) -- 0:00:34
847500 -- [-2137.014] (-2130.093) (-2135.574) (-2135.831) * (-2135.304) (-2132.632) [-2139.659] (-2140.548) -- 0:00:34
848000 -- (-2137.749) (-2138.982) [-2134.861] (-2138.897) * (-2132.633) (-2130.151) [-2134.119] (-2147.497) -- 0:00:33
848500 -- [-2131.361] (-2132.091) (-2135.669) (-2148.198) * (-2142.557) (-2134.933) (-2132.717) [-2135.323] -- 0:00:33
849000 -- (-2137.854) (-2132.129) (-2131.722) [-2133.087] * [-2145.553] (-2133.581) (-2133.272) (-2136.190) -- 0:00:33
849500 -- [-2135.077] (-2134.141) (-2134.422) (-2130.995) * (-2137.768) [-2131.169] (-2130.762) (-2134.032) -- 0:00:33
850000 -- (-2136.065) [-2134.687] (-2134.699) (-2140.397) * (-2136.604) (-2135.442) [-2132.923] (-2135.701) -- 0:00:33
Average standard deviation of split frequencies: 0.005726
850500 -- (-2137.864) (-2135.276) (-2136.729) [-2136.059] * [-2134.101] (-2135.177) (-2131.106) (-2135.396) -- 0:00:33
851000 -- (-2134.113) [-2135.298] (-2136.448) (-2131.645) * (-2136.880) [-2129.312] (-2131.330) (-2136.199) -- 0:00:33
851500 -- [-2136.041] (-2135.685) (-2140.021) (-2136.404) * [-2131.482] (-2130.931) (-2133.395) (-2141.645) -- 0:00:33
852000 -- [-2132.792] (-2136.162) (-2139.552) (-2136.724) * (-2138.422) [-2137.063] (-2136.907) (-2134.949) -- 0:00:33
852500 -- (-2138.628) [-2134.359] (-2137.392) (-2139.626) * (-2134.042) [-2131.905] (-2138.179) (-2139.752) -- 0:00:32
853000 -- [-2138.833] (-2140.610) (-2139.241) (-2139.261) * (-2134.037) (-2133.071) [-2138.433] (-2136.269) -- 0:00:32
853500 -- (-2139.269) [-2136.431] (-2138.736) (-2138.186) * (-2134.712) [-2133.410] (-2137.168) (-2139.275) -- 0:00:32
854000 -- [-2137.282] (-2138.839) (-2135.935) (-2137.389) * [-2133.542] (-2135.385) (-2139.125) (-2133.187) -- 0:00:32
854500 -- (-2140.595) (-2133.868) [-2134.498] (-2138.632) * (-2133.947) [-2141.456] (-2136.968) (-2140.352) -- 0:00:32
855000 -- [-2139.800] (-2138.521) (-2132.600) (-2146.619) * [-2129.306] (-2136.664) (-2140.815) (-2138.654) -- 0:00:32
Average standard deviation of split frequencies: 0.005323
855500 -- (-2135.809) (-2133.908) [-2134.626] (-2142.447) * (-2142.020) (-2135.969) (-2135.781) [-2131.030] -- 0:00:32
856000 -- (-2138.252) (-2132.425) [-2134.043] (-2135.933) * [-2133.312] (-2138.841) (-2137.689) (-2128.831) -- 0:00:32
856500 -- [-2133.230] (-2131.660) (-2136.816) (-2132.667) * (-2138.476) (-2135.555) [-2129.978] (-2134.031) -- 0:00:32
857000 -- (-2134.254) (-2136.523) [-2133.039] (-2131.543) * (-2139.654) [-2138.832] (-2130.209) (-2138.681) -- 0:00:31
857500 -- (-2143.899) (-2134.552) [-2134.675] (-2140.181) * (-2136.451) [-2134.436] (-2138.362) (-2133.314) -- 0:00:31
858000 -- [-2133.540] (-2133.800) (-2134.459) (-2134.796) * (-2142.339) (-2135.522) [-2137.538] (-2129.981) -- 0:00:31
858500 -- (-2137.346) (-2135.235) [-2136.925] (-2136.034) * (-2135.641) [-2132.053] (-2136.608) (-2132.394) -- 0:00:31
859000 -- (-2144.890) [-2131.383] (-2137.694) (-2133.608) * (-2131.942) [-2129.536] (-2138.810) (-2133.622) -- 0:00:31
859500 -- [-2139.348] (-2139.037) (-2134.816) (-2138.311) * (-2134.451) [-2130.351] (-2137.032) (-2137.673) -- 0:00:31
860000 -- (-2135.675) [-2132.332] (-2134.280) (-2135.760) * (-2138.690) [-2136.670] (-2136.983) (-2138.153) -- 0:00:31
Average standard deviation of split frequencies: 0.006025
860500 -- [-2135.180] (-2138.657) (-2136.095) (-2131.014) * (-2136.158) (-2146.542) [-2136.140] (-2140.640) -- 0:00:31
861000 -- (-2135.365) (-2133.242) (-2135.895) [-2135.089] * (-2138.001) [-2134.668] (-2132.990) (-2139.351) -- 0:00:30
861500 -- (-2135.642) [-2141.488] (-2139.131) (-2138.513) * (-2141.573) [-2134.507] (-2135.359) (-2137.535) -- 0:00:30
862000 -- (-2131.077) (-2135.648) (-2134.362) [-2138.131] * (-2139.128) (-2137.292) (-2135.504) [-2136.932] -- 0:00:30
862500 -- (-2129.809) (-2135.381) (-2139.929) [-2143.079] * (-2135.701) (-2135.584) [-2138.354] (-2140.486) -- 0:00:30
863000 -- [-2133.064] (-2132.842) (-2143.177) (-2133.324) * (-2135.173) (-2141.272) [-2131.531] (-2137.077) -- 0:00:30
863500 -- (-2133.174) (-2138.485) (-2134.097) [-2137.224] * (-2132.923) (-2144.924) [-2131.838] (-2137.072) -- 0:00:30
864000 -- (-2138.227) (-2134.702) (-2135.699) [-2135.345] * [-2137.369] (-2140.693) (-2135.613) (-2136.848) -- 0:00:30
864500 -- [-2135.467] (-2135.883) (-2136.354) (-2133.779) * [-2133.935] (-2135.523) (-2131.625) (-2134.583) -- 0:00:30
865000 -- (-2136.200) (-2137.589) (-2137.264) [-2138.562] * [-2137.688] (-2132.686) (-2133.399) (-2132.789) -- 0:00:30
Average standard deviation of split frequencies: 0.007439
865500 -- (-2133.290) (-2143.353) (-2138.821) [-2135.648] * (-2136.411) (-2134.306) [-2134.794] (-2135.545) -- 0:00:29
866000 -- (-2133.446) (-2135.242) [-2136.077] (-2135.734) * (-2137.587) (-2138.230) (-2130.062) [-2133.095] -- 0:00:29
866500 -- (-2138.346) [-2135.460] (-2132.358) (-2132.202) * (-2133.998) [-2133.328] (-2130.625) (-2135.190) -- 0:00:29
867000 -- (-2134.621) (-2140.361) [-2136.264] (-2138.322) * (-2132.556) [-2134.451] (-2135.804) (-2143.297) -- 0:00:29
867500 -- [-2133.670] (-2134.677) (-2137.107) (-2135.969) * (-2131.779) (-2132.444) (-2136.537) [-2139.609] -- 0:00:29
868000 -- (-2136.196) (-2134.598) [-2136.864] (-2134.401) * [-2137.206] (-2130.572) (-2132.820) (-2132.838) -- 0:00:29
868500 -- (-2144.952) (-2135.047) [-2135.912] (-2131.989) * [-2139.262] (-2134.940) (-2128.819) (-2137.412) -- 0:00:29
869000 -- [-2131.731] (-2138.934) (-2134.202) (-2131.833) * (-2133.678) (-2135.322) (-2129.376) [-2132.618] -- 0:00:29
869500 -- [-2131.171] (-2140.186) (-2138.894) (-2135.081) * (-2133.784) (-2132.069) [-2137.847] (-2138.221) -- 0:00:29
870000 -- (-2135.216) [-2136.148] (-2131.127) (-2137.180) * [-2132.876] (-2138.054) (-2134.783) (-2134.552) -- 0:00:28
Average standard deviation of split frequencies: 0.007039
870500 -- [-2133.164] (-2138.232) (-2136.916) (-2144.811) * (-2134.676) [-2135.807] (-2132.482) (-2137.512) -- 0:00:28
871000 -- (-2133.842) (-2133.316) [-2132.609] (-2135.444) * [-2138.677] (-2139.115) (-2134.756) (-2140.509) -- 0:00:28
871500 -- [-2133.930] (-2133.341) (-2135.737) (-2136.515) * [-2139.455] (-2140.885) (-2130.449) (-2133.186) -- 0:00:28
872000 -- (-2133.881) [-2138.870] (-2138.210) (-2134.661) * [-2134.553] (-2133.737) (-2136.081) (-2136.261) -- 0:00:28
872500 -- [-2129.236] (-2135.027) (-2138.385) (-2131.170) * [-2132.821] (-2137.069) (-2142.117) (-2130.590) -- 0:00:28
873000 -- [-2132.216] (-2133.631) (-2137.954) (-2135.385) * (-2134.352) (-2133.703) (-2138.337) [-2128.955] -- 0:00:28
873500 -- (-2137.772) (-2138.212) (-2134.430) [-2129.921] * (-2135.878) [-2132.369] (-2130.630) (-2130.903) -- 0:00:28
874000 -- (-2132.574) (-2136.562) (-2139.820) [-2132.680] * [-2139.944] (-2140.785) (-2132.057) (-2130.716) -- 0:00:28
874500 -- (-2135.092) [-2133.295] (-2138.933) (-2133.359) * (-2138.039) (-2130.167) (-2139.248) [-2141.222] -- 0:00:27
875000 -- (-2136.818) (-2137.590) [-2132.497] (-2143.796) * (-2143.907) (-2136.026) [-2134.516] (-2133.177) -- 0:00:27
Average standard deviation of split frequencies: 0.006637
875500 -- (-2137.071) [-2132.135] (-2134.611) (-2136.945) * (-2142.841) (-2134.821) [-2134.696] (-2135.875) -- 0:00:27
876000 -- (-2136.056) (-2131.617) (-2139.069) [-2133.262] * (-2136.363) (-2130.541) [-2137.178] (-2139.370) -- 0:00:27
876500 -- [-2133.525] (-2136.248) (-2133.319) (-2133.805) * (-2136.091) (-2142.616) [-2133.912] (-2137.687) -- 0:00:27
877000 -- (-2136.154) (-2139.388) [-2132.529] (-2133.382) * [-2135.939] (-2138.731) (-2133.564) (-2132.192) -- 0:00:27
877500 -- (-2133.201) (-2141.177) [-2129.882] (-2134.779) * (-2133.314) (-2135.129) (-2136.859) [-2131.270] -- 0:00:27
878000 -- (-2132.829) [-2137.769] (-2134.476) (-2132.772) * (-2139.564) (-2131.891) [-2133.807] (-2140.238) -- 0:00:27
878500 -- (-2132.575) (-2134.134) (-2134.190) [-2136.856] * (-2138.005) (-2135.729) (-2134.698) [-2131.547] -- 0:00:27
879000 -- (-2137.531) [-2135.739] (-2140.095) (-2141.760) * [-2137.132] (-2138.305) (-2131.939) (-2132.397) -- 0:00:26
879500 -- (-2134.117) (-2131.170) [-2142.814] (-2134.622) * [-2137.012] (-2132.468) (-2136.007) (-2135.627) -- 0:00:26
880000 -- [-2135.683] (-2132.426) (-2135.680) (-2136.236) * (-2140.406) [-2130.926] (-2131.650) (-2134.127) -- 0:00:26
Average standard deviation of split frequencies: 0.006959
880500 -- [-2132.222] (-2132.872) (-2134.756) (-2136.437) * (-2134.417) (-2136.746) [-2134.924] (-2131.443) -- 0:00:26
881000 -- (-2133.099) [-2135.575] (-2135.280) (-2131.469) * (-2134.517) [-2133.780] (-2135.281) (-2134.841) -- 0:00:26
881500 -- [-2136.838] (-2134.011) (-2133.516) (-2141.606) * (-2138.715) (-2134.882) [-2135.145] (-2138.742) -- 0:00:26
882000 -- (-2129.964) (-2135.133) [-2133.232] (-2131.951) * (-2135.894) (-2134.740) [-2133.901] (-2135.367) -- 0:00:26
882500 -- (-2132.808) [-2134.409] (-2133.839) (-2133.206) * [-2135.186] (-2135.756) (-2131.375) (-2130.319) -- 0:00:26
883000 -- (-2137.960) (-2135.678) (-2134.115) [-2136.401] * (-2138.332) (-2133.083) (-2135.011) [-2133.272] -- 0:00:26
883500 -- [-2134.349] (-2138.297) (-2138.354) (-2138.988) * (-2137.306) (-2133.823) (-2140.504) [-2133.181] -- 0:00:25
884000 -- (-2136.202) (-2141.919) [-2137.977] (-2139.005) * [-2134.808] (-2131.720) (-2137.129) (-2135.801) -- 0:00:25
884500 -- (-2137.254) (-2135.402) (-2137.120) [-2133.916] * (-2137.592) [-2134.980] (-2134.500) (-2141.420) -- 0:00:25
885000 -- (-2133.768) [-2135.250] (-2134.529) (-2138.920) * (-2135.698) (-2142.168) (-2138.739) [-2136.025] -- 0:00:25
Average standard deviation of split frequencies: 0.005143
885500 -- (-2135.375) [-2131.106] (-2135.793) (-2137.107) * (-2131.729) [-2139.099] (-2134.967) (-2135.758) -- 0:00:25
886000 -- (-2137.815) (-2134.479) (-2138.625) [-2135.784] * (-2134.165) (-2139.274) (-2142.071) [-2140.401] -- 0:00:25
886500 -- (-2138.649) [-2134.105] (-2135.721) (-2140.549) * (-2137.769) (-2131.365) [-2137.700] (-2137.149) -- 0:00:25
887000 -- (-2135.608) [-2132.680] (-2138.036) (-2137.015) * (-2138.642) [-2130.139] (-2142.296) (-2135.446) -- 0:00:25
887500 -- (-2133.032) [-2134.005] (-2134.245) (-2138.822) * (-2138.788) (-2134.420) (-2138.520) [-2130.623] -- 0:00:25
888000 -- (-2137.368) [-2132.398] (-2136.132) (-2137.364) * [-2140.820] (-2137.010) (-2138.266) (-2128.045) -- 0:00:24
888500 -- (-2137.312) [-2132.868] (-2136.026) (-2138.060) * (-2136.997) (-2138.387) (-2136.364) [-2135.444] -- 0:00:24
889000 -- (-2136.455) (-2133.272) (-2132.515) [-2135.748] * (-2139.714) (-2134.094) [-2135.996] (-2133.370) -- 0:00:24
889500 -- (-2134.455) (-2133.687) [-2132.199] (-2133.100) * (-2130.583) [-2133.908] (-2134.581) (-2134.175) -- 0:00:24
890000 -- (-2134.969) [-2136.598] (-2141.236) (-2139.583) * (-2138.252) [-2132.678] (-2130.020) (-2138.379) -- 0:00:24
Average standard deviation of split frequencies: 0.004587
890500 -- (-2132.838) [-2131.163] (-2135.258) (-2141.091) * [-2137.565] (-2132.723) (-2130.180) (-2138.963) -- 0:00:24
891000 -- (-2134.438) (-2137.579) [-2130.576] (-2137.871) * (-2138.893) (-2135.602) [-2136.497] (-2137.452) -- 0:00:24
891500 -- (-2130.850) (-2138.599) (-2137.360) [-2141.761] * (-2139.089) (-2137.801) (-2132.137) [-2130.229] -- 0:00:24
892000 -- (-2132.761) [-2132.443] (-2134.480) (-2137.248) * (-2137.244) [-2135.238] (-2132.545) (-2145.952) -- 0:00:24
892500 -- (-2133.893) (-2133.281) [-2136.685] (-2135.079) * (-2135.527) (-2141.734) (-2140.642) [-2137.037] -- 0:00:23
893000 -- (-2136.884) [-2132.236] (-2135.626) (-2136.614) * [-2135.627] (-2141.994) (-2137.528) (-2137.677) -- 0:00:23
893500 -- (-2134.534) (-2141.059) [-2136.552] (-2134.881) * (-2136.702) [-2134.723] (-2137.246) (-2137.330) -- 0:00:23
894000 -- [-2139.880] (-2135.563) (-2138.086) (-2130.084) * (-2136.685) (-2136.070) (-2131.275) [-2131.715] -- 0:00:23
894500 -- (-2140.719) [-2134.105] (-2137.204) (-2129.698) * (-2134.930) (-2140.604) [-2129.325] (-2140.086) -- 0:00:23
895000 -- [-2141.585] (-2138.640) (-2139.549) (-2132.694) * (-2137.998) [-2131.154] (-2128.568) (-2139.842) -- 0:00:23
Average standard deviation of split frequencies: 0.005261
895500 -- (-2147.470) (-2131.292) (-2140.892) [-2132.435] * (-2134.001) (-2141.542) (-2132.339) [-2137.813] -- 0:00:23
896000 -- (-2137.235) (-2137.091) [-2139.113] (-2135.456) * [-2136.568] (-2140.273) (-2133.633) (-2135.493) -- 0:00:23
896500 -- (-2135.965) (-2136.225) [-2137.237] (-2132.854) * (-2135.267) (-2139.500) [-2134.654] (-2132.002) -- 0:00:23
897000 -- (-2132.721) [-2130.963] (-2136.028) (-2131.127) * [-2133.300] (-2134.745) (-2142.414) (-2136.507) -- 0:00:22
897500 -- [-2129.247] (-2136.943) (-2145.690) (-2132.749) * [-2137.530] (-2132.550) (-2135.777) (-2136.811) -- 0:00:22
898000 -- [-2132.204] (-2143.574) (-2146.472) (-2136.481) * (-2134.166) (-2136.530) (-2134.634) [-2135.596] -- 0:00:22
898500 -- [-2138.626] (-2136.080) (-2135.087) (-2135.215) * (-2134.617) (-2138.034) [-2133.866] (-2136.258) -- 0:00:22
899000 -- [-2135.128] (-2140.427) (-2135.089) (-2130.969) * (-2136.253) (-2134.108) (-2135.990) [-2135.861] -- 0:00:22
899500 -- (-2132.248) (-2145.467) (-2134.806) [-2132.719] * (-2132.759) (-2136.078) [-2130.481] (-2135.929) -- 0:00:22
900000 -- (-2133.736) (-2139.612) [-2135.140] (-2138.909) * [-2132.468] (-2138.056) (-2134.152) (-2143.326) -- 0:00:22
Average standard deviation of split frequencies: 0.004885
900500 -- (-2134.479) [-2138.447] (-2138.901) (-2135.702) * (-2138.803) [-2136.980] (-2137.187) (-2145.813) -- 0:00:22
901000 -- (-2136.041) (-2133.041) (-2133.067) [-2134.648] * (-2135.464) [-2136.426] (-2134.813) (-2141.159) -- 0:00:22
901500 -- (-2138.654) [-2131.841] (-2136.772) (-2135.195) * (-2137.963) (-2131.812) (-2140.093) [-2132.323] -- 0:00:21
902000 -- (-2137.239) [-2138.949] (-2141.006) (-2140.892) * [-2135.983] (-2134.656) (-2140.003) (-2141.980) -- 0:00:21
902500 -- (-2136.199) (-2137.608) (-2133.847) [-2139.298] * (-2142.699) [-2134.506] (-2138.764) (-2133.907) -- 0:00:21
903000 -- (-2136.520) (-2141.293) (-2141.483) [-2133.231] * (-2137.307) (-2146.843) (-2131.514) [-2131.982] -- 0:00:21
903500 -- (-2136.632) (-2142.867) (-2144.084) [-2135.134] * [-2137.936] (-2138.427) (-2133.638) (-2130.785) -- 0:00:21
904000 -- (-2136.031) (-2134.658) (-2145.851) [-2131.160] * [-2137.344] (-2141.087) (-2134.735) (-2130.583) -- 0:00:21
904500 -- (-2139.557) (-2133.371) [-2136.544] (-2133.298) * [-2134.146] (-2139.630) (-2137.428) (-2135.561) -- 0:00:21
905000 -- (-2146.966) [-2133.602] (-2136.992) (-2130.668) * [-2137.378] (-2142.415) (-2141.391) (-2134.616) -- 0:00:21
Average standard deviation of split frequencies: 0.005203
905500 -- (-2141.145) (-2134.009) [-2142.431] (-2139.609) * (-2140.180) [-2129.332] (-2134.165) (-2136.294) -- 0:00:21
906000 -- (-2139.901) (-2130.248) (-2138.523) [-2132.006] * (-2138.211) [-2132.043] (-2140.847) (-2137.312) -- 0:00:20
906500 -- (-2135.882) [-2137.722] (-2140.216) (-2133.260) * (-2135.746) (-2132.739) [-2134.588] (-2133.112) -- 0:00:20
907000 -- [-2136.845] (-2136.733) (-2138.237) (-2134.890) * (-2136.233) [-2136.045] (-2133.910) (-2134.029) -- 0:00:20
907500 -- (-2135.389) (-2134.537) [-2133.215] (-2141.386) * (-2135.730) [-2134.378] (-2131.792) (-2133.582) -- 0:00:20
908000 -- (-2133.009) (-2138.833) [-2130.899] (-2140.422) * [-2132.468] (-2134.547) (-2133.678) (-2132.316) -- 0:00:20
908500 -- [-2132.067] (-2137.198) (-2137.437) (-2140.419) * (-2141.273) [-2132.995] (-2135.179) (-2134.305) -- 0:00:20
909000 -- (-2139.377) (-2138.158) [-2134.122] (-2137.875) * (-2135.032) (-2136.513) [-2133.159] (-2139.037) -- 0:00:20
909500 -- (-2133.688) (-2131.743) (-2139.754) [-2136.175] * [-2132.777] (-2134.855) (-2132.791) (-2133.573) -- 0:00:20
910000 -- (-2136.696) (-2130.137) [-2132.508] (-2137.893) * [-2139.309] (-2140.118) (-2137.062) (-2135.314) -- 0:00:20
Average standard deviation of split frequencies: 0.006212
910500 -- (-2138.017) (-2132.889) (-2134.241) [-2135.520] * (-2133.608) (-2135.188) (-2136.782) [-2135.836] -- 0:00:19
911000 -- (-2134.157) (-2139.888) (-2139.883) [-2132.410] * (-2131.979) (-2135.415) (-2136.520) [-2137.864] -- 0:00:19
911500 -- (-2139.209) (-2136.741) [-2138.287] (-2136.202) * [-2133.389] (-2138.891) (-2136.742) (-2135.887) -- 0:00:19
912000 -- (-2135.319) (-2130.442) (-2135.055) [-2135.228] * [-2133.301] (-2134.280) (-2140.099) (-2134.122) -- 0:00:19
912500 -- (-2139.895) (-2135.694) (-2137.041) [-2137.116] * (-2133.061) (-2134.520) [-2134.000] (-2134.684) -- 0:00:19
913000 -- [-2132.526] (-2132.090) (-2132.691) (-2132.625) * (-2136.030) (-2137.220) [-2137.369] (-2132.844) -- 0:00:19
913500 -- (-2132.598) (-2131.557) [-2136.354] (-2133.610) * [-2132.000] (-2134.502) (-2136.522) (-2137.599) -- 0:00:19
914000 -- [-2130.865] (-2139.328) (-2130.412) (-2136.875) * [-2131.378] (-2133.972) (-2141.828) (-2136.199) -- 0:00:19
914500 -- [-2135.786] (-2135.891) (-2136.842) (-2134.253) * (-2140.755) (-2133.639) (-2140.422) [-2138.341] -- 0:00:19
915000 -- [-2138.869] (-2130.987) (-2130.586) (-2136.592) * (-2134.969) (-2139.107) (-2137.272) [-2133.711] -- 0:00:18
Average standard deviation of split frequencies: 0.004803
915500 -- [-2136.009] (-2143.682) (-2132.930) (-2130.378) * (-2140.871) [-2135.641] (-2137.495) (-2140.577) -- 0:00:18
916000 -- (-2134.246) (-2132.222) (-2135.118) [-2131.997] * (-2135.531) (-2136.825) [-2135.762] (-2140.333) -- 0:00:18
916500 -- (-2136.477) (-2136.350) (-2140.671) [-2130.973] * (-2137.166) [-2132.066] (-2135.107) (-2137.456) -- 0:00:18
917000 -- (-2134.237) [-2131.317] (-2132.820) (-2134.466) * (-2134.963) [-2132.186] (-2134.718) (-2136.805) -- 0:00:18
917500 -- (-2132.645) (-2134.038) [-2137.356] (-2134.965) * (-2142.750) (-2138.182) (-2131.961) [-2130.188] -- 0:00:18
918000 -- (-2133.813) (-2137.776) (-2137.327) [-2135.076] * [-2136.843] (-2135.288) (-2133.987) (-2139.148) -- 0:00:18
918500 -- (-2132.778) (-2136.304) [-2134.915] (-2141.910) * (-2133.774) (-2137.940) [-2134.420] (-2135.308) -- 0:00:18
919000 -- (-2137.000) [-2134.053] (-2132.065) (-2140.926) * (-2133.525) [-2135.083] (-2134.116) (-2138.519) -- 0:00:18
919500 -- (-2142.682) (-2131.690) (-2130.314) [-2139.855] * (-2137.971) [-2141.687] (-2138.469) (-2131.436) -- 0:00:17
920000 -- (-2133.626) (-2132.392) (-2135.025) [-2132.344] * (-2140.428) (-2134.318) (-2134.998) [-2133.955] -- 0:00:17
Average standard deviation of split frequencies: 0.004438
920500 -- (-2133.394) [-2131.483] (-2140.701) (-2133.726) * [-2134.328] (-2131.651) (-2130.330) (-2135.265) -- 0:00:17
921000 -- (-2140.063) (-2134.595) (-2132.233) [-2134.489] * [-2134.785] (-2136.788) (-2133.447) (-2134.912) -- 0:00:17
921500 -- (-2137.629) [-2136.768] (-2130.633) (-2132.934) * (-2135.937) (-2139.364) [-2135.993] (-2137.153) -- 0:00:17
922000 -- (-2138.074) [-2134.376] (-2135.417) (-2136.356) * (-2139.115) [-2135.574] (-2134.257) (-2140.863) -- 0:00:17
922500 -- [-2136.085] (-2133.485) (-2140.746) (-2137.395) * (-2136.491) (-2135.922) (-2134.934) [-2137.018] -- 0:00:17
923000 -- [-2137.120] (-2131.800) (-2149.667) (-2139.038) * (-2139.385) (-2134.913) (-2140.178) [-2133.469] -- 0:00:17
923500 -- [-2135.786] (-2137.044) (-2153.251) (-2136.844) * (-2137.943) (-2135.606) (-2138.693) [-2139.104] -- 0:00:17
924000 -- (-2137.007) (-2133.882) (-2142.207) [-2136.889] * [-2132.403] (-2134.938) (-2139.678) (-2130.966) -- 0:00:16
924500 -- (-2135.482) (-2136.088) (-2137.817) [-2136.264] * (-2135.572) (-2135.459) (-2134.338) [-2135.138] -- 0:00:16
925000 -- (-2139.607) (-2136.466) (-2138.114) [-2132.811] * (-2133.796) (-2135.224) [-2133.611] (-2131.497) -- 0:00:16
Average standard deviation of split frequencies: 0.004751
925500 -- (-2136.644) (-2137.693) (-2133.551) [-2135.618] * (-2134.644) [-2137.183] (-2136.609) (-2134.614) -- 0:00:16
926000 -- (-2140.260) (-2139.582) (-2131.032) [-2132.591] * (-2138.851) [-2133.179] (-2137.265) (-2135.964) -- 0:00:16
926500 -- (-2138.045) (-2136.342) (-2132.423) [-2133.563] * (-2133.057) [-2136.304] (-2134.848) (-2132.916) -- 0:00:16
927000 -- [-2134.751] (-2136.484) (-2130.342) (-2131.337) * (-2134.979) [-2133.439] (-2140.270) (-2138.079) -- 0:00:16
927500 -- (-2134.478) (-2136.398) (-2137.331) [-2138.204] * (-2138.006) (-2131.816) [-2134.473] (-2138.830) -- 0:00:16
928000 -- [-2133.813] (-2137.704) (-2137.182) (-2137.676) * (-2137.148) [-2132.166] (-2137.892) (-2140.247) -- 0:00:16
928500 -- [-2133.637] (-2142.929) (-2134.950) (-2137.958) * (-2153.341) (-2136.122) (-2140.895) [-2137.062] -- 0:00:15
929000 -- (-2133.441) (-2140.084) (-2136.376) [-2135.003] * (-2150.479) [-2132.602] (-2135.459) (-2134.337) -- 0:00:15
929500 -- [-2134.235] (-2141.305) (-2134.038) (-2139.436) * (-2152.198) (-2138.976) (-2133.309) [-2133.154] -- 0:00:15
930000 -- (-2134.774) (-2148.236) [-2140.348] (-2136.649) * (-2138.880) [-2138.576] (-2137.580) (-2139.364) -- 0:00:15
Average standard deviation of split frequencies: 0.004728
930500 -- [-2136.525] (-2137.553) (-2132.450) (-2137.086) * (-2135.021) (-2137.809) (-2133.549) [-2136.731] -- 0:00:15
931000 -- [-2139.700] (-2139.680) (-2133.786) (-2138.303) * [-2134.958] (-2138.701) (-2135.034) (-2137.478) -- 0:00:15
931500 -- (-2135.864) (-2146.563) (-2133.929) [-2137.770] * [-2132.233] (-2132.168) (-2133.092) (-2140.145) -- 0:00:15
932000 -- [-2134.298] (-2138.790) (-2138.187) (-2135.751) * (-2136.633) (-2131.986) [-2132.263] (-2134.938) -- 0:00:15
932500 -- (-2132.292) [-2134.144] (-2135.416) (-2139.279) * [-2133.507] (-2139.762) (-2142.330) (-2137.820) -- 0:00:15
933000 -- [-2137.507] (-2131.383) (-2131.781) (-2136.363) * (-2133.621) (-2136.144) (-2131.831) [-2134.584] -- 0:00:14
933500 -- (-2134.777) [-2135.192] (-2138.978) (-2136.208) * [-2132.535] (-2132.726) (-2139.099) (-2137.609) -- 0:00:14
934000 -- (-2134.094) [-2135.204] (-2139.866) (-2134.424) * [-2134.398] (-2135.761) (-2130.632) (-2139.691) -- 0:00:14
934500 -- (-2133.207) [-2132.746] (-2138.267) (-2131.004) * (-2132.227) [-2130.380] (-2135.735) (-2138.238) -- 0:00:14
935000 -- (-2136.673) (-2135.192) (-2139.120) [-2135.989] * (-2131.238) (-2138.505) [-2138.241] (-2135.228) -- 0:00:14
Average standard deviation of split frequencies: 0.003358
935500 -- (-2134.207) [-2133.960] (-2135.879) (-2134.215) * (-2135.331) [-2134.532] (-2134.754) (-2131.694) -- 0:00:14
936000 -- (-2136.481) (-2133.324) (-2139.282) [-2138.774] * (-2144.651) (-2133.737) (-2134.472) [-2130.299] -- 0:00:14
936500 -- (-2137.356) (-2137.218) [-2134.530] (-2134.279) * (-2137.684) (-2139.050) (-2136.687) [-2135.791] -- 0:00:14
937000 -- (-2136.868) (-2138.531) (-2136.723) [-2137.691] * [-2139.139] (-2135.822) (-2131.024) (-2132.807) -- 0:00:14
937500 -- (-2138.161) (-2139.168) [-2134.544] (-2146.315) * [-2133.288] (-2136.376) (-2130.025) (-2134.442) -- 0:00:13
938000 -- (-2135.950) (-2147.453) [-2139.091] (-2145.189) * (-2139.178) (-2135.652) [-2134.704] (-2135.479) -- 0:00:13
938500 -- (-2138.161) [-2136.658] (-2132.257) (-2140.617) * (-2136.749) (-2131.332) (-2134.693) [-2141.800] -- 0:00:13
939000 -- (-2132.563) (-2142.654) (-2134.807) [-2133.771] * (-2136.445) [-2129.633] (-2136.600) (-2142.325) -- 0:00:13
939500 -- (-2138.276) (-2137.620) [-2135.466] (-2135.177) * [-2134.447] (-2130.815) (-2134.332) (-2146.395) -- 0:00:13
940000 -- (-2134.230) (-2141.179) (-2136.277) [-2136.448] * [-2141.102] (-2131.922) (-2136.148) (-2144.026) -- 0:00:13
Average standard deviation of split frequencies: 0.002673
940500 -- (-2134.843) (-2138.217) [-2135.225] (-2133.822) * (-2135.595) [-2130.649] (-2136.165) (-2138.394) -- 0:00:13
941000 -- (-2135.876) (-2141.441) (-2137.423) [-2134.408] * (-2132.089) [-2133.117] (-2145.753) (-2138.322) -- 0:00:13
941500 -- (-2136.650) (-2137.266) (-2136.072) [-2129.799] * (-2135.588) [-2136.531] (-2130.747) (-2135.484) -- 0:00:13
942000 -- (-2132.831) (-2137.053) (-2139.536) [-2131.440] * (-2132.552) [-2134.329] (-2135.829) (-2136.163) -- 0:00:12
942500 -- [-2139.476] (-2137.664) (-2133.952) (-2130.709) * (-2134.698) [-2131.668] (-2133.285) (-2134.362) -- 0:00:12
943000 -- (-2131.253) [-2133.868] (-2134.279) (-2134.624) * (-2134.094) (-2138.774) (-2133.977) [-2137.350] -- 0:00:12
943500 -- (-2132.673) (-2136.438) [-2136.719] (-2136.196) * (-2139.147) (-2137.502) [-2134.413] (-2141.490) -- 0:00:12
944000 -- (-2134.820) [-2132.182] (-2133.065) (-2140.860) * (-2145.627) (-2140.844) [-2131.109] (-2137.757) -- 0:00:12
944500 -- [-2139.509] (-2139.017) (-2136.637) (-2136.342) * [-2130.695] (-2136.706) (-2132.962) (-2134.115) -- 0:00:12
945000 -- (-2140.097) (-2136.779) (-2134.283) [-2131.144] * (-2138.227) (-2134.221) (-2135.552) [-2134.237] -- 0:00:12
Average standard deviation of split frequencies: 0.003322
945500 -- (-2134.045) (-2138.476) (-2136.031) [-2130.809] * (-2138.169) [-2134.811] (-2132.039) (-2139.088) -- 0:00:12
946000 -- (-2134.107) (-2138.559) (-2133.036) [-2134.678] * (-2134.936) [-2130.815] (-2131.561) (-2136.403) -- 0:00:12
946500 -- [-2132.540] (-2140.048) (-2133.345) (-2133.938) * [-2133.788] (-2142.781) (-2133.888) (-2137.530) -- 0:00:11
947000 -- [-2131.918] (-2144.598) (-2135.357) (-2141.827) * (-2136.471) (-2142.932) [-2138.555] (-2137.494) -- 0:00:11
947500 -- (-2135.056) (-2142.181) [-2131.224] (-2137.058) * (-2133.462) [-2142.685] (-2134.561) (-2137.156) -- 0:00:11
948000 -- (-2135.182) (-2133.175) (-2137.232) [-2137.661] * (-2143.085) (-2137.117) (-2133.079) [-2138.807] -- 0:00:11
948500 -- (-2139.378) (-2139.847) (-2136.548) [-2136.551] * [-2134.255] (-2133.371) (-2132.885) (-2137.480) -- 0:00:11
949000 -- [-2134.074] (-2131.761) (-2136.014) (-2141.039) * (-2144.339) (-2134.645) [-2133.284] (-2134.890) -- 0:00:11
949500 -- (-2131.394) [-2133.541] (-2137.802) (-2137.179) * (-2141.963) (-2139.761) (-2130.421) [-2137.511] -- 0:00:11
950000 -- (-2132.223) [-2134.974] (-2133.338) (-2131.746) * (-2142.333) [-2140.082] (-2141.067) (-2137.908) -- 0:00:11
Average standard deviation of split frequencies: 0.003471
950500 -- [-2133.461] (-2135.901) (-2140.678) (-2133.331) * (-2137.472) (-2129.625) [-2143.417] (-2136.082) -- 0:00:11
951000 -- (-2139.515) [-2131.271] (-2137.592) (-2133.214) * [-2135.124] (-2134.125) (-2134.414) (-2138.144) -- 0:00:10
951500 -- (-2135.282) [-2132.573] (-2134.662) (-2134.092) * (-2138.359) [-2130.863] (-2131.511) (-2133.007) -- 0:00:10
952000 -- (-2136.595) (-2132.675) (-2140.555) [-2134.297] * (-2138.684) (-2134.896) [-2134.810] (-2138.788) -- 0:00:10
952500 -- (-2134.252) (-2131.603) (-2130.530) [-2131.582] * (-2132.493) (-2138.355) [-2134.102] (-2135.613) -- 0:00:10
953000 -- [-2135.948] (-2137.206) (-2142.684) (-2131.876) * (-2134.909) (-2131.691) [-2136.686] (-2140.944) -- 0:00:10
953500 -- (-2137.770) (-2135.864) [-2134.101] (-2133.093) * (-2137.501) [-2133.401] (-2137.348) (-2135.328) -- 0:00:10
954000 -- [-2138.123] (-2136.100) (-2136.093) (-2134.923) * (-2136.796) [-2134.195] (-2132.907) (-2135.640) -- 0:00:10
954500 -- [-2136.045] (-2134.138) (-2135.299) (-2138.222) * (-2139.668) (-2133.744) (-2142.055) [-2135.404] -- 0:00:10
955000 -- (-2136.496) (-2134.719) [-2132.423] (-2135.113) * [-2136.103] (-2134.500) (-2137.143) (-2136.238) -- 0:00:10
Average standard deviation of split frequencies: 0.003123
955500 -- (-2135.723) (-2132.900) [-2133.097] (-2140.097) * (-2136.930) (-2134.682) [-2135.078] (-2136.849) -- 0:00:09
956000 -- (-2141.974) (-2135.090) (-2130.591) [-2133.307] * (-2136.650) (-2135.800) [-2137.040] (-2131.707) -- 0:00:09
956500 -- (-2136.027) (-2137.735) (-2139.814) [-2134.358] * (-2149.921) [-2131.311] (-2134.382) (-2132.903) -- 0:00:09
957000 -- (-2135.244) [-2136.310] (-2134.799) (-2145.650) * (-2141.774) (-2133.366) (-2139.149) [-2132.810] -- 0:00:09
957500 -- (-2136.182) (-2131.715) (-2132.406) [-2136.676] * (-2140.788) (-2138.419) [-2137.897] (-2134.241) -- 0:00:09
958000 -- [-2132.151] (-2137.606) (-2135.773) (-2133.064) * [-2138.411] (-2141.506) (-2133.819) (-2139.511) -- 0:00:09
958500 -- (-2132.852) (-2132.907) [-2131.303] (-2131.857) * [-2134.251] (-2134.029) (-2136.877) (-2132.498) -- 0:00:09
959000 -- (-2137.357) (-2144.471) [-2130.210] (-2135.724) * (-2133.775) [-2135.395] (-2136.218) (-2141.071) -- 0:00:09
959500 -- (-2135.183) (-2128.551) (-2131.803) [-2136.781] * (-2137.501) [-2131.592] (-2135.104) (-2138.663) -- 0:00:09
960000 -- (-2135.211) (-2138.071) (-2134.623) [-2132.502] * [-2138.295] (-2130.694) (-2135.355) (-2135.076) -- 0:00:08
Average standard deviation of split frequencies: 0.004089
960500 -- (-2133.645) [-2135.223] (-2134.295) (-2136.779) * (-2127.633) (-2141.316) [-2135.224] (-2134.967) -- 0:00:08
961000 -- (-2132.324) (-2134.335) (-2139.168) [-2141.297] * (-2132.083) (-2135.453) (-2141.361) [-2134.535] -- 0:00:08
961500 -- (-2133.136) (-2141.490) (-2136.454) [-2140.123] * [-2132.302] (-2136.160) (-2139.799) (-2134.478) -- 0:00:08
962000 -- (-2133.078) [-2137.864] (-2134.882) (-2138.781) * [-2137.732] (-2138.811) (-2131.492) (-2135.977) -- 0:00:08
962500 -- [-2133.304] (-2141.553) (-2140.478) (-2140.711) * (-2139.058) [-2136.352] (-2137.279) (-2145.049) -- 0:00:08
963000 -- [-2138.015] (-2140.521) (-2136.394) (-2139.852) * (-2135.636) (-2135.221) (-2129.964) [-2143.505] -- 0:00:08
963500 -- (-2133.740) [-2144.525] (-2134.173) (-2143.316) * [-2133.865] (-2137.514) (-2138.549) (-2137.513) -- 0:00:08
964000 -- [-2133.710] (-2140.624) (-2137.610) (-2140.498) * (-2131.837) [-2134.044] (-2131.436) (-2133.927) -- 0:00:08
964500 -- [-2136.123] (-2142.193) (-2138.306) (-2139.652) * (-2133.745) (-2134.431) (-2133.341) [-2132.335] -- 0:00:07
965000 -- (-2135.898) (-2138.052) (-2138.178) [-2130.858] * (-2139.313) [-2133.255] (-2133.424) (-2136.896) -- 0:00:07
Average standard deviation of split frequencies: 0.002765
965500 -- (-2132.989) [-2139.324] (-2131.436) (-2135.168) * (-2140.346) (-2133.589) (-2133.663) [-2134.107] -- 0:00:07
966000 -- [-2134.978] (-2136.166) (-2138.137) (-2133.927) * (-2131.508) (-2135.054) (-2143.118) [-2133.853] -- 0:00:07
966500 -- [-2139.077] (-2138.560) (-2137.071) (-2136.632) * (-2132.153) [-2134.743] (-2141.966) (-2132.992) -- 0:00:07
967000 -- (-2137.978) [-2139.372] (-2138.784) (-2129.854) * [-2134.234] (-2135.964) (-2140.194) (-2136.736) -- 0:00:07
967500 -- (-2133.598) [-2139.246] (-2135.937) (-2132.161) * (-2139.435) (-2137.649) (-2133.450) [-2133.074] -- 0:00:07
968000 -- (-2137.507) (-2138.875) [-2132.918] (-2132.128) * [-2132.673] (-2137.623) (-2137.579) (-2135.857) -- 0:00:07
968500 -- (-2134.286) (-2144.346) (-2135.754) [-2138.004] * [-2134.573] (-2138.481) (-2146.738) (-2136.356) -- 0:00:07
969000 -- [-2129.692] (-2131.498) (-2141.390) (-2139.303) * [-2133.981] (-2130.293) (-2138.486) (-2135.136) -- 0:00:06
969500 -- (-2136.911) [-2133.168] (-2139.549) (-2135.688) * (-2131.448) (-2133.211) (-2139.655) [-2137.049] -- 0:00:06
970000 -- [-2135.137] (-2140.881) (-2139.413) (-2135.140) * (-2134.937) (-2141.723) [-2135.656] (-2136.652) -- 0:00:06
Average standard deviation of split frequencies: 0.002428
970500 -- (-2139.393) (-2135.385) (-2134.447) [-2130.799] * (-2140.143) [-2132.833] (-2139.307) (-2132.601) -- 0:00:06
971000 -- (-2141.619) (-2138.992) [-2131.419] (-2138.839) * (-2138.083) [-2137.633] (-2134.415) (-2131.915) -- 0:00:06
971500 -- (-2137.716) (-2137.024) [-2131.231] (-2136.884) * [-2134.829] (-2135.313) (-2132.130) (-2135.328) -- 0:00:06
972000 -- [-2130.126] (-2141.386) (-2133.533) (-2134.679) * (-2139.099) [-2136.205] (-2134.530) (-2138.312) -- 0:00:06
972500 -- [-2132.067] (-2132.571) (-2133.483) (-2140.893) * (-2130.284) (-2139.888) (-2139.609) [-2135.128] -- 0:00:06
973000 -- (-2133.837) (-2135.370) [-2133.331] (-2137.106) * (-2132.446) (-2139.113) (-2131.961) [-2134.572] -- 0:00:06
973500 -- (-2139.391) (-2136.859) (-2132.730) [-2134.561] * (-2138.321) [-2135.560] (-2131.496) (-2128.973) -- 0:00:05
974000 -- [-2135.335] (-2137.452) (-2135.014) (-2132.998) * [-2135.033] (-2135.385) (-2138.567) (-2134.689) -- 0:00:05
974500 -- (-2134.867) (-2131.938) [-2139.506] (-2140.589) * (-2137.422) (-2133.614) [-2131.337] (-2143.982) -- 0:00:05
975000 -- (-2136.568) [-2137.469] (-2136.792) (-2130.385) * [-2132.299] (-2131.474) (-2135.712) (-2135.355) -- 0:00:05
Average standard deviation of split frequencies: 0.001771
975500 -- (-2131.142) (-2135.980) (-2139.750) [-2133.394] * [-2132.476] (-2138.003) (-2136.953) (-2135.331) -- 0:00:05
976000 -- [-2129.837] (-2140.399) (-2140.397) (-2134.202) * (-2139.466) [-2136.103] (-2139.484) (-2131.697) -- 0:00:05
976500 -- (-2132.902) [-2131.152] (-2135.915) (-2133.152) * (-2135.956) (-2140.181) (-2135.857) [-2132.205] -- 0:00:05
977000 -- (-2132.453) [-2129.894] (-2138.004) (-2134.821) * [-2131.809] (-2137.989) (-2136.841) (-2133.808) -- 0:00:05
977500 -- (-2137.001) (-2137.726) [-2133.890] (-2133.701) * (-2136.359) (-2135.864) (-2135.967) [-2134.700] -- 0:00:05
978000 -- (-2136.419) [-2148.459] (-2135.617) (-2133.631) * (-2140.386) [-2133.765] (-2142.132) (-2136.825) -- 0:00:04
978500 -- (-2145.669) (-2139.685) (-2138.719) [-2132.969] * [-2142.219] (-2135.156) (-2135.987) (-2144.633) -- 0:00:04
979000 -- (-2140.069) (-2139.496) [-2136.094] (-2134.332) * (-2138.797) (-2137.297) [-2133.609] (-2134.096) -- 0:00:04
979500 -- [-2135.169] (-2141.470) (-2133.677) (-2138.180) * (-2140.830) (-2134.386) [-2129.664] (-2134.631) -- 0:00:04
980000 -- (-2135.925) [-2132.983] (-2142.766) (-2135.045) * (-2133.051) (-2138.663) [-2134.247] (-2139.005) -- 0:00:04
Average standard deviation of split frequencies: 0.001442
980500 -- (-2133.686) [-2131.950] (-2137.403) (-2143.477) * [-2133.168] (-2133.884) (-2132.500) (-2139.428) -- 0:00:04
981000 -- (-2140.243) (-2136.456) [-2137.262] (-2133.320) * (-2135.521) [-2135.273] (-2133.147) (-2136.276) -- 0:00:04
981500 -- (-2132.509) (-2141.095) (-2145.944) [-2133.220] * (-2142.935) [-2135.741] (-2138.834) (-2136.392) -- 0:00:04
982000 -- [-2135.397] (-2135.517) (-2132.223) (-2133.096) * (-2137.731) (-2137.771) [-2132.000] (-2137.223) -- 0:00:04
982500 -- [-2134.034] (-2139.278) (-2141.161) (-2136.305) * (-2139.881) [-2130.845] (-2147.383) (-2135.058) -- 0:00:03
983000 -- (-2134.956) (-2142.906) [-2131.158] (-2138.150) * (-2138.585) (-2132.603) [-2134.657] (-2136.166) -- 0:00:03
983500 -- [-2139.110] (-2138.527) (-2133.313) (-2136.026) * (-2141.739) [-2135.372] (-2140.786) (-2135.286) -- 0:00:03
984000 -- [-2133.138] (-2131.845) (-2137.509) (-2135.812) * [-2139.129] (-2135.529) (-2135.477) (-2138.152) -- 0:00:03
984500 -- [-2132.545] (-2136.850) (-2135.396) (-2136.596) * (-2136.474) (-2132.960) (-2135.714) [-2131.836] -- 0:00:03
985000 -- (-2134.122) (-2137.863) [-2130.451] (-2133.611) * (-2132.974) (-2137.552) [-2134.210] (-2130.353) -- 0:00:03
Average standard deviation of split frequencies: 0.000797
985500 -- (-2141.865) (-2137.584) [-2131.919] (-2138.091) * (-2139.197) (-2136.078) (-2138.204) [-2139.654] -- 0:00:03
986000 -- [-2133.574] (-2137.038) (-2137.481) (-2138.501) * (-2143.613) (-2137.577) [-2130.330] (-2132.815) -- 0:00:03
986500 -- (-2138.098) (-2134.932) (-2133.861) [-2136.205] * (-2141.928) (-2137.723) (-2133.095) [-2132.267] -- 0:00:03
987000 -- [-2135.299] (-2135.606) (-2135.492) (-2136.861) * [-2132.569] (-2134.189) (-2133.253) (-2138.229) -- 0:00:02
987500 -- [-2134.646] (-2136.292) (-2139.253) (-2145.013) * (-2134.385) [-2136.204] (-2139.164) (-2135.865) -- 0:00:02
988000 -- [-2130.551] (-2130.079) (-2139.904) (-2147.364) * (-2140.478) (-2136.924) [-2129.504] (-2135.383) -- 0:00:02
988500 -- (-2132.077) [-2138.031] (-2131.936) (-2138.952) * [-2133.100] (-2135.480) (-2142.214) (-2136.443) -- 0:00:02
989000 -- (-2139.988) [-2135.849] (-2136.976) (-2132.949) * (-2132.227) (-2133.326) [-2133.168] (-2138.218) -- 0:00:02
989500 -- (-2132.231) (-2132.319) [-2131.115] (-2138.473) * [-2136.687] (-2133.432) (-2141.910) (-2132.340) -- 0:00:02
990000 -- (-2133.765) (-2134.226) (-2138.864) [-2133.097] * (-2129.727) [-2134.669] (-2135.692) (-2135.266) -- 0:00:02
Average standard deviation of split frequencies: 0.000476
990500 -- (-2139.693) [-2131.776] (-2142.079) (-2135.585) * [-2130.854] (-2136.451) (-2134.710) (-2137.559) -- 0:00:02
991000 -- [-2129.661] (-2143.449) (-2133.725) (-2134.575) * [-2133.166] (-2134.910) (-2141.168) (-2133.120) -- 0:00:02
991500 -- (-2133.643) [-2139.277] (-2135.768) (-2130.973) * (-2132.447) [-2138.065] (-2138.011) (-2131.512) -- 0:00:01
992000 -- (-2132.503) (-2135.892) [-2134.531] (-2134.291) * (-2135.564) (-2135.802) (-2136.824) [-2132.538] -- 0:00:01
992500 -- (-2136.948) (-2138.922) [-2134.469] (-2135.444) * (-2136.644) (-2135.123) (-2141.758) [-2139.309] -- 0:00:01
993000 -- (-2134.436) [-2136.068] (-2137.581) (-2130.417) * (-2136.545) (-2134.402) [-2136.220] (-2138.545) -- 0:00:01
993500 -- (-2139.483) [-2132.739] (-2139.286) (-2134.026) * [-2130.348] (-2143.158) (-2134.752) (-2133.878) -- 0:00:01
994000 -- (-2140.528) (-2136.658) [-2136.211] (-2138.294) * (-2135.434) (-2135.474) (-2139.307) [-2137.566] -- 0:00:01
994500 -- (-2142.312) [-2130.183] (-2138.763) (-2133.373) * [-2138.611] (-2140.384) (-2140.224) (-2134.574) -- 0:00:01
995000 -- (-2131.991) [-2135.569] (-2134.991) (-2135.801) * [-2135.915] (-2139.951) (-2132.975) (-2132.904) -- 0:00:01
Average standard deviation of split frequencies: 0.000473
995500 -- (-2136.741) (-2134.812) (-2131.067) [-2135.062] * (-2139.449) [-2130.478] (-2133.658) (-2135.856) -- 0:00:01
996000 -- [-2136.294] (-2137.243) (-2133.581) (-2138.509) * (-2137.427) [-2140.295] (-2137.418) (-2133.551) -- 0:00:00
996500 -- [-2136.716] (-2136.292) (-2135.289) (-2136.248) * (-2144.544) (-2137.713) (-2138.714) [-2135.440] -- 0:00:00
997000 -- (-2136.967) (-2130.605) (-2142.705) [-2133.338] * (-2136.826) (-2133.933) [-2131.449] (-2133.785) -- 0:00:00
997500 -- (-2134.314) [-2135.110] (-2137.476) (-2133.342) * [-2143.479] (-2134.920) (-2136.019) (-2134.711) -- 0:00:00
998000 -- (-2135.380) (-2133.723) [-2131.158] (-2137.520) * (-2134.328) (-2138.094) [-2139.696] (-2134.037) -- 0:00:00
998500 -- (-2140.402) (-2135.348) (-2131.801) [-2136.046] * [-2135.522] (-2136.987) (-2135.692) (-2135.536) -- 0:00:00
999000 -- [-2134.773] (-2135.922) (-2133.742) (-2136.488) * (-2136.960) (-2133.773) [-2133.032] (-2134.069) -- 0:00:00
999500 -- (-2134.651) (-2137.394) [-2129.821] (-2131.279) * [-2134.623] (-2134.089) (-2131.760) (-2140.092) -- 0:00:00
1000000 -- (-2139.822) (-2136.548) (-2132.691) [-2129.545] * (-2137.586) (-2135.746) (-2135.653) [-2135.604] -- 0:00:00
Average standard deviation of split frequencies: 0.000157
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2139.821818 -- 15.176627
Chain 1 -- -2139.821808 -- 15.176627
Chain 2 -- -2136.547746 -- 15.446945
Chain 2 -- -2136.547743 -- 15.446945
Chain 3 -- -2132.691440 -- 13.123627
Chain 3 -- -2132.691440 -- 13.123627
Chain 4 -- -2129.545023 -- 14.415792
Chain 4 -- -2129.545024 -- 14.415792
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2137.586491 -- 12.611120
Chain 1 -- -2137.586481 -- 12.611120
Chain 2 -- -2135.746065 -- 12.318900
Chain 2 -- -2135.746090 -- 12.318900
Chain 3 -- -2135.652575 -- 10.211375
Chain 3 -- -2135.652573 -- 10.211375
Chain 4 -- -2135.604101 -- 16.694946
Chain 4 -- -2135.604101 -- 16.694946
Analysis completed in 3 mins 43 seconds
Analysis used 222.95 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2127.30
Likelihood of best state for "cold" chain of run 2 was -2127.36
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
50.5 % ( 37 %) Dirichlet(Revmat{all})
65.8 % ( 52 %) Slider(Revmat{all})
25.7 % ( 24 %) Dirichlet(Pi{all})
27.5 % ( 23 %) Slider(Pi{all})
53.6 % ( 28 %) Multiplier(Alpha{1,2})
48.6 % ( 31 %) Multiplier(Alpha{3})
63.6 % ( 41 %) Slider(Pinvar{all})
5.7 % ( 2 %) ExtSPR(Tau{all},V{all})
5.5 % ( 1 %) ExtTBR(Tau{all},V{all})
5.7 % ( 3 %) NNI(Tau{all},V{all})
8.9 % ( 4 %) ParsSPR(Tau{all},V{all})
26.0 % ( 30 %) Multiplier(V{all})
29.6 % ( 28 %) Nodeslider(V{all})
25.7 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
50.6 % ( 27 %) Dirichlet(Revmat{all})
64.5 % ( 52 %) Slider(Revmat{all})
25.6 % ( 23 %) Dirichlet(Pi{all})
27.2 % ( 22 %) Slider(Pi{all})
53.6 % ( 24 %) Multiplier(Alpha{1,2})
49.1 % ( 23 %) Multiplier(Alpha{3})
64.1 % ( 30 %) Slider(Pinvar{all})
5.7 % ( 7 %) ExtSPR(Tau{all},V{all})
5.7 % ( 8 %) ExtTBR(Tau{all},V{all})
5.7 % ( 6 %) NNI(Tau{all},V{all})
9.1 % ( 9 %) ParsSPR(Tau{all},V{all})
26.1 % ( 30 %) Multiplier(V{all})
29.3 % ( 27 %) Nodeslider(V{all})
26.0 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.57
2 | 166486 0.85 0.72
3 | 166716 166820 0.86
4 | 166024 166698 167256
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.56
2 | 166664 0.85 0.72
3 | 166322 166751 0.86
4 | 166860 167010 166393
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2133.28
| 2 |
| 2 |
| 22 2 2 |
| 2 1 2 2 221 2 21|
| 2 1 1 |
|2 * 1 2 12 12 1 1 |
|1 111 1 11 1 2 22 21 |
| 21 * 11 2 * 2 111 1 |
| 22 1 1 2 1 1 11 2 11 2 2 2 2 2 2 |
| 2 1 22 1 12 11 1 |
| 12 2 2 1 2 1 1 2|
| 1 2 2 1 2 12 1 2 1 2 |
| 2 1 1 1 2 1 1 12 |
| 1 2 1 |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2136.12
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2132.34 -2142.07
2 -2132.08 -2140.29
--------------------------------------
TOTAL -2132.20 -2141.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.398826 0.003930 0.285083 0.522553 0.390663 981.36 1146.17 1.000
r(A<->C){all} 0.054093 0.000558 0.010339 0.100130 0.051956 845.92 942.39 1.000
r(A<->G){all} 0.273057 0.002259 0.189289 0.374165 0.270419 809.19 887.35 1.000
r(A<->T){all} 0.096206 0.000690 0.048363 0.147941 0.094515 923.51 931.13 1.000
r(C<->G){all} 0.078816 0.000614 0.031767 0.126020 0.077431 912.54 998.68 1.000
r(C<->T){all} 0.460920 0.003371 0.353784 0.579082 0.460301 826.82 841.62 1.000
r(G<->T){all} 0.036908 0.000345 0.002472 0.072354 0.034545 993.21 1000.76 1.002
pi(A){all} 0.267943 0.000198 0.241156 0.294808 0.267595 1258.16 1289.79 1.000
pi(C){all} 0.224327 0.000177 0.199433 0.251083 0.224333 1032.22 1149.19 1.000
pi(G){all} 0.261935 0.000201 0.233164 0.288810 0.262194 972.68 1052.99 1.000
pi(T){all} 0.245795 0.000186 0.219840 0.272478 0.245278 1091.12 1132.96 1.000
alpha{1,2} 0.127572 0.007008 0.000196 0.269962 0.121075 813.70 841.17 1.001
alpha{3} 1.348165 0.401093 0.385434 2.574776 1.224848 1156.06 1219.98 1.001
pinvar{all} 0.273197 0.016628 0.039348 0.511955 0.272184 762.56 806.21 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
8 -- ..***
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2244 0.747502 0.000000 0.747502 0.747502 2
8 735 0.244837 0.000471 0.244504 0.245170 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.056519 0.000231 0.029320 0.085808 0.054666 1.000 2
length{all}[2] 0.013861 0.000029 0.004374 0.024481 0.013178 1.000 2
length{all}[3] 0.013246 0.000032 0.002903 0.024617 0.012739 1.000 2
length{all}[4] 0.099470 0.000636 0.056703 0.150843 0.096323 1.000 2
length{all}[5] 0.113169 0.000743 0.065492 0.167546 0.109298 1.000 2
length{all}[6] 0.087142 0.000589 0.040990 0.133327 0.084476 1.000 2
length{all}[7] 0.017818 0.000071 0.001482 0.033964 0.016950 1.000 2
length{all}[8] 0.008507 0.000026 0.000229 0.018205 0.007629 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000157
Maximum standard deviation of split frequencies = 0.000471
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------75----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/-------------------- C1 (1)
|
| /------------------------------------ C4 (4)
|------------------------------+
+ \----------------------------------------- C5 (5)
|
| /----- C2 (2)
\-----+
\----- C3 (3)
|-----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 2 trees
99 % credible set contains 2 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 861
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
178 patterns at 287 / 287 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
173728 bytes for conP
24208 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 179
260592 bytes for conP, adjusted
0.105113 0.156788 0.163376 0.196333 0.042224 0.044762 0.020841 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -2271.234201
Iterating by ming2
Initial: fx= 2271.234201
x= 0.10511 0.15679 0.16338 0.19633 0.04222 0.04476 0.02084 0.30000 1.30000
1 h-m-p 0.0000 0.0008 319.5561 +++YYYCCCCC 2239.046914 7 0.0006 28 | 0/9
2 h-m-p 0.0002 0.0019 1249.9657 YYCCC 2217.685270 4 0.0002 46 | 0/9
3 h-m-p 0.0001 0.0007 493.6059 +YCYYCCC 2168.804522 6 0.0007 68 | 0/9
4 h-m-p 0.0003 0.0016 115.5598 YCCCC 2165.151338 4 0.0007 87 | 0/9
5 h-m-p 0.0001 0.0005 513.7929 +YCCCC 2159.188992 4 0.0003 107 | 0/9
6 h-m-p 0.0003 0.0020 439.9160 +YYYCCCCCC 2095.873723 8 0.0017 134 | 0/9
7 h-m-p 0.0003 0.0014 138.1837 YYCC 2094.958379 3 0.0002 150 | 0/9
8 h-m-p 0.0138 0.1488 2.1712 YYC 2094.662158 2 0.0117 164 | 0/9
9 h-m-p 0.0024 0.0253 10.4565 +YCCC 2092.604936 3 0.0063 182 | 0/9
10 h-m-p 0.0028 0.0522 24.1119 CCYC 2088.829431 3 0.0028 199 | 0/9
11 h-m-p 0.4986 2.5377 0.1364 CYCCC 2079.325313 4 0.9492 218 | 0/9
12 h-m-p 0.1416 0.7080 0.3173 CYCCC 2076.287537 4 0.2321 246 | 0/9
13 h-m-p 0.8037 6.9063 0.0916 +YCCC 2071.418458 3 2.1747 273 | 0/9
14 h-m-p 0.5825 2.9125 0.1462 YCYCCC 2068.412144 5 1.3976 302 | 0/9
15 h-m-p 1.6000 8.0000 0.1050 CCC 2066.348749 2 1.6091 327 | 0/9
16 h-m-p 1.0597 8.0000 0.1595 +YCCC 2064.187895 3 3.2640 354 | 0/9
17 h-m-p 1.6000 8.0000 0.0756 CCC 2063.774224 2 1.9272 379 | 0/9
18 h-m-p 1.6000 8.0000 0.0436 C 2063.721284 0 1.6985 400 | 0/9
19 h-m-p 1.6000 8.0000 0.0161 YC 2063.711964 1 1.1179 422 | 0/9
20 h-m-p 1.6000 8.0000 0.0020 CC 2063.709749 1 1.8258 445 | 0/9
21 h-m-p 0.9679 8.0000 0.0039 YC 2063.709311 1 1.7133 467 | 0/9
22 h-m-p 1.6000 8.0000 0.0004 C 2063.709284 0 1.3799 488 | 0/9
23 h-m-p 1.6000 8.0000 0.0001 C 2063.709282 0 1.5928 509 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 Y 2063.709282 0 1.1017 530 | 0/9
25 h-m-p 1.6000 8.0000 0.0000 Y 2063.709282 0 1.2544 551 | 0/9
26 h-m-p 1.6000 8.0000 0.0000 Y 2063.709282 0 1.6000 572 | 0/9
27 h-m-p 1.6000 8.0000 0.0000 C 2063.709282 0 1.6000 593 | 0/9
28 h-m-p 1.6000 8.0000 0.0000 C 2063.709282 0 0.4000 614 | 0/9
29 h-m-p 1.6000 8.0000 0.0000 ---C 2063.709282 0 0.0063 638
Out..
lnL = -2063.709282
639 lfun, 639 eigenQcodon, 4473 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 179
0.105113 0.156788 0.163376 0.196333 0.042224 0.044762 0.020841 2.540998 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.515157
np = 10
lnL0 = -2098.510558
Iterating by ming2
Initial: fx= 2098.510558
x= 0.10511 0.15679 0.16338 0.19633 0.04222 0.04476 0.02084 2.54100 0.57321 0.49224
1 h-m-p 0.0000 0.0009 152.7746 ++CYCC 2096.672298 3 0.0002 22 | 0/10
2 h-m-p 0.0002 0.0009 120.4538 YCYCCC 2093.746924 5 0.0005 43 | 0/10
3 h-m-p 0.0001 0.0008 710.1204 +CCYCCC 2064.617563 5 0.0006 67 | 0/10
4 h-m-p 0.0000 0.0002 670.3465 CYCCC 2063.014217 4 0.0001 87 | 0/10
5 h-m-p 0.0021 0.0105 17.8127 YCCC 2062.792506 3 0.0013 105 | 0/10
6 h-m-p 0.0011 0.0078 20.9294 YCC 2062.669916 2 0.0009 121 | 0/10
7 h-m-p 0.0029 0.0711 6.2872 +YCCC 2062.423515 3 0.0074 140 | 0/10
8 h-m-p 0.0007 0.0135 69.1643 YCCC 2061.906487 3 0.0014 158 | 0/10
9 h-m-p 0.0011 0.0261 92.0806 +YCY 2057.697806 2 0.0092 175 | 0/10
10 h-m-p 0.0029 0.0147 41.7317 CCC 2057.472374 2 0.0011 192 | 0/10
11 h-m-p 0.0335 2.3561 1.3391 ++CYCCCC 2052.664309 5 0.8148 216 | 0/10
12 h-m-p 1.6000 8.0000 0.2625 CYCC 2051.695985 3 0.5533 234 | 0/10
13 h-m-p 0.5481 8.0000 0.2650 YCCC 2051.297079 3 0.9630 262 | 0/10
14 h-m-p 1.6000 8.0000 0.1463 YCC 2051.192726 2 0.8364 288 | 0/10
15 h-m-p 1.6000 8.0000 0.0058 YC 2051.184152 1 1.0736 312 | 0/10
16 h-m-p 1.6000 8.0000 0.0011 YC 2051.183493 1 1.1652 336 | 0/10
17 h-m-p 0.8802 8.0000 0.0014 C 2051.183399 0 1.2455 359 | 0/10
18 h-m-p 1.6000 8.0000 0.0003 Y 2051.183392 0 1.2514 382 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 Y 2051.183392 0 1.1169 405 | 0/10
20 h-m-p 1.6000 8.0000 0.0000 Y 2051.183392 0 1.1109 428 | 0/10
21 h-m-p 1.6000 8.0000 0.0000 Y 2051.183392 0 1.6000 451 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 2051.183392 0 0.8553 474 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 Y 2051.183392 0 1.6000 497 | 0/10
24 h-m-p 1.6000 8.0000 0.0000 --------------Y 2051.183392 0 0.0000 534
Out..
lnL = -2051.183392
535 lfun, 1605 eigenQcodon, 7490 P(t)
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 179
initial w for M2:NSpselection reset.
0.105113 0.156788 0.163376 0.196333 0.042224 0.044762 0.020841 2.512475 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.394383
np = 12
lnL0 = -2109.688272
Iterating by ming2
Initial: fx= 2109.688272
x= 0.10511 0.15679 0.16338 0.19633 0.04222 0.04476 0.02084 2.51248 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0013 167.1864 ++CYCC 2107.749237 3 0.0002 24 | 0/12
2 h-m-p 0.0003 0.0013 102.1317 YCYCCC 2104.923523 5 0.0006 47 | 0/12
3 h-m-p 0.0001 0.0011 464.4295 ++ 2085.407650 m 0.0011 62 | 0/12
4 h-m-p -0.0000 -0.0000 111.1531
h-m-p: -1.99642371e-19 -9.98211854e-19 1.11153099e+02 2085.407650
.. | 0/12
5 h-m-p 0.0000 0.0017 215.9778 ++YYCCC 2081.564627 4 0.0003 97 | 0/12
6 h-m-p 0.0002 0.0009 149.4658 YCYCCC 2076.637281 5 0.0005 120 | 0/12
7 h-m-p 0.0001 0.0007 150.2746 CCCCC 2075.105452 4 0.0003 143 | 0/12
8 h-m-p 0.0002 0.0012 75.4695 ++ 2072.118254 m 0.0012 158 | 1/12
9 h-m-p 0.0022 0.0109 35.9484 CCC 2071.126459 2 0.0021 177 | 1/12
10 h-m-p 0.0012 0.0308 60.2472 +CCC 2066.616243 2 0.0061 197 | 0/12
11 h-m-p 0.0006 0.0034 602.2155 CCC 2061.913183 2 0.0006 216 | 0/12
12 h-m-p 0.0020 0.0158 186.9116 YCCC 2059.733386 3 0.0011 236 | 0/12
13 h-m-p 0.0041 0.0204 39.8585 YYCC 2058.491175 3 0.0038 255 | 0/12
14 h-m-p 0.0034 0.0170 28.8937 YYCC 2057.881473 3 0.0030 274 | 0/12
15 h-m-p 0.0155 0.1823 5.6588 ++ 2053.656821 m 0.1823 289 | 1/12
16 h-m-p 0.3486 2.0215 1.5305 YCCCCC 2052.236332 5 0.3770 313 | 1/12
17 h-m-p 0.4131 2.0653 0.9965 CYC 2051.442649 2 0.4038 331 | 1/12
18 h-m-p 1.6000 8.0000 0.1184 YC 2051.315166 1 0.8907 358 | 0/12
19 h-m-p 0.1227 8.0000 0.8600 +YCC 2051.157197 2 0.3549 388 | 0/12
20 h-m-p 0.6961 8.0000 0.4385 +YC 2050.519853 1 2.3368 417 | 0/12
21 h-m-p 1.6000 8.0000 0.4827 YCC 2050.131750 2 0.9724 447 | 0/12
22 h-m-p 1.6000 8.0000 0.1568 YCC 2050.090214 2 0.8859 477 | 0/12
23 h-m-p 1.6000 8.0000 0.0582 YC 2050.082227 1 0.8181 505 | 0/12
24 h-m-p 1.6000 8.0000 0.0205 C 2050.080348 0 1.6429 532 | 0/12
25 h-m-p 0.9976 8.0000 0.0337 +YC 2050.077756 1 2.8702 561 | 0/12
26 h-m-p 0.8299 8.0000 0.1166 +YC 2050.061957 1 5.6246 590 | 0/12
27 h-m-p 1.6000 8.0000 0.3330 YYC 2050.054437 2 1.3284 619 | 0/12
28 h-m-p 1.6000 8.0000 0.0578 YC 2050.049869 1 1.0739 647 | 0/12
29 h-m-p 0.1883 8.0000 0.3295 +YC 2050.045422 1 1.4373 676 | 0/12
30 h-m-p 1.6000 8.0000 0.2406 YC 2050.039964 1 3.1847 704 | 0/12
31 h-m-p 1.6000 8.0000 0.1833 C 2050.037591 0 1.6000 731 | 0/12
32 h-m-p 0.6114 8.0000 0.4797 CC 2050.036518 1 0.9986 760 | 0/12
33 h-m-p 1.5451 8.0000 0.3100 CY 2050.035409 1 2.1240 789 | 0/12
34 h-m-p 1.5292 8.0000 0.4306 C 2050.034762 0 1.4788 816 | 0/12
35 h-m-p 1.6000 8.0000 0.2892 C 2050.034442 0 1.6000 843 | 0/12
36 h-m-p 0.9990 8.0000 0.4632 YC 2050.034219 1 2.1787 871 | 0/12
37 h-m-p 1.6000 8.0000 0.3424 C 2050.034123 0 2.0751 898 | 0/12
38 h-m-p 1.6000 8.0000 0.3754 C 2050.034083 0 2.2324 925 | 0/12
39 h-m-p 1.6000 8.0000 0.3516 C 2050.034064 0 2.0228 952 | 0/12
40 h-m-p 1.6000 8.0000 0.3952 C 2050.034055 0 2.0842 979 | 0/12
41 h-m-p 1.6000 8.0000 0.3572 C 2050.034051 0 2.4628 1006 | 0/12
42 h-m-p 1.6000 8.0000 0.3509 C 2050.034049 0 2.4374 1033 | 0/12
43 h-m-p 1.6000 8.0000 0.3532 Y 2050.034049 0 2.6020 1060 | 0/12
44 h-m-p 1.6000 8.0000 0.3503 C 2050.034048 0 2.2920 1087 | 0/12
45 h-m-p 1.6000 8.0000 0.3674 C 2050.034048 0 2.2009 1114 | 0/12
46 h-m-p 1.6000 8.0000 0.3931 C 2050.034048 0 1.9432 1141 | 0/12
47 h-m-p 1.6000 8.0000 0.3852 C 2050.034048 0 2.3670 1168 | 0/12
48 h-m-p 1.6000 8.0000 0.3384 C 2050.034048 0 2.2741 1195 | 0/12
49 h-m-p 1.6000 8.0000 0.3418 Y 2050.034048 0 2.8296 1222 | 0/12
50 h-m-p 1.6000 8.0000 0.1875 C 2050.034048 0 1.6000 1249 | 0/12
51 h-m-p 0.1126 8.0000 2.6649 Y 2050.034048 0 0.1126 1276 | 0/12
52 h-m-p 1.0390 8.0000 0.2888 C 2050.034048 0 0.2597 1291 | 0/12
53 h-m-p 1.6000 8.0000 0.0030 C 2050.034048 0 1.6000 1318 | 0/12
54 h-m-p 1.6000 8.0000 0.0014 C 2050.034048 0 1.6000 1345 | 0/12
55 h-m-p 1.6000 8.0000 0.0003 -C 2050.034048 0 0.1000 1373 | 0/12
56 h-m-p 0.0160 8.0000 0.1594 -------------.. | 0/12
57 h-m-p 0.0160 8.0000 0.0001 ---C 2050.034048 0 0.0001 1441
Out..
lnL = -2050.034048
1442 lfun, 5768 eigenQcodon, 30282 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2059.234837 S = -1939.872209 -111.562075
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 178 patterns 0:19
did 20 / 178 patterns 0:19
did 30 / 178 patterns 0:19
did 40 / 178 patterns 0:19
did 50 / 178 patterns 0:19
did 60 / 178 patterns 0:19
did 70 / 178 patterns 0:19
did 80 / 178 patterns 0:19
did 90 / 178 patterns 0:19
did 100 / 178 patterns 0:19
did 110 / 178 patterns 0:19
did 120 / 178 patterns 0:19
did 130 / 178 patterns 0:19
did 140 / 178 patterns 0:19
did 150 / 178 patterns 0:19
did 160 / 178 patterns 0:19
did 170 / 178 patterns 0:19
did 178 / 178 patterns 0:19
Time used: 0:19
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 179
0.105113 0.156788 0.163376 0.196333 0.042224 0.044762 0.020841 2.613699 0.331355 0.382499 0.097199 0.242650 0.406289
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 9.666033
np = 13
lnL0 = -2061.675100
Iterating by ming2
Initial: fx= 2061.675100
x= 0.10511 0.15679 0.16338 0.19633 0.04222 0.04476 0.02084 2.61370 0.33136 0.38250 0.09720 0.24265 0.40629
1 h-m-p 0.0000 0.0009 132.6191 ++CCCC 2060.483687 3 0.0002 26 | 0/13
2 h-m-p 0.0002 0.0009 77.1656 CYCCC 2059.749846 4 0.0003 49 | 0/13
3 h-m-p 0.0001 0.0007 138.6296 ++ 2056.692788 m 0.0007 65 | 1/13
4 h-m-p 0.0007 0.0035 46.9799 CCCCC 2056.221940 4 0.0008 89 | 1/13
5 h-m-p 0.0005 0.0025 82.8882 +YCYCC 2054.944472 4 0.0013 112 | 1/13
6 h-m-p 0.0009 0.0046 36.7851 CCC 2054.607840 2 0.0012 132 | 1/13
7 h-m-p 0.0020 0.0842 21.7275 CYC 2054.313515 2 0.0026 151 | 0/13
8 h-m-p 0.0017 0.0120 33.8741 YCCC 2053.937707 3 0.0010 172 | 0/13
9 h-m-p 0.0033 0.0716 9.9249 CC 2053.908781 1 0.0013 190 | 0/13
10 h-m-p 0.0092 0.2413 1.4029 YC 2053.896623 1 0.0055 207 | 0/13
11 h-m-p 0.0027 0.4204 2.9096 +++YYYC 2052.856220 3 0.1642 229 | 0/13
12 h-m-p 0.3967 1.9833 0.6833 CCCC 2052.410722 3 0.5712 251 | 0/13
13 h-m-p 0.3409 8.0000 1.1450 YCCC 2051.989780 3 0.5820 285 | 0/13
14 h-m-p 0.6561 5.3272 1.0156 CYC 2051.568858 2 0.6099 304 | 0/13
15 h-m-p 0.3675 1.8375 0.4009 CCCCC 2051.219801 4 0.4175 328 | 0/13
16 h-m-p 0.3296 8.0000 0.5077 +YCC 2050.694989 2 0.9748 361 | 0/13
17 h-m-p 1.0377 8.0000 0.4769 CC 2050.416272 1 1.0433 392 | 0/13
18 h-m-p 1.6000 8.0000 0.2235 YCCC 2050.218398 3 1.1437 426 | 0/13
19 h-m-p 1.3003 8.0000 0.1966 CCC 2050.098450 2 2.0097 459 | 0/13
20 h-m-p 1.6000 8.0000 0.1151 YC 2050.057477 1 1.2206 489 | 0/13
21 h-m-p 1.2285 8.0000 0.1143 C 2050.037000 0 1.2285 518 | 0/13
22 h-m-p 1.6000 8.0000 0.0193 YC 2050.035058 1 1.2047 548 | 0/13
23 h-m-p 1.6000 8.0000 0.0140 C 2050.034676 0 2.0374 577 | 0/13
24 h-m-p 1.6000 8.0000 0.0051 YC 2050.034460 1 3.1279 607 | 0/13
25 h-m-p 1.6000 8.0000 0.0083 YC 2050.034166 1 2.9037 637 | 0/13
26 h-m-p 1.6000 8.0000 0.0083 C 2050.034054 0 1.4809 666 | 0/13
27 h-m-p 1.6000 8.0000 0.0035 Y 2050.034048 0 0.9302 695 | 0/13
28 h-m-p 1.6000 8.0000 0.0003 Y 2050.034048 0 1.0294 724 | 0/13
29 h-m-p 1.6000 8.0000 0.0001 Y 2050.034048 0 0.9812 753 | 0/13
30 h-m-p 1.6000 8.0000 0.0000 Y 2050.034048 0 0.9436 782 | 0/13
31 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/13
32 h-m-p 0.0160 8.0000 0.0000 ------------- | 0/13
33 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -2050.034048
906 lfun, 3624 eigenQcodon, 19026 P(t)
Time used: 0:27
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 179
0.105113 0.156788 0.163376 0.196333 0.042224 0.044762 0.020841 2.613699 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.718583
np = 10
lnL0 = -2060.293095
Iterating by ming2
Initial: fx= 2060.293095
x= 0.10511 0.15679 0.16338 0.19633 0.04222 0.04476 0.02084 2.61370 0.66567 1.54913
1 h-m-p 0.0000 0.0010 132.4179 ++CYC 2059.246938 2 0.0001 30 | 0/10
2 h-m-p 0.0002 0.0010 59.4292 CCCCC 2058.869388 4 0.0002 61 | 0/10
3 h-m-p 0.0002 0.0114 60.6370 +CYC 2057.812487 2 0.0011 88 | 0/10
4 h-m-p 0.0005 0.0026 82.5577 CYCCC 2056.847856 4 0.0008 118 | 0/10
5 h-m-p 0.0005 0.0040 143.4510 +YCYCC 2054.057910 4 0.0013 148 | 0/10
6 h-m-p 0.0063 0.0316 10.7575 -CC 2054.029239 1 0.0006 174 | 0/10
7 h-m-p 0.0025 0.1127 2.5012 YC 2054.024966 1 0.0013 198 | 0/10
8 h-m-p 0.0026 0.6608 1.2378 CC 2054.020677 1 0.0038 223 | 0/10
9 h-m-p 0.0012 0.4258 3.9894 +++YYYC 2053.707949 3 0.0762 252 | 0/10
10 h-m-p 0.6954 3.4769 0.4174 YCCC 2053.149309 3 0.3947 280 | 0/10
11 h-m-p 0.0816 0.7087 2.0196 +YYCCC 2052.740836 4 0.2500 310 | 0/10
12 h-m-p 0.3034 1.5169 0.5574 YYYCCCCC 2052.584983 7 0.3311 344 | 0/10
13 h-m-p 1.6000 8.0000 0.0717 YC 2052.519881 1 0.7703 368 | 0/10
14 h-m-p 1.6000 8.0000 0.0316 YC 2052.518392 1 0.6662 392 | 0/10
15 h-m-p 1.6000 8.0000 0.0027 Y 2052.518280 0 0.6608 415 | 0/10
16 h-m-p 1.6000 8.0000 0.0004 Y 2052.518274 0 0.9431 438 | 0/10
17 h-m-p 1.6000 8.0000 0.0001 Y 2052.518274 0 1.0729 461 | 0/10
18 h-m-p 1.6000 8.0000 0.0000 Y 2052.518274 0 0.9882 484 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 Y 2052.518274 0 0.2014 507 | 0/10
20 h-m-p 0.2855 8.0000 0.0000 -C 2052.518274 0 0.0178 531
Out..
lnL = -2052.518274
532 lfun, 5852 eigenQcodon, 37240 P(t)
Time used: 0:43
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 179
initial w for M8:NSbetaw>1 reset.
0.105113 0.156788 0.163376 0.196333 0.042224 0.044762 0.020841 2.542566 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.708204
np = 12
lnL0 = -2060.042520
Iterating by ming2
Initial: fx= 2060.042520
x= 0.10511 0.15679 0.16338 0.19633 0.04222 0.04476 0.02084 2.54257 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0009 184.7834 ++YCCC 2056.461364 3 0.0003 36 | 0/12
2 h-m-p 0.0001 0.0006 149.6487 +YYCCC 2053.233115 4 0.0004 70 | 0/12
3 h-m-p 0.0001 0.0005 88.8462 CCC 2052.902834 2 0.0001 101 | 0/12
4 h-m-p 0.0004 0.0045 30.9093 YCCC 2052.592213 3 0.0008 133 | 0/12
5 h-m-p 0.0004 0.0075 52.7698 YCCC 2052.056470 3 0.0010 165 | 0/12
6 h-m-p 0.0018 0.0119 29.2321 YCC 2051.822762 2 0.0011 195 | 0/12
7 h-m-p 0.0048 0.0267 6.7845 YC 2051.807503 1 0.0008 223 | 0/12
8 h-m-p 0.0035 0.1054 1.5012 CC 2051.801669 1 0.0037 252 | 0/12
9 h-m-p 0.0016 0.7965 4.4313 ++YC 2051.522855 1 0.0636 282 | 0/12
10 h-m-p 0.0029 0.0306 98.7742 YCC 2051.318443 2 0.0021 312 | 0/12
11 h-m-p 0.2004 3.1978 1.0330 YCCC 2050.980837 3 0.4559 344 | 0/12
12 h-m-p 0.7674 6.9909 0.6136 CC 2050.793599 1 0.6928 373 | 0/12
13 h-m-p 1.1811 6.1104 0.3599 CCCC 2050.637331 3 1.2291 406 | 0/12
14 h-m-p 1.6000 8.0000 0.2329 YC 2050.602945 1 1.1661 434 | 0/12
15 h-m-p 1.4423 8.0000 0.1883 CC 2050.581555 1 1.3079 463 | 0/12
16 h-m-p 0.9006 8.0000 0.2735 +CCC 2050.521298 2 3.2084 495 | 0/12
17 h-m-p 1.3576 8.0000 0.6463 CCCC 2050.446781 3 1.6193 528 | 0/12
18 h-m-p 1.6000 8.0000 0.5172 YCC 2050.388494 2 3.3935 558 | 0/12
19 h-m-p 1.6000 8.0000 0.8827 YC 2050.331795 1 2.7214 586 | 0/12
20 h-m-p 1.6000 8.0000 1.1119 CYC 2050.293819 2 2.2446 616 | 0/12
21 h-m-p 1.2806 8.0000 1.9489 YCC 2050.250992 2 2.3934 646 | 0/12
22 h-m-p 1.6000 8.0000 2.1833 YC 2050.214172 1 3.7132 674 | 0/12
23 h-m-p 1.6000 8.0000 3.3414 YC 2050.188448 1 2.5683 702 | 0/12
24 h-m-p 1.6000 8.0000 4.4803 YC 2050.167429 1 3.9469 730 | 0/12
25 h-m-p 1.3078 6.5390 7.5547 YC 2050.153946 1 2.2198 758 | 0/12
26 h-m-p 0.6825 3.4127 9.5611 ++ 2050.143262 m 3.4127 785 | 1/12
27 h-m-p 0.7523 6.9404 6.3453 ----------------.. | 1/12
28 h-m-p 0.0000 0.0239 2.1488 +CC 2050.142711 1 0.0002 855 | 1/12
29 h-m-p 0.0003 0.0927 1.6424 C 2050.142336 0 0.0004 881 | 1/12
30 h-m-p 0.0005 0.0552 1.2324 Y 2050.142235 0 0.0002 907 | 1/12
31 h-m-p 0.0012 0.5855 0.4939 C 2050.142205 0 0.0003 933 | 1/12
32 h-m-p 0.0015 0.7434 0.2626 C 2050.142190 0 0.0006 959 | 1/12
33 h-m-p 0.0015 0.7392 0.2370 Y 2050.142173 0 0.0011 985 | 1/12
34 h-m-p 0.0085 4.2575 0.6914 CC 2050.141694 1 0.0118 1013 | 1/12
35 h-m-p 0.0013 0.4833 6.0313 ++CC 2050.132182 1 0.0270 1043 | 1/12
36 h-m-p 0.0292 0.2632 5.5703 -YC 2050.131754 1 0.0013 1071 | 1/12
37 h-m-p 0.0107 5.3168 0.6948 +++CCC 2050.102615 2 0.7595 1104 | 1/12
38 h-m-p 0.8067 8.0000 0.6542 YCC 2050.055358 2 1.3853 1133 | 1/12
39 h-m-p 1.6000 8.0000 0.0339 YC 2050.055073 1 0.9086 1160 | 1/12
40 h-m-p 1.6000 8.0000 0.0011 C 2050.055067 0 1.2912 1186 | 1/12
41 h-m-p 0.8560 8.0000 0.0016 C 2050.055066 0 0.9541 1212 | 1/12
42 h-m-p 1.6000 8.0000 0.0000 Y 2050.055066 0 0.9881 1238 | 1/12
43 h-m-p 1.6000 8.0000 0.0000 ----------Y 2050.055066 0 0.0000 1274
Out..
lnL = -2050.055066
1275 lfun, 15300 eigenQcodon, 98175 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2057.832423 S = -1939.889444 -111.282986
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 178 patterns 1:25
did 20 / 178 patterns 1:25
did 30 / 178 patterns 1:25
did 40 / 178 patterns 1:26
did 50 / 178 patterns 1:26
did 60 / 178 patterns 1:26
did 70 / 178 patterns 1:26
did 80 / 178 patterns 1:26
did 90 / 178 patterns 1:27
did 100 / 178 patterns 1:27
did 110 / 178 patterns 1:27
did 120 / 178 patterns 1:27
did 130 / 178 patterns 1:27
did 140 / 178 patterns 1:28
did 150 / 178 patterns 1:28
did 160 / 178 patterns 1:28
did 170 / 178 patterns 1:28
did 178 / 178 patterns 1:28
Time used: 1:28
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=5, Len=287
D_melanogaster_CG5783-PA MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
D_sechellia_CG5783-PA MGTRLEVIGLKDVQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
D_simulans_CG5783-PA MGTRLEVIGLKDIQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI
D_yakuba_CG5783-PA MGTRLEVIGLKDIQQFQQLYKQNWPKYCQEYYCLDNFVSFLKKQPHMRNI
D_erecta_CG5783-PA MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI
************:*:*******.***************.***********
D_melanogaster_CG5783-PA KMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLK
D_sechellia_CG5783-PA KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
D_simulans_CG5783-PA KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK
D_yakuba_CG5783-PA QMYTLDTKQARDEGLFVIVDRYQLFVGCLTNTNGLVRSALELLDWSTGLK
D_erecta_CG5783-PA DMYTLDTKQARDEGLFVIVDRYQLFVGCLNNSSGLARTALDLLDWSTGLK
.*****:**********************.*:.**. .**:*****:***
D_melanogaster_CG5783-PA CSSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGF
D_sechellia_CG5783-PA CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKADDALKLRVEPPTGF
D_simulans_CG5783-PA CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKAEDALKLRVEPPTGF
D_yakuba_CG5783-PA CSSIPSRHIDALDGLVESKRLELVFRDYTNLYFMKAEDALKLKVEPPDGF
D_erecta_CG5783-PA CSSVPSRHMDALDSVVESKKLDLVFRDCTNLFYMKAEDALKLKVEPPVGF
***:****:.***.:****:*:**:** ***::***:*****:**** **
D_melanogaster_CG5783-PA VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
D_sechellia_CG5783-PA VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
D_simulans_CG5783-PA VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA
D_yakuba_CG5783-PA VLRPLSVADAPLVNDEWPNHHVGSLFFIERQIRLCVSVGLYQEDTQELVA
D_erecta_CG5783-PA VLKSLSVADAPLINEEWPNHHVGSLFFIERQIRLCISAGLYQEDTQELVA
**:.********:* ****** *****:*******:*.************
D_melanogaster_CG5783-PA WCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPS
D_sechellia_CG5783-PA WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
D_simulans_CG5783-PA WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS
D_yakuba_CG5783-PA WCIRLQGGYLGALQVKALHKRRGFGSVVTREIAYRLAAEGHDVMALVGPL
D_erecta_CG5783-PA WCIRSQGGFLGTLQVKDSHKRRGFGSVVTREMAYRIAAQGHDVMALVNPC
**** ***:**:**** *************:***:*.:********.*
D_melanogaster_CG5783-PA NKPSSEMFSKLGFQVIDQCYWLRTEPTGGQFTWPEGE
D_sechellia_CG5783-PA NKPSSGMFSKLGFQVIDQCFWLRTEPTEGQFTWPEGE
D_simulans_CG5783-PA NKPSSGMFSKLGFQVIEQCFWLRTEPTEGQFTWPEGE
D_yakuba_CG5783-PA NKPSSEMFSKLGFQVIDQCLWLRTEPTRGEFTWPEGE
D_erecta_CG5783-PA NKPSSEMFSKLGFQVIDQCYWLRTEPTSGEFTWPEGE
***** **********:** ******* *:*******
>D_melanogaster_CG5783-PA ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATATCCAGGAGTTCCA ACAGCTCTACAAGCAAAACTGGCCAAAATATTGCCAGGAATACTACTGCC TTGATAACTTTGTGGAATTTCTGAAAAAACAGCCCCATATGAGGAATATT AAGATGTACACATTGGATGCAAAACAAGCCAGAGATGAAGGTCTTTTTGT TATAGTGGATCGCTATCAACTATTCGTAGGTTGCTTGAACAACACGAACG GCCTTGTTGGAAAAGCTCTGGATTTACTGGACTGGTCGTCGGGTTTGAAA TGCAGTTCTATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA GTCCAAAAAGTTGAATCTGGTGTACAGGGACTGCACGAATTTGTTTTTTA TGAAAGCCAACGACGCTCTCAAGCTGAAAGTCGAACCTCCATCTGGATTT GTTTTAAAGTCGTTGAGTGTGGCAGATGCTCCATTGGTTAACGCAGAGTG GCCCAATCATCATGAGGGATCTTTGTTCTTCGTAGAAAGGCAGATTCGCC TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACCCAGGAACTAGTTGCC TGGTGCATTAGGTTACAAGGCGGCTACTTGGGCGCCCTGCAAGTCAAAGA TACACACAAGCGACGCGGATTTGGCAGTGTGGTGACTAGGGAAATAGCAT ACCGCCTAGCCGTCCAAGGTCACGATGTAATGGCTCTCGTGGGCCCCTCG AATAAGCCGTCATCGGAGATGTTCAGCAAACTGGGATTCCAGGTCATCGA TCAATGCTACTGGCTAAGGACGGAACCCACCGGTGGGCAGTTCACATGGC CCGAGGGCGAG >D_sechellia_CG5783-PA ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATGTCCAGGAGTTCCA ACAGCTCTACAAGCAAAGCTGGCCAAAATATTGCCAGGAGTACTACTGCC TTGATAACTTTGTGGAATTTCTGAAAAAACAACCCCACATGAGGAACATT AAGATGTACACATTGGATACAAAACAAGCCAGAGATGAAGGTCTTTTTGT CATAGTGGATCGCTATCAACTATTCGTAGGTTGCTTGAACAACACAAACG GCCTTGTTAGAAAAGCTCTGGATTTGCTGGACTGGTCGACGGGTCTGAAA TGCAGTTCAATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA GTCCAAGAAGTTGGATCTGGTGTTCAGGGACTGCACGAATTTGTTTTTTA TGAAAGCCGACGACGCTCTCAAGCTGAGAGTCGAACCCCCGACTGGATTT GTTTTAAAATCGTTGAGCGTGGCAGATGCTCCATTGGTCAACGCGGAGTG GCCCAATCATCATGAGGGCTCTTTGTTCTTCGTAGAAAGGCAGATTCGCC TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACTCAGGAACTAGTTGCC TGGTGCATTAGGTTACAAGGCGGTTACTTGGGCGCTTTGCAAGTGAAAGA TTCGCACAAGCGTCGCGGATTTGGCAGTGTGGTGACGAGGGAAATAGCAT ACCGCCTAGCTGCCCAAGGTCACGATGTAATGGCTCTCGTGGGCCCCTCG AATAAGCCCTCTTCGGGGATGTTCAGTAAACTGGGTTTCCAGGTCATCGA CCAATGCTTCTGGCTAAGGACGGAACCCACCGAGGGGCAGTTCACATGGC CCGAGGGCGAG >D_simulans_CG5783-PA ATGGGTACTCGATTAGAAGTTATTGGGCTGAAAGATATCCAGGAGTTCCA ACAGCTCTACAAGCAAAGCTGGCCAAAATATTGCCAGGAGTACTACTGCC TTGATAACTTTGTGGAATTTCTGAAAAAACAACCCCACATGAGGAACATT AAGATGTACACATTGGATACAAAACAAGCCAGAGATGAAGGTCTTTTTGT CATAGTGGATCGCTATCAACTATTCGTAGGCTGCTTGAACAACACAAACG GCCTTGTTAGAAAAGCTCTGGATTTGCTGGACTGGTCGACGGGTCTGAAA TGCAGTTCAATACCCTCCAGACACATTGGTGCCCTGGATAGTCTGGTGGA GTCCAAGAAGTTGGATCTGGTGTTCAGGGACTGCACGAATTTGTTTTTTA TGAAAGCCGAGGACGCTCTCAAGCTGAGAGTCGAACCCCCGACTGGATTT GTTTTAAAATCGCTGAGCGTGGCAGATGCTCCATTGGTCAACGCGGAGTG GCCCAATCATCATGAGGGATCTTTGTTCTTCGTAGAAAGGCAGATTCGCC TGTGCGTCAGTGTTGGATTGTACCAGGAAGACACTCAGGAACTAGTTGCC TGGTGCATTAGGTTACAAGGCGGCTACTTGGGCGCCCTGCAAGTGAAAGA TTCGCACAAGCGTCGTGGATTTGGCAGTGTGGTGACGAGGGAAATTGCAT ACCGCCTAGCTGCCCAAGGTCACGATGTAATGGCCCTCGTGGGCCCCTCG AATAAGCCTTCATCGGGGATGTTTAGCAAACTGGGCTTCCAGGTCATCGA ACAATGCTTCTGGCTAAGAACGGAACCCACCGAGGGGCAGTTCACATGGC CCGAGGGCGAG >D_yakuba_CG5783-PA ATGGGTACTCGATTAGAAGTTATTGGATTGAAAGACATCCAGCAGTTCCA ACAGCTCTACAAGCAGAACTGGCCGAAGTATTGCCAGGAATACTACTGCC TTGATAACTTCGTGTCATTCCTGAAAAAACAACCCCACATGAGGAACATT CAGATGTACACATTGGATACAAAACAAGCCAGAGACGAAGGTCTTTTTGT CATAGTGGATCGCTATCAACTATTTGTAGGTTGCTTGACCAACACAAACG GCCTTGTTAGATCAGCTTTGGAATTATTGGACTGGTCGACGGGTCTGAAA TGCAGTTCAATACCCTCCAGACACATTGATGCCCTGGATGGTCTGGTTGA GTCTAAGAGGTTGGAGCTGGTATTCAGGGATTACACGAATTTGTATTTTA TGAAAGCTGAGGACGCTCTCAAGCTGAAAGTTGAACCACCAGATGGATTT GTTCTAAGGCCCCTGAGCGTGGCAGACGCTCCTTTGGTGAACGACGAGTG GCCCAACCATCATGTGGGATCTTTGTTCTTCATAGAAAGACAGATTCGCC TGTGCGTCAGTGTAGGATTGTACCAGGAGGACACCCAAGAACTAGTTGCC TGGTGCATCAGGTTGCAAGGCGGCTACTTGGGCGCCCTGCAGGTGAAAGC TTTACACAAACGTCGAGGATTCGGCAGTGTAGTGACGAGGGAAATCGCAT ACCGCCTAGCCGCTGAGGGTCACGATGTAATGGCCCTCGTGGGCCCCTTG AATAAGCCCTCATCCGAGATGTTCAGCAAACTTGGCTTCCAGGTCATCGA CCAGTGCCTTTGGCTAAGGACCGAACCCACCAGGGGCGAGTTCACCTGGC CCGAGGGCGAG >D_erecta_CG5783-PA ATGGGTACTCGCTTAGAAGTTATTGGATTGAAAGATATCCAGGAATTCCA GCAGCTCTACAAGCAAAACTGGCCGAAATATTGCCAGGAATACTACTGCC TTGACAATTTTGTGGAATTTCTGAAAAAACAACCCCACATGCGGAATATT GATATGTACACATTGGATACAAAACAGGCCAGAGATGAAGGTCTCTTTGT CATAGTGGATCGCTATCAACTTTTCGTAGGTTGCTTGAACAACTCAAGCG GTCTTGCTAGAACAGCTTTGGATTTATTGGACTGGTCGACGGGTCTGAAA TGTAGTTCAGTACCCTCCAGACATATGGATGCCCTGGACAGTGTGGTAGA GTCTAAAAAGTTGGACCTCGTATTCAGGGATTGCACGAATTTGTTTTATA TGAAAGCTGAGGACGCTCTCAAGCTGAAAGTTGAACCCCCAGTTGGATTT GTTTTAAAGTCGCTGAGCGTGGCAGACGCCCCTTTGATTAACGAAGAGTG GCCCAATCATCATGTGGGATCTTTGTTCTTCATAGAAAGACAGATTCGCT TGTGCATCAGTGCGGGATTGTACCAGGAAGATACCCAGGAACTAGTTGCC TGGTGCATCAGGTCACAAGGCGGCTTCTTGGGCACCCTGCAAGTGAAAGA TTCTCACAAGCGTCGGGGATTTGGCAGTGTCGTGACGAGGGAAATGGCAT ACCGCATAGCCGCCCAGGGCCACGATGTAATGGCCCTCGTAAACCCCTGT AATAAGCCCTCGTCCGAAATGTTTAGCAAACTTGGCTTCCAGGTCATCGA CCAGTGCTATTGGCTAAGGACGGAACCCACCAGCGGCGAGTTCACCTGGC CCGAGGGCGAG
>D_melanogaster_CG5783-PA MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI KMYTLDAKQARDEGLFVIVDRYQLFVGCLNNTNGLVGKALDLLDWSSGLK CSSIPSRHIGALDSLVESKKLNLVYRDCTNLFFMKANDALKLKVEPPSGF VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA WCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPS NKPSSEMFSKLGFQVIDQCYWLRTEPTGGQFTWPEGE >D_sechellia_CG5783-PA MGTRLEVIGLKDVQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKADDALKLRVEPPTGF VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS NKPSSGMFSKLGFQVIDQCFWLRTEPTEGQFTWPEGE >D_simulans_CG5783-PA MGTRLEVIGLKDIQEFQQLYKQSWPKYCQEYYCLDNFVEFLKKQPHMRNI KMYTLDTKQARDEGLFVIVDRYQLFVGCLNNTNGLVRKALDLLDWSTGLK CSSIPSRHIGALDSLVESKKLDLVFRDCTNLFFMKAEDALKLRVEPPTGF VLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQEDTQELVA WCIRLQGGYLGALQVKDSHKRRGFGSVVTREIAYRLAAQGHDVMALVGPS NKPSSGMFSKLGFQVIEQCFWLRTEPTEGQFTWPEGE >D_yakuba_CG5783-PA MGTRLEVIGLKDIQQFQQLYKQNWPKYCQEYYCLDNFVSFLKKQPHMRNI QMYTLDTKQARDEGLFVIVDRYQLFVGCLTNTNGLVRSALELLDWSTGLK CSSIPSRHIDALDGLVESKRLELVFRDYTNLYFMKAEDALKLKVEPPDGF VLRPLSVADAPLVNDEWPNHHVGSLFFIERQIRLCVSVGLYQEDTQELVA WCIRLQGGYLGALQVKALHKRRGFGSVVTREIAYRLAAEGHDVMALVGPL NKPSSEMFSKLGFQVIDQCLWLRTEPTRGEFTWPEGE >D_erecta_CG5783-PA MGTRLEVIGLKDIQEFQQLYKQNWPKYCQEYYCLDNFVEFLKKQPHMRNI DMYTLDTKQARDEGLFVIVDRYQLFVGCLNNSSGLARTALDLLDWSTGLK CSSVPSRHMDALDSVVESKKLDLVFRDCTNLFYMKAEDALKLKVEPPVGF VLKSLSVADAPLINEEWPNHHVGSLFFIERQIRLCISAGLYQEDTQELVA WCIRSQGGFLGTLQVKDSHKRRGFGSVVTREMAYRIAAQGHDVMALVNPC NKPSSEMFSKLGFQVIDQCYWLRTEPTSGEFTWPEGE
#NEXUS
[ID: 0990728217]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_CG5783-PA
D_sechellia_CG5783-PA
D_simulans_CG5783-PA
D_yakuba_CG5783-PA
D_erecta_CG5783-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG5783-PA,
2 D_sechellia_CG5783-PA,
3 D_simulans_CG5783-PA,
4 D_yakuba_CG5783-PA,
5 D_erecta_CG5783-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05466589,(4:0.09632291,5:0.1092975)1.000:0.08447623,(2:0.01317787,3:0.01273862)0.748:0.01694994);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05466589,(4:0.09632291,5:0.1092975):0.08447623,(2:0.01317787,3:0.01273862):0.01694994);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2132.34 -2142.07
2 -2132.08 -2140.29
--------------------------------------
TOTAL -2132.20 -2141.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/171/CG5783-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.398826 0.003930 0.285083 0.522553 0.390663 981.36 1146.17 1.000
r(A<->C){all} 0.054093 0.000558 0.010339 0.100130 0.051956 845.92 942.39 1.000
r(A<->G){all} 0.273057 0.002259 0.189289 0.374165 0.270419 809.19 887.35 1.000
r(A<->T){all} 0.096206 0.000690 0.048363 0.147941 0.094515 923.51 931.13 1.000
r(C<->G){all} 0.078816 0.000614 0.031767 0.126020 0.077431 912.54 998.68 1.000
r(C<->T){all} 0.460920 0.003371 0.353784 0.579082 0.460301 826.82 841.62 1.000
r(G<->T){all} 0.036908 0.000345 0.002472 0.072354 0.034545 993.21 1000.76 1.002
pi(A){all} 0.267943 0.000198 0.241156 0.294808 0.267595 1258.16 1289.79 1.000
pi(C){all} 0.224327 0.000177 0.199433 0.251083 0.224333 1032.22 1149.19 1.000
pi(G){all} 0.261935 0.000201 0.233164 0.288810 0.262194 972.68 1052.99 1.000
pi(T){all} 0.245795 0.000186 0.219840 0.272478 0.245278 1091.12 1132.96 1.000
alpha{1,2} 0.127572 0.007008 0.000196 0.269962 0.121075 813.70 841.17 1.001
alpha{3} 1.348165 0.401093 0.385434 2.574776 1.224848 1156.06 1219.98 1.001
pinvar{all} 0.273197 0.016628 0.039348 0.511955 0.272184 762.56 806.21 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/171/CG5783-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 287
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 7 7 8 4 7 | Ser TCT 3 2 1 2 3 | Tyr TAT 2 2 2 3 4 | Cys TGT 0 0 0 0 2
TTC 7 9 8 10 8 | TCC 2 2 2 2 2 | TAC 9 7 7 8 6 | TGC 8 8 8 7 7
Leu TTA 4 3 3 3 3 | TCA 1 1 2 4 3 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 10 11 9 13 12 | TCG 5 5 5 1 3 | TAG 0 0 0 0 0 | Trp TGG 6 6 6 6 6
----------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 5 4 | Pro CCT 1 0 1 1 1 | His CAT 3 2 2 2 3 | Arg CGT 0 1 2 1 1
CTC 3 3 3 3 5 | CCC 6 8 7 8 8 | CAC 3 4 4 4 3 | CGC 4 4 3 3 4
CTA 4 4 4 5 2 | CCA 3 2 2 2 1 | Gln CAA 8 9 9 6 5 | CGA 2 1 1 2 0
CTG 11 11 13 9 6 | CCG 1 1 1 1 1 | CAG 9 8 8 11 11 | CGG 0 0 0 0 2
----------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 6 4 4 | Thr ACT 2 3 3 1 1 | Asn AAT 5 3 3 2 5 | Ser AGT 5 5 4 3 4
ATC 2 1 2 4 4 | ACC 2 1 1 5 4 | AAC 7 6 6 7 5 | AGC 1 2 3 2 4
ATA 3 3 2 3 3 | ACA 3 4 4 3 3 | Lys AAA 12 11 11 10 11 | Arg AGA 2 4 5 4 4
Met ATG 6 6 6 6 8 | ACG 3 4 4 3 4 | AAG 7 7 7 5 6 | AGG 6 6 5 8 4
----------------------------------------------------------------------------------------------------------------------
Val GTT 7 5 5 6 5 | Ala GCT 4 6 4 6 4 | Asp GAT 11 11 11 8 11 | Gly GGT 7 8 5 6 5
GTC 5 6 5 3 3 | GCC 6 5 7 6 7 | GAC 4 6 4 8 7 | GGC 7 7 9 9 8
GTA 3 3 3 5 6 | GCA 4 2 2 2 2 | Glu GAA 10 9 10 9 13 | GGA 6 3 4 5 5
GTG 8 9 9 8 7 | GCG 0 1 1 0 1 | GAG 7 8 9 10 6 | GGG 2 3 3 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG5783-PA
position 1: T:0.22300 C:0.21254 A:0.24739 G:0.31707
position 2: T:0.30662 C:0.16028 A:0.33798 G:0.19512
position 3: T:0.22648 C:0.26481 A:0.22648 G:0.28223
Average T:0.25203 C:0.21254 A:0.27062 G:0.26481
#2: D_sechellia_CG5783-PA
position 1: T:0.21951 C:0.21254 A:0.24739 G:0.32056
position 2: T:0.31010 C:0.16376 A:0.32404 G:0.20209
position 3: T:0.21951 C:0.27526 A:0.20557 G:0.29965
Average T:0.24971 C:0.21719 A:0.25900 G:0.27410
#3: D_simulans_CG5783-PA
position 1: T:0.21254 C:0.21951 A:0.25087 G:0.31707
position 2: T:0.31010 C:0.16376 A:0.32404 G:0.20209
position 3: T:0.20906 C:0.27526 A:0.21603 G:0.29965
Average T:0.24390 C:0.21951 A:0.26365 G:0.27294
#4: D_yakuba_CG5783-PA
position 1: T:0.21951 C:0.21951 A:0.24390 G:0.31707
position 2: T:0.31707 C:0.16376 A:0.32404 G:0.19512
position 3: T:0.18815 C:0.31010 A:0.21951 G:0.28223
Average T:0.24158 C:0.23113 A:0.26249 G:0.26481
#5: D_erecta_CG5783-PA
position 1: T:0.22997 C:0.19861 A:0.25784 G:0.31359
position 2: T:0.30314 C:0.16725 A:0.33449 G:0.19512
position 3: T:0.22300 C:0.29617 A:0.21254 G:0.26829
Average T:0.25203 C:0.22067 A:0.26829 G:0.25900
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 33 | Ser S TCT 11 | Tyr Y TAT 13 | Cys C TGT 2
TTC 42 | TCC 10 | TAC 37 | TGC 38
Leu L TTA 16 | TCA 11 | *** * TAA 0 | *** * TGA 0
TTG 55 | TCG 19 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 4 | His H CAT 12 | Arg R CGT 5
CTC 17 | CCC 37 | CAC 18 | CGC 18
CTA 19 | CCA 10 | Gln Q CAA 37 | CGA 6
CTG 50 | CCG 5 | CAG 47 | CGG 2
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 10 | Asn N AAT 18 | Ser S AGT 21
ATC 13 | ACC 13 | AAC 31 | AGC 12
ATA 14 | ACA 17 | Lys K AAA 55 | Arg R AGA 19
Met M ATG 32 | ACG 18 | AAG 32 | AGG 29
------------------------------------------------------------------------------
Val V GTT 28 | Ala A GCT 24 | Asp D GAT 52 | Gly G GGT 31
GTC 22 | GCC 31 | GAC 29 | GGC 40
GTA 20 | GCA 12 | Glu E GAA 51 | GGA 23
GTG 41 | GCG 3 | GAG 40 | GGG 8
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22091 C:0.21254 A:0.24948 G:0.31707
position 2: T:0.30941 C:0.16376 A:0.32892 G:0.19791
position 3: T:0.21324 C:0.28432 A:0.21603 G:0.28641
Average T:0.24785 C:0.22021 A:0.26481 G:0.26713
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG5783-PA
D_sechellia_CG5783-PA 0.1311 (0.0237 0.1806)
D_simulans_CG5783-PA 0.1404 (0.0253 0.1799) 0.0563 (0.0045 0.0805)
D_yakuba_CG5783-PA 0.1440 (0.0612 0.4249) 0.1305 (0.0538 0.4125) 0.1420 (0.0523 0.3681)
D_erecta_CG5783-PA 0.1298 (0.0600 0.4619) 0.1224 (0.0580 0.4742) 0.1358 (0.0565 0.4158) 0.2238 (0.0674 0.3011)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 179
lnL(ntime: 7 np: 9): -2063.709282 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.106281 0.140008 0.181832 0.207107 0.048527 0.033516 0.031529 2.540998 0.194398
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.74880
(1: 0.106281, (4: 0.181832, 5: 0.207107): 0.140008, (2: 0.033516, 3: 0.031529): 0.048527);
(D_melanogaster_CG5783-PA: 0.106281, (D_yakuba_CG5783-PA: 0.181832, D_erecta_CG5783-PA: 0.207107): 0.140008, (D_sechellia_CG5783-PA: 0.033516, D_simulans_CG5783-PA: 0.031529): 0.048527);
Detailed output identifying parameters
kappa (ts/tv) = 2.54100
omega (dN/dS) = 0.19440
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.106 626.5 234.5 0.1944 0.0166 0.0856 10.4 20.1
6..7 0.140 626.5 234.5 0.1944 0.0219 0.1128 13.7 26.4
7..4 0.182 626.5 234.5 0.1944 0.0285 0.1465 17.8 34.3
7..5 0.207 626.5 234.5 0.1944 0.0324 0.1668 20.3 39.1
6..8 0.049 626.5 234.5 0.1944 0.0076 0.0391 4.8 9.2
8..2 0.034 626.5 234.5 0.1944 0.0052 0.0270 3.3 6.3
8..3 0.032 626.5 234.5 0.1944 0.0049 0.0254 3.1 6.0
tree length for dN: 0.1172
tree length for dS: 0.6031
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 179
lnL(ntime: 7 np: 10): -2051.183392 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.108539 0.147884 0.186188 0.212343 0.047892 0.033485 0.031751 2.512475 0.877441 0.084314
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.76808
(1: 0.108539, (4: 0.186188, 5: 0.212343): 0.147884, (2: 0.033485, 3: 0.031751): 0.047892);
(D_melanogaster_CG5783-PA: 0.108539, (D_yakuba_CG5783-PA: 0.186188, D_erecta_CG5783-PA: 0.212343): 0.147884, (D_sechellia_CG5783-PA: 0.033485, D_simulans_CG5783-PA: 0.031751): 0.047892);
Detailed output identifying parameters
kappa (ts/tv) = 2.51248
dN/dS (w) for site classes (K=2)
p: 0.87744 0.12256
w: 0.08431 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.109 626.9 234.1 0.1965 0.0171 0.0872 10.7 20.4
6..7 0.148 626.9 234.1 0.1965 0.0233 0.1188 14.6 27.8
7..4 0.186 626.9 234.1 0.1965 0.0294 0.1496 18.4 35.0
7..5 0.212 626.9 234.1 0.1965 0.0335 0.1706 21.0 39.9
6..8 0.048 626.9 234.1 0.1965 0.0076 0.0385 4.7 9.0
8..2 0.033 626.9 234.1 0.1965 0.0053 0.0269 3.3 6.3
8..3 0.032 626.9 234.1 0.1965 0.0050 0.0255 3.1 6.0
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 179
lnL(ntime: 7 np: 12): -2050.034048 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.109795 0.151116 0.189510 0.217534 0.047765 0.033353 0.031736 2.613699 0.944861 0.000000 0.116784 2.079044
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.78081
(1: 0.109795, (4: 0.189510, 5: 0.217534): 0.151116, (2: 0.033353, 3: 0.031736): 0.047765);
(D_melanogaster_CG5783-PA: 0.109795, (D_yakuba_CG5783-PA: 0.189510, D_erecta_CG5783-PA: 0.217534): 0.151116, (D_sechellia_CG5783-PA: 0.033353, D_simulans_CG5783-PA: 0.031736): 0.047765);
Detailed output identifying parameters
kappa (ts/tv) = 2.61370
dN/dS (w) for site classes (K=3)
p: 0.94486 0.00000 0.05514
w: 0.11678 1.00000 2.07904
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.110 625.3 235.7 0.2250 0.0188 0.0837 11.8 19.7
6..7 0.151 625.3 235.7 0.2250 0.0259 0.1152 16.2 27.2
7..4 0.190 625.3 235.7 0.2250 0.0325 0.1445 20.3 34.1
7..5 0.218 625.3 235.7 0.2250 0.0373 0.1659 23.3 39.1
6..8 0.048 625.3 235.7 0.2250 0.0082 0.0364 5.1 8.6
8..2 0.033 625.3 235.7 0.2250 0.0057 0.0254 3.6 6.0
8..3 0.032 625.3 235.7 0.2250 0.0054 0.0242 3.4 5.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5783-PA)
Pr(w>1) post mean +- SE for w
39 E 0.748 1.584
51 K 0.956* 1.993
88 K 0.773 1.633
122 N 0.606 1.306
137 N 0.947 1.975
148 S 0.999** 2.077
165 A 0.666 1.424
218 T 0.856 1.797
248 G 0.594 1.282
250 S 0.961* 2.003
270 Y 0.980* 2.040
278 G 0.982* 2.043
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5783-PA)
Pr(w>1) post mean +- SE for w
51 K 0.510 1.868 +- 1.309
137 N 0.509 1.898 +- 1.382
148 S 0.851 2.793 +- 1.497
218 T 0.549 2.021 +- 1.595
250 S 0.663 2.313 +- 1.504
270 Y 0.682 2.388 +- 1.515
278 G 0.720 2.499 +- 1.538
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.309 0.691 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.278 0.316 0.221 0.106 0.045 0.019 0.008 0.004 0.002 0.001
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009 0.216
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.016 0.077 0.677
sum of density on p0-p1 = 1.000000
Time used: 0:19
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 179
check convergence..
lnL(ntime: 7 np: 13): -2050.034048 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.109795 0.151116 0.189510 0.217534 0.047765 0.033353 0.031736 2.613699 0.311194 0.633667 0.116784 0.116784 2.079045
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.78081
(1: 0.109795, (4: 0.189510, 5: 0.217534): 0.151116, (2: 0.033353, 3: 0.031736): 0.047765);
(D_melanogaster_CG5783-PA: 0.109795, (D_yakuba_CG5783-PA: 0.189510, D_erecta_CG5783-PA: 0.217534): 0.151116, (D_sechellia_CG5783-PA: 0.033353, D_simulans_CG5783-PA: 0.031736): 0.047765);
Detailed output identifying parameters
kappa (ts/tv) = 2.61370
dN/dS (w) for site classes (K=3)
p: 0.31119 0.63367 0.05514
w: 0.11678 0.11678 2.07904
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.110 625.3 235.7 0.2250 0.0188 0.0837 11.8 19.7
6..7 0.151 625.3 235.7 0.2250 0.0259 0.1152 16.2 27.2
7..4 0.190 625.3 235.7 0.2250 0.0325 0.1445 20.3 34.1
7..5 0.218 625.3 235.7 0.2250 0.0373 0.1659 23.3 39.1
6..8 0.048 625.3 235.7 0.2250 0.0082 0.0364 5.1 8.6
8..2 0.033 625.3 235.7 0.2250 0.0057 0.0254 3.6 6.0
8..3 0.032 625.3 235.7 0.2250 0.0054 0.0242 3.4 5.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5783-PA)
Pr(w>1) post mean +- SE for w
39 E 0.748 1.584
51 K 0.956* 1.993
88 K 0.773 1.633
122 N 0.606 1.306
137 N 0.947 1.975
148 S 0.999** 2.077
165 A 0.666 1.424
218 T 0.856 1.797
248 G 0.594 1.282
250 S 0.961* 2.003
270 Y 0.980* 2.040
278 G 0.982* 2.043
Time used: 0:27
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 179
lnL(ntime: 7 np: 10): -2052.518274 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.108619 0.147719 0.185655 0.210796 0.047585 0.033564 0.031760 2.542566 0.177941 0.692365
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.76570
(1: 0.108619, (4: 0.185655, 5: 0.210796): 0.147719, (2: 0.033564, 3: 0.031760): 0.047585);
(D_melanogaster_CG5783-PA: 0.108619, (D_yakuba_CG5783-PA: 0.185655, D_erecta_CG5783-PA: 0.210796): 0.147719, (D_sechellia_CG5783-PA: 0.033564, D_simulans_CG5783-PA: 0.031760): 0.047585);
Detailed output identifying parameters
kappa (ts/tv) = 2.54257
Parameters in M7 (beta):
p = 0.17794 q = 0.69236
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00004 0.00073 0.00485 0.01984 0.06062 0.15111 0.32036 0.58442 0.89666
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.109 626.4 234.6 0.2039 0.0175 0.0861 11.0 20.2
6..7 0.148 626.4 234.6 0.2039 0.0239 0.1170 14.9 27.4
7..4 0.186 626.4 234.6 0.2039 0.0300 0.1471 18.8 34.5
7..5 0.211 626.4 234.6 0.2039 0.0340 0.1670 21.3 39.2
6..8 0.048 626.4 234.6 0.2039 0.0077 0.0377 4.8 8.8
8..2 0.034 626.4 234.6 0.2039 0.0054 0.0266 3.4 6.2
8..3 0.032 626.4 234.6 0.2039 0.0051 0.0252 3.2 5.9
Time used: 0:43
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 179
lnL(ntime: 7 np: 12): -2050.055066 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.109839 0.151119 0.189550 0.217563 0.047738 0.033357 0.031736 2.615005 0.945938 13.291771 99.000000 2.099593
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.78090
(1: 0.109839, (4: 0.189550, 5: 0.217563): 0.151119, (2: 0.033357, 3: 0.031736): 0.047738);
(D_melanogaster_CG5783-PA: 0.109839, (D_yakuba_CG5783-PA: 0.189550, D_erecta_CG5783-PA: 0.217563): 0.151119, (D_sechellia_CG5783-PA: 0.033357, D_simulans_CG5783-PA: 0.031736): 0.047738);
Detailed output identifying parameters
kappa (ts/tv) = 2.61501
Parameters in M8 (beta&w>1):
p0 = 0.94594 p = 13.29177 q = 99.00000
(p1 = 0.05406) w = 2.09959
dN/dS (w) for site classes (K=11)
p: 0.09459 0.09459 0.09459 0.09459 0.09459 0.09459 0.09459 0.09459 0.09459 0.09459 0.05406
w: 0.07258 0.08722 0.09674 0.10478 0.11234 0.11994 0.12810 0.13754 0.14988 0.17190 2.09959
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.110 625.3 235.7 0.2252 0.0189 0.0837 11.8 19.7
6..7 0.151 625.3 235.7 0.2252 0.0259 0.1152 16.2 27.1
7..4 0.190 625.3 235.7 0.2252 0.0325 0.1445 20.3 34.1
7..5 0.218 625.3 235.7 0.2252 0.0373 0.1658 23.4 39.1
6..8 0.048 625.3 235.7 0.2252 0.0082 0.0364 5.1 8.6
8..2 0.033 625.3 235.7 0.2252 0.0057 0.0254 3.6 6.0
8..3 0.032 625.3 235.7 0.2252 0.0054 0.0242 3.4 5.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5783-PA)
Pr(w>1) post mean +- SE for w
39 E 0.732 1.572
51 K 0.948 1.997
88 K 0.758 1.623
122 N 0.586 1.285
137 N 0.937 1.976
148 S 0.999** 2.097
165 A 0.647 1.405
218 T 0.846 1.797
248 G 0.573 1.259
250 S 0.957* 2.015
270 Y 0.976* 2.052
278 G 0.978* 2.057
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5783-PA)
Pr(w>1) post mean +- SE for w
39 E 0.502 1.412 +- 1.067
51 K 0.641 1.665 +- 1.014
88 K 0.515 1.426 +- 1.047
137 N 0.623 1.645 +- 1.037
148 S 0.909 2.163 +- 0.990
218 T 0.629 1.684 +- 1.131
250 S 0.750 1.896 +- 1.070
270 Y 0.763 1.924 +- 1.064
278 G 0.785 1.971 +- 1.068
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.017 0.983
p : 0.582 0.411 0.007 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.039 0.128 0.139 0.108 0.091 0.112 0.163 0.220
ws: 0.469 0.373 0.113 0.031 0.009 0.003 0.001 0.000 0.000 0.000
Time used: 1:28
Model 1: NearlyNeutral -2051.183392 Model 2: PositiveSelection -2050.034048 Model 0: one-ratio -2063.709282 Model 3: discrete -2050.034048 Model 7: beta -2052.518274 Model 8: beta&w>1 -2050.055066 Model 0 vs 1 25.05177999999978 Model 2 vs 1 2.2986879999998564 Model 8 vs 7 4.926416000000245
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
