--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 08 09:54:59 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/171/CG5780-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1832.45 -1843.38
2 -1832.43 -1841.68
--------------------------------------
TOTAL -1832.44 -1842.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.846188 0.012211 0.644539 1.073575 0.842553 1170.23 1335.61 1.001
r(A<->C){all} 0.089270 0.000875 0.033256 0.148649 0.086731 756.22 844.38 1.000
r(A<->G){all} 0.264636 0.002905 0.163336 0.369801 0.261354 653.85 714.56 1.004
r(A<->T){all} 0.140183 0.001519 0.073129 0.225351 0.137559 726.63 783.95 1.000
r(C<->G){all} 0.029796 0.000267 0.000001 0.059650 0.028111 978.62 1048.21 1.000
r(C<->T){all} 0.427524 0.003930 0.316969 0.560151 0.424281 634.58 715.50 1.003
r(G<->T){all} 0.048592 0.000494 0.005419 0.090241 0.046661 873.12 924.88 1.000
pi(A){all} 0.258112 0.000240 0.230352 0.288733 0.257727 1137.41 1184.02 1.000
pi(C){all} 0.273330 0.000230 0.244286 0.304597 0.273713 1125.31 1146.07 1.000
pi(G){all} 0.248965 0.000223 0.220335 0.278235 0.248794 1122.51 1136.55 1.000
pi(T){all} 0.219593 0.000195 0.192116 0.246307 0.219441 1256.76 1338.80 1.000
alpha{1,2} 0.054787 0.000901 0.000114 0.100545 0.056775 878.98 1057.53 1.000
alpha{3} 3.191450 0.883497 1.568388 5.067614 3.052710 1267.23 1268.26 1.000
pinvar{all} 0.380973 0.003162 0.275629 0.490988 0.382214 1054.52 1223.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1697.654063
Model 2: PositiveSelection -1697.654063
Model 0: one-ratio -1702.386964
Model 3: discrete -1697.648436
Model 7: beta -1698.932663
Model 8: beta&w>1 -1697.673616
Model 0 vs 1 9.465802000000167
Model 2 vs 1 0.0
Model 8 vs 7 2.518094000000019
>C1
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAAGGSKDISIDITLNV
QAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNSF
DDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSRSA
VLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKLFT
EVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
>C2
MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAAGGSKDISIDITLNV
QAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKNSF
DDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSRSA
VLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKLFT
EVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
>C3
MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAPAGSKDISIDITLNV
QAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNNS
FDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSRS
AVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQLF
TEVTAEIHSDKAPIIGMKIGPDVVPPTQYo
>C4
MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAPAGSKDISIDITLNV
QAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNNS
FDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSRS
AVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKLF
TEVTAEIHSDKAPNNGMKIGPDVVPPTQYo
>C5
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNS
FDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSRS
AVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKLF
TEVTAEIHSDKVPNIGMKIGPDVVPPTQYS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=232
C1 MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAA-GGSKDISIDITLN
C2 MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAA-GGSKDISIDITLN
C3 MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAP-AGSKDISIDITLN
C4 MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAP-AGSKDISIDITLN
C5 MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
*****************************:: **. .************
C1 VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
C2 VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKN-
C3 VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
C4 VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
C5 VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
****:*********:*************************:********
C1 SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
C2 SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
C3 SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
C4 SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
C5 SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
*******:*********************:***************:****
C1 SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
C2 SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
C3 SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
C4 SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
C5 SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
*********:****************:***********.*********:*
C1 FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
C2 FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
C3 FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo-
C4 FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo-
C5 FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS-
************.* ********:*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 230 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 230 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4722]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4722]--->[4716]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.278 Mb, Max= 30.541 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAA-GGSKDISIDITLN
VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
>C2
MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAA-GGSKDISIDITLN
VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKN-
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
>C3
MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAP-AGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo-
>C4
MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAP-AGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo-
>C5
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS-
FORMAT of file /tmp/tmp4200578742652130796aln Not Supported[FATAL:T-COFFEE]
>C1
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAA-GGSKDISIDITLN
VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
>C2
MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAA-GGSKDISIDITLN
VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKN-
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
>C3
MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAP-AGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo-
>C4
MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAP-AGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo-
>C5
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS-
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:232 S:99 BS:232
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 96.96 C1 C2 96.96
TOP 1 0 96.96 C2 C1 96.96
BOT 0 2 92.58 C1 C3 92.58
TOP 2 0 92.58 C3 C1 92.58
BOT 0 3 95.20 C1 C4 95.20
TOP 3 0 95.20 C4 C1 95.20
BOT 0 4 95.63 C1 C5 95.63
TOP 4 0 95.63 C5 C1 95.63
BOT 1 2 93.01 C2 C3 93.01
TOP 2 1 93.01 C3 C2 93.01
BOT 1 3 95.20 C2 C4 95.20
TOP 3 1 95.20 C4 C2 95.20
BOT 1 4 95.63 C2 C5 95.63
TOP 4 1 95.63 C5 C2 95.63
BOT 2 3 96.96 C3 C4 96.96
TOP 3 2 96.96 C4 C3 96.96
BOT 2 4 94.76 C3 C5 94.76
TOP 4 2 94.76 C5 C3 94.76
BOT 3 4 96.94 C4 C5 96.94
TOP 4 3 96.94 C5 C4 96.94
AVG 0 C1 * 95.09
AVG 1 C2 * 95.20
AVG 2 C3 * 94.33
AVG 3 C4 * 96.07
AVG 4 C5 * 95.74
TOT TOT * 95.29
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
C2 ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
C3 ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
C4 ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCCG
C5 ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCCG
**************.*********************************.*
C1 GAAGGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGAGGAGGATGTCC
C2 GAAAGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGATGAGGATTCCC
C3 GAAGGGCCGGCGCTCCAAGAGCCGCGATGTCTTGAAGGAGGACTCCTCGC
C4 AAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGTCCTCGC
C5 GAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGGCCACGC
.**.** ************** ******** ******* ** . *
C1 AGGCGGCT---GGGGGCTCCAAGGACATTTCCATCGACATTACGCTGAAT
C2 AGGCGGCC---GGTGGCTCCAAGGACATTTCCATCGACATCACTCTGAAT
C3 AGGCGCCC---GCAGGCTCCAAGGACATTTCCATCGACATCACCCTGAAT
C4 AGGCGCCT---GCAGGCTCCAAGGATATTTCCATCGATATCACCCTGAAT
C5 AGGCGGCTCCTGCAGGCTCCAAGGATATTTCCATCGACATCACCCTGAAC
***** * * *********** *********** ** ** *****
C1 GTCCAGGCGGGCACCCCACCGACCACCTCGGACACGGCCACCTCGTCCAC
C2 GTTCAGGCGGGTACCCCACCCACCACATCGGACACGGCCACCACGTCCAC
C3 GTCCAGGCAGGCTCTCCGCCCACAACCTCGGACACGGCCACCTCGTCCAC
C4 GTCCAGGCAGGATCTCCACCCACAACCTCGGACACGGCCACCTCGTCCAC
C5 GTCCAGGCAGGATCGCCACCCACCACTTCGGATACGGCCACCTCGTCCAC
** *****.** :* **.** **.** ***** *********:*******
C1 ATACAACAATGAATTCGAGTCACATCGACCACCCATTCGTCGCATTTCAG
C2 ATATAACAATGAATTCGAGTCCCATCGACCACCCATTCGTCGCATTTCGG
C3 CTACAACAATGAATTCGAGTCGCACCGACCGCCCATCCGTCGGATTTCGG
C4 CTACAACAATGAATTCGAGTCGCATCGTCCACCCATTAGGCGGATCTCGG
C5 CTACAACAATGAGTTCGAGTCGCATCGTCCACCCATTCGACGAATTTCGG
.** ********.******** ** **:**.***** .* ** ** **.*
C1 GTGGCTGGGCGGATTCTGGACTCAAAGGATTAAAGTCCAAGAAAAAC---
C2 GTGGCTGGGCGGATTCCGGATTCAAGGGATTAAAGTCCAAGAAAAAC---
C3 GAGGTTGGGCGGATTCGGGACTGAAGGGGTTAAAGTCCAAGAAGAACAAC
C4 GAGGCTGGGCGGATTCGGGTCTAAAGGGGTTAAAGTCCAAGAAGAACAAC
C5 GAGGTTGGGCCGATTCTGGTCTAAAGGGATTGAAGTCCAAGAAGAAC---
*:** ***** ***** **: * **.**.**.***********.***
C1 TCCTTTGATGATGAGCGCTTTAAACAAACAAAGTCGGCTACAAATTCCAT
C2 TCATTCGACGATGAGCGTTTTAGGCAAACAAAGTCGGCTACAAATTCCAT
C3 TCCTTTGATGACGAGCGTTTCAGGCAAACCAAGTCTGCTACAAATTCCAT
C4 TCCTTTGATGACGAACGTTTTAGGCAAACCAAGTCTGCTACAAATTCTAT
C5 TCATTTGACGACGAACGTTTTAGGCAGACCAAGTCGGCTACAAATTCAAT
**.** ** ** **.** ** *..**.**.***** *********** **
C1 ACCAACGGATGACATTCCCGTCATCCCAGACATGGATGATGTCAAGGACG
C2 ACCAACGGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAGGACG
C3 TCCTACTGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAAGATG
C4 ACCTACTGATGACATTCCCGTCATTCCCGACATGGATGATGTTAAAGACG
C5 ACCGACGGATGACATTCCCGTCATCCCAGATATGGATGAAGTCAAGGATG
:** ** ***************** **.** ********:** **.** *
C1 AAATCATGCTCAATGAGATTGTAGAACCGCCAACTATTGGCACCTCACGA
C2 AAATCATGCTCAATGAGATTGTGGAGCCGCCTACTATCGGCACCTCGCGA
C3 AAATTATGCTCAATGAGATAGTGGAACCTCCTACTATGGGCACTTCTCGA
C4 AAATAATGCTTAATGAGATAGTAGAACCTCCTACTATGGGCACTTCTCGA
C5 AAATAATGCTCAATGAGATTGTGGAACCGCCTACCATGGGCACTTCACGT
**** ***** ********:**.**.** **:** ** ***** ** **:
C1 TCTGCTGTTTTGAAGGAGGCCAATTCCGATTTGCTTTCCCAGTACGCCTT
C2 TCCGCCGTCTTGAAGGAGGCCAATTCCGATTTGCTCTCTCAGTACGCATT
C3 TCCGCTGTCCTAAAGGAGGCCAATTCCGAGTTGCTTTCCCAGTACGCCTT
C4 TCTGCTGTCTTAAAGGAGGCCAATTCCGATTTGCTTTCTCAGTACGCCTT
C5 TCTGCTGTCTTGAAGGAGGCCAATTCCGATTTACTTTCCCAGTACGCCTT
** ** ** *.***************** **.** ** ********.**
C1 TTCAGCTGTGGATGGCTTTGATCTCTCAATCCTCACCGATTGCCTGGTTC
C2 TTCGGCTGTGGATGGCTTTGATCTCTCTATTCTAACCGATTGCCTAGTTC
C3 TTCTGCAGTGGACGGCTTCGATCTCTCAGTCCTAACAGACTGCCTGGTTC
C4 TTCTGCAGTGGACGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC
C5 TTCCGCAGTGGATGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC
*** **:***** ***** ********:.* **.**.** *****.****
C1 CACAGGAGAGCCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAGCTG
C2 CACAGGAGAGCCTCAACGAGAAAGATGATCTCTGGCAGTGGGACAAACTG
C3 CACAGGAGAGTCTCAGCGAGAAGGACGATCTCTGGCAGTGGGACCAGCTC
C4 CGCAGGAGAGCCTCAATGAGAAGGACGACCTCTGGCAATGGGACAAACTC
C5 CGCAGGAGAGTCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAACTC
*.******** ****. *****.** ** ********.******.*.**
C1 TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATGGG
C2 TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATTGG
C3 TTTACCGAGGTCACGGCCGAAATCCATTCGGATAAGGCGCCCATCATAGG
C4 TTCACCGAGGTCACGGCAGAAATCCATTCGGATAAGGCACCAAACAATGG
C5 TTTACCGAGGTCACGGCTGAAATCCATTCGGATAAGGTGCCGAATATAGG
** ************** *****************.* .** *: *: **
C1 CATGAAAATAGGACCCGATGTGATTCCACCCACACAATATACT---
C2 CATGAAGATTGGACCCGATGTGGTTCCACCCACACAATATACT---
C3 CATGAAGATAGGACCTGATGTCGTACCCCCGACACAATAT------
C4 CATGAAGATAGGCCCTGATGTCGTACCCCCCACACAATAT------
C5 CATGAAGATAGGCCCCGATGTCGTTCCGCCCACACAATATTCT---
******.**:**.** ***** .*:** ** *********
>C1
ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
GAAGGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGAGGAGGATGTCC
AGGCGGCT---GGGGGCTCCAAGGACATTTCCATCGACATTACGCTGAAT
GTCCAGGCGGGCACCCCACCGACCACCTCGGACACGGCCACCTCGTCCAC
ATACAACAATGAATTCGAGTCACATCGACCACCCATTCGTCGCATTTCAG
GTGGCTGGGCGGATTCTGGACTCAAAGGATTAAAGTCCAAGAAAAAC---
TCCTTTGATGATGAGCGCTTTAAACAAACAAAGTCGGCTACAAATTCCAT
ACCAACGGATGACATTCCCGTCATCCCAGACATGGATGATGTCAAGGACG
AAATCATGCTCAATGAGATTGTAGAACCGCCAACTATTGGCACCTCACGA
TCTGCTGTTTTGAAGGAGGCCAATTCCGATTTGCTTTCCCAGTACGCCTT
TTCAGCTGTGGATGGCTTTGATCTCTCAATCCTCACCGATTGCCTGGTTC
CACAGGAGAGCCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAGCTG
TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATGGG
CATGAAAATAGGACCCGATGTGATTCCACCCACACAATATACT---
>C2
ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
GAAAGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGATGAGGATTCCC
AGGCGGCC---GGTGGCTCCAAGGACATTTCCATCGACATCACTCTGAAT
GTTCAGGCGGGTACCCCACCCACCACATCGGACACGGCCACCACGTCCAC
ATATAACAATGAATTCGAGTCCCATCGACCACCCATTCGTCGCATTTCGG
GTGGCTGGGCGGATTCCGGATTCAAGGGATTAAAGTCCAAGAAAAAC---
TCATTCGACGATGAGCGTTTTAGGCAAACAAAGTCGGCTACAAATTCCAT
ACCAACGGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAGGACG
AAATCATGCTCAATGAGATTGTGGAGCCGCCTACTATCGGCACCTCGCGA
TCCGCCGTCTTGAAGGAGGCCAATTCCGATTTGCTCTCTCAGTACGCATT
TTCGGCTGTGGATGGCTTTGATCTCTCTATTCTAACCGATTGCCTAGTTC
CACAGGAGAGCCTCAACGAGAAAGATGATCTCTGGCAGTGGGACAAACTG
TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATTGG
CATGAAGATTGGACCCGATGTGGTTCCACCCACACAATATACT---
>C3
ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
GAAGGGCCGGCGCTCCAAGAGCCGCGATGTCTTGAAGGAGGACTCCTCGC
AGGCGCCC---GCAGGCTCCAAGGACATTTCCATCGACATCACCCTGAAT
GTCCAGGCAGGCTCTCCGCCCACAACCTCGGACACGGCCACCTCGTCCAC
CTACAACAATGAATTCGAGTCGCACCGACCGCCCATCCGTCGGATTTCGG
GAGGTTGGGCGGATTCGGGACTGAAGGGGTTAAAGTCCAAGAAGAACAAC
TCCTTTGATGACGAGCGTTTCAGGCAAACCAAGTCTGCTACAAATTCCAT
TCCTACTGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAAGATG
AAATTATGCTCAATGAGATAGTGGAACCTCCTACTATGGGCACTTCTCGA
TCCGCTGTCCTAAAGGAGGCCAATTCCGAGTTGCTTTCCCAGTACGCCTT
TTCTGCAGTGGACGGCTTCGATCTCTCAGTCCTAACAGACTGCCTGGTTC
CACAGGAGAGTCTCAGCGAGAAGGACGATCTCTGGCAGTGGGACCAGCTC
TTTACCGAGGTCACGGCCGAAATCCATTCGGATAAGGCGCCCATCATAGG
CATGAAGATAGGACCTGATGTCGTACCCCCGACACAATAT------
>C4
ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCCG
AAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGTCCTCGC
AGGCGCCT---GCAGGCTCCAAGGATATTTCCATCGATATCACCCTGAAT
GTCCAGGCAGGATCTCCACCCACAACCTCGGACACGGCCACCTCGTCCAC
CTACAACAATGAATTCGAGTCGCATCGTCCACCCATTAGGCGGATCTCGG
GAGGCTGGGCGGATTCGGGTCTAAAGGGGTTAAAGTCCAAGAAGAACAAC
TCCTTTGATGACGAACGTTTTAGGCAAACCAAGTCTGCTACAAATTCTAT
ACCTACTGATGACATTCCCGTCATTCCCGACATGGATGATGTTAAAGACG
AAATAATGCTTAATGAGATAGTAGAACCTCCTACTATGGGCACTTCTCGA
TCTGCTGTCTTAAAGGAGGCCAATTCCGATTTGCTTTCTCAGTACGCCTT
TTCTGCAGTGGACGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC
CGCAGGAGAGCCTCAATGAGAAGGACGACCTCTGGCAATGGGACAAACTC
TTCACCGAGGTCACGGCAGAAATCCATTCGGATAAGGCACCAAACAATGG
CATGAAGATAGGCCCTGATGTCGTACCCCCCACACAATAT------
>C5
ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCCG
GAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGGCCACGC
AGGCGGCTCCTGCAGGCTCCAAGGATATTTCCATCGACATCACCCTGAAC
GTCCAGGCAGGATCGCCACCCACCACTTCGGATACGGCCACCTCGTCCAC
CTACAACAATGAGTTCGAGTCGCATCGTCCACCCATTCGACGAATTTCGG
GAGGTTGGGCCGATTCTGGTCTAAAGGGATTGAAGTCCAAGAAGAAC---
TCATTTGACGACGAACGTTTTAGGCAGACCAAGTCGGCTACAAATTCAAT
ACCGACGGATGACATTCCCGTCATCCCAGATATGGATGAAGTCAAGGATG
AAATAATGCTCAATGAGATTGTGGAACCGCCTACCATGGGCACTTCACGT
TCTGCTGTCTTGAAGGAGGCCAATTCCGATTTACTTTCCCAGTACGCCTT
TTCCGCAGTGGATGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC
CGCAGGAGAGTCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAACTC
TTTACCGAGGTCACGGCTGAAATCCATTCGGATAAGGTGCCGAATATAGG
CATGAAGATAGGCCCCGATGTCGTTCCGCCCACACAATATTCT---
>C1
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAAoGGSKDISIDITLN
VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNo
SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYT
>C2
MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAAoGGSKDISIDITLN
VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKNo
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYT
>C3
MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAPoAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo
>C4
MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAPoAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo
>C5
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNo
SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 696 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478598574
Setting output file names to "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1101435072
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0990564390
Seed = 1849756579
Swapseed = 1478598574
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 21 unique site patterns
Division 2 has 16 unique site patterns
Division 3 has 89 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2160.549775 -- -25.624409
Chain 2 -- -2060.629841 -- -25.624409
Chain 3 -- -2099.847526 -- -25.624409
Chain 4 -- -2153.901963 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2150.212845 -- -25.624409
Chain 2 -- -2071.951140 -- -25.624409
Chain 3 -- -2157.862171 -- -25.624409
Chain 4 -- -2164.991905 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2160.550] (-2060.630) (-2099.848) (-2153.902) * [-2150.213] (-2071.951) (-2157.862) (-2164.992)
500 -- [-1934.122] (-1926.281) (-1932.142) (-1923.955) * (-1921.988) [-1919.800] (-1940.317) (-1929.118) -- 0:33:19
1000 -- (-1908.171) [-1910.120] (-1910.194) (-1911.889) * (-1923.412) [-1905.597] (-1926.474) (-1916.742) -- 0:16:39
1500 -- [-1870.326] (-1909.972) (-1882.627) (-1897.986) * [-1903.884] (-1897.823) (-1896.501) (-1902.139) -- 0:11:05
2000 -- [-1834.761] (-1877.865) (-1846.674) (-1866.002) * (-1857.672) [-1863.772] (-1869.626) (-1872.145) -- 0:08:19
2500 -- [-1832.686] (-1848.969) (-1840.574) (-1850.466) * (-1845.397) [-1842.439] (-1838.414) (-1849.458) -- 0:06:39
3000 -- [-1828.419] (-1839.268) (-1839.649) (-1835.433) * (-1846.475) [-1838.614] (-1840.511) (-1845.389) -- 0:05:32
3500 -- [-1839.555] (-1834.610) (-1842.376) (-1836.817) * (-1857.849) [-1836.887] (-1841.029) (-1841.686) -- 0:04:44
4000 -- (-1836.335) (-1834.925) (-1836.028) [-1834.901] * (-1843.119) (-1836.631) (-1843.919) [-1837.536] -- 0:04:09
4500 -- (-1839.009) [-1834.578] (-1838.263) (-1842.710) * [-1830.118] (-1836.009) (-1838.574) (-1839.717) -- 0:03:41
5000 -- (-1836.139) (-1831.900) [-1843.453] (-1843.811) * (-1836.374) [-1833.945] (-1836.208) (-1840.800) -- 0:06:38
Average standard deviation of split frequencies: 0.000000
5500 -- [-1831.683] (-1836.391) (-1840.181) (-1834.703) * (-1835.670) (-1839.514) (-1833.606) [-1835.289] -- 0:06:01
6000 -- [-1831.387] (-1836.228) (-1836.953) (-1835.657) * (-1829.180) (-1833.955) (-1838.861) [-1833.491] -- 0:05:31
6500 -- (-1838.050) (-1842.433) (-1836.897) [-1833.285] * (-1833.034) [-1839.933] (-1836.897) (-1836.663) -- 0:05:05
7000 -- [-1832.573] (-1843.795) (-1833.454) (-1837.468) * (-1839.900) [-1830.566] (-1840.216) (-1836.919) -- 0:04:43
7500 -- (-1833.156) [-1839.216] (-1838.171) (-1834.292) * (-1834.770) (-1833.451) [-1838.052] (-1833.305) -- 0:04:24
8000 -- (-1836.400) [-1831.793] (-1832.291) (-1835.149) * (-1834.030) [-1828.076] (-1841.241) (-1837.388) -- 0:04:08
8500 -- (-1833.492) [-1834.518] (-1845.093) (-1831.947) * (-1843.130) [-1832.954] (-1838.174) (-1833.341) -- 0:03:53
9000 -- (-1834.143) (-1830.409) (-1845.444) [-1832.772] * [-1840.170] (-1832.526) (-1836.612) (-1834.235) -- 0:05:30
9500 -- [-1842.707] (-1841.591) (-1834.215) (-1832.958) * (-1834.896) [-1836.263] (-1838.664) (-1832.471) -- 0:05:12
10000 -- (-1838.254) (-1839.022) (-1837.616) [-1834.690] * (-1835.950) (-1835.122) (-1838.312) [-1833.933] -- 0:04:57
Average standard deviation of split frequencies: 0.000000
10500 -- (-1836.226) [-1832.034] (-1836.538) (-1843.665) * (-1832.745) [-1831.218] (-1833.619) (-1838.918) -- 0:04:42
11000 -- (-1836.867) [-1830.378] (-1836.339) (-1836.617) * (-1835.090) (-1831.167) [-1834.370] (-1837.385) -- 0:04:29
11500 -- (-1833.709) (-1837.187) [-1835.568] (-1835.751) * (-1838.465) (-1831.839) (-1835.926) [-1833.949] -- 0:04:17
12000 -- (-1835.909) (-1839.630) [-1835.613] (-1835.224) * (-1837.213) [-1828.465] (-1831.982) (-1844.108) -- 0:04:07
12500 -- (-1839.520) [-1832.029] (-1836.819) (-1837.538) * [-1842.931] (-1828.623) (-1834.177) (-1840.643) -- 0:03:57
13000 -- (-1842.900) (-1837.497) [-1838.316] (-1839.287) * (-1832.377) [-1830.554] (-1833.910) (-1838.631) -- 0:03:47
13500 -- (-1834.213) (-1841.347) [-1842.050] (-1844.617) * (-1842.273) (-1832.321) (-1836.282) [-1839.546] -- 0:04:52
14000 -- [-1834.261] (-1835.014) (-1835.759) (-1836.191) * (-1843.874) [-1832.874] (-1837.962) (-1835.004) -- 0:04:41
14500 -- (-1837.116) (-1837.198) (-1841.002) [-1836.441] * (-1844.340) (-1833.211) [-1835.643] (-1831.171) -- 0:04:31
15000 -- (-1837.375) [-1834.167] (-1838.579) (-1833.593) * (-1840.770) [-1836.890] (-1834.773) (-1838.812) -- 0:04:22
Average standard deviation of split frequencies: 0.000000
15500 -- (-1836.957) (-1831.264) [-1835.432] (-1836.017) * (-1841.591) (-1839.761) (-1838.414) [-1837.920] -- 0:04:14
16000 -- (-1832.012) (-1842.092) (-1839.321) [-1839.578] * (-1834.220) (-1837.992) [-1836.688] (-1832.305) -- 0:04:06
16500 -- (-1839.092) (-1837.803) (-1836.010) [-1836.053] * (-1840.825) (-1837.292) (-1842.056) [-1838.388] -- 0:03:58
17000 -- (-1843.859) [-1840.067] (-1835.824) (-1842.552) * (-1837.614) (-1832.214) (-1837.567) [-1834.171] -- 0:03:51
17500 -- (-1833.258) [-1830.448] (-1837.072) (-1839.485) * (-1832.108) (-1833.640) (-1837.456) [-1833.939] -- 0:03:44
18000 -- [-1834.717] (-1833.189) (-1838.335) (-1839.072) * (-1832.801) [-1829.593] (-1833.502) (-1837.952) -- 0:04:32
18500 -- (-1835.964) (-1833.110) (-1837.695) [-1841.426] * (-1832.205) (-1831.672) [-1837.458] (-1834.515) -- 0:04:25
19000 -- (-1840.879) (-1833.276) (-1837.297) [-1836.514] * (-1832.070) (-1833.281) [-1842.116] (-1830.752) -- 0:04:18
19500 -- (-1841.585) (-1836.508) (-1841.849) [-1839.004] * (-1832.812) [-1835.253] (-1837.565) (-1837.421) -- 0:04:11
20000 -- [-1837.320] (-1844.223) (-1842.941) (-1840.181) * (-1836.429) (-1836.669) [-1835.599] (-1841.668) -- 0:04:05
Average standard deviation of split frequencies: 0.000000
20500 -- (-1836.102) [-1837.198] (-1844.515) (-1836.686) * (-1843.354) (-1832.943) [-1833.416] (-1843.605) -- 0:03:58
21000 -- (-1833.512) [-1839.236] (-1838.539) (-1836.310) * (-1837.421) [-1838.202] (-1836.945) (-1840.482) -- 0:03:53
21500 -- (-1836.888) (-1838.599) (-1841.018) [-1832.382] * [-1831.174] (-1833.311) (-1837.695) (-1838.688) -- 0:03:47
22000 -- (-1831.554) [-1837.447] (-1836.780) (-1836.913) * (-1838.214) (-1837.192) (-1836.416) [-1836.985] -- 0:04:26
22500 -- (-1833.890) (-1833.544) (-1840.112) [-1834.292] * (-1835.503) [-1833.493] (-1832.760) (-1831.685) -- 0:04:20
23000 -- [-1833.473] (-1832.195) (-1837.776) (-1841.120) * (-1833.692) (-1836.630) [-1836.129] (-1842.285) -- 0:04:14
23500 -- (-1838.302) [-1834.311] (-1831.514) (-1834.563) * [-1835.777] (-1840.714) (-1839.634) (-1834.715) -- 0:04:09
24000 -- (-1839.907) [-1831.338] (-1838.511) (-1832.307) * (-1835.239) (-1837.545) [-1838.882] (-1830.794) -- 0:04:04
24500 -- (-1833.759) [-1833.789] (-1835.736) (-1835.455) * (-1840.188) (-1840.381) (-1831.847) [-1835.639] -- 0:03:58
25000 -- [-1835.645] (-1838.150) (-1837.411) (-1834.404) * (-1834.667) (-1831.071) (-1837.927) [-1837.113] -- 0:03:54
Average standard deviation of split frequencies: 0.000000
25500 -- [-1843.225] (-1837.250) (-1840.119) (-1835.296) * [-1833.223] (-1833.315) (-1834.849) (-1837.793) -- 0:03:49
26000 -- (-1840.946) (-1839.769) (-1839.019) [-1837.235] * [-1831.620] (-1837.041) (-1830.755) (-1836.464) -- 0:03:44
26500 -- (-1836.370) (-1834.323) [-1834.594] (-1839.736) * [-1835.103] (-1833.427) (-1834.148) (-1834.321) -- 0:04:17
27000 -- (-1841.363) [-1833.118] (-1835.765) (-1835.925) * [-1836.474] (-1839.409) (-1835.009) (-1831.852) -- 0:04:12
27500 -- (-1836.456) [-1834.965] (-1831.607) (-1839.597) * (-1834.287) (-1834.654) [-1832.990] (-1835.714) -- 0:04:07
28000 -- (-1842.462) [-1832.506] (-1843.596) (-1838.919) * (-1833.751) (-1832.903) (-1838.780) [-1834.068] -- 0:04:03
28500 -- (-1834.401) [-1835.613] (-1836.331) (-1839.910) * [-1837.632] (-1838.946) (-1833.712) (-1829.052) -- 0:03:58
29000 -- (-1832.355) (-1836.060) [-1842.167] (-1840.661) * (-1839.200) (-1844.663) (-1837.193) [-1836.147] -- 0:03:54
29500 -- (-1836.766) (-1833.389) [-1839.673] (-1837.121) * (-1837.682) (-1834.846) [-1834.410] (-1839.103) -- 0:03:50
30000 -- [-1835.867] (-1830.806) (-1837.418) (-1843.449) * (-1837.721) (-1842.735) [-1841.173] (-1836.755) -- 0:03:46
Average standard deviation of split frequencies: 0.000000
30500 -- [-1830.093] (-1838.486) (-1831.561) (-1834.468) * (-1830.735) (-1835.049) [-1838.257] (-1836.284) -- 0:03:42
31000 -- (-1839.394) [-1835.356] (-1834.141) (-1836.316) * (-1833.637) (-1833.021) (-1839.277) [-1837.636] -- 0:04:10
31500 -- (-1835.635) (-1841.485) (-1832.353) [-1834.526] * (-1832.933) (-1837.426) (-1833.795) [-1832.692] -- 0:04:05
32000 -- (-1838.578) (-1834.799) (-1837.120) [-1840.695] * [-1836.402] (-1841.118) (-1834.726) (-1830.205) -- 0:04:02
32500 -- (-1836.123) (-1842.225) [-1832.075] (-1832.791) * (-1834.821) [-1834.589] (-1838.027) (-1833.331) -- 0:03:58
33000 -- [-1832.605] (-1831.360) (-1835.181) (-1845.371) * [-1834.775] (-1832.947) (-1833.116) (-1837.194) -- 0:03:54
33500 -- (-1831.287) (-1834.784) (-1833.504) [-1837.121] * (-1836.697) (-1834.796) (-1832.001) [-1831.629] -- 0:03:50
34000 -- (-1835.552) (-1836.718) (-1834.559) [-1832.186] * (-1836.160) (-1837.974) (-1834.515) [-1831.509] -- 0:03:47
34500 -- (-1834.606) (-1837.433) (-1839.344) [-1836.936] * (-1838.526) [-1837.964] (-1836.189) (-1833.140) -- 0:03:43
35000 -- (-1833.445) [-1836.909] (-1843.349) (-1839.746) * (-1838.434) [-1833.379] (-1834.936) (-1831.596) -- 0:03:40
Average standard deviation of split frequencies: 0.000000
35500 -- (-1831.619) [-1834.379] (-1831.417) (-1838.744) * (-1844.835) [-1832.199] (-1843.105) (-1834.333) -- 0:04:04
36000 -- (-1838.625) (-1832.189) (-1841.779) [-1839.916] * (-1841.774) (-1830.194) [-1835.641] (-1834.541) -- 0:04:01
36500 -- [-1834.770] (-1844.705) (-1837.564) (-1839.477) * [-1830.769] (-1832.798) (-1835.268) (-1838.124) -- 0:03:57
37000 -- (-1841.877) [-1835.138] (-1833.447) (-1830.728) * (-1835.137) (-1835.182) (-1835.668) [-1838.348] -- 0:03:54
37500 -- (-1836.093) (-1839.600) (-1841.920) [-1835.562] * (-1834.142) (-1835.590) [-1834.205] (-1835.283) -- 0:03:51
38000 -- (-1838.720) (-1836.181) (-1837.589) [-1836.540] * [-1843.100] (-1834.575) (-1841.396) (-1837.434) -- 0:03:47
38500 -- (-1833.142) (-1834.591) [-1836.558] (-1834.765) * [-1830.129] (-1836.339) (-1837.191) (-1835.465) -- 0:03:44
39000 -- (-1838.231) [-1831.722] (-1831.336) (-1835.522) * [-1837.097] (-1831.240) (-1835.034) (-1838.113) -- 0:03:41
39500 -- (-1831.855) (-1832.495) [-1832.472] (-1836.019) * [-1829.181] (-1835.661) (-1841.604) (-1846.259) -- 0:04:03
40000 -- (-1834.647) (-1836.082) (-1834.675) [-1836.079] * (-1833.910) (-1831.841) (-1839.634) [-1832.572] -- 0:04:00
Average standard deviation of split frequencies: 0.000000
40500 -- (-1844.818) [-1835.314] (-1836.476) (-1834.694) * (-1834.570) (-1835.371) (-1838.844) [-1833.412] -- 0:03:56
41000 -- (-1842.414) (-1835.579) [-1835.295] (-1832.922) * (-1832.958) (-1837.678) [-1837.252] (-1834.466) -- 0:03:53
41500 -- (-1832.489) [-1836.411] (-1836.527) (-1844.586) * (-1834.746) [-1834.977] (-1842.971) (-1835.128) -- 0:03:50
42000 -- (-1836.968) (-1834.544) (-1838.900) [-1836.060] * (-1839.398) [-1835.575] (-1842.606) (-1835.051) -- 0:03:48
42500 -- (-1839.235) (-1832.684) (-1834.863) [-1832.993] * (-1840.888) [-1830.381] (-1839.874) (-1838.733) -- 0:03:45
43000 -- (-1839.347) (-1835.621) [-1835.385] (-1838.926) * (-1840.566) (-1837.613) (-1839.524) [-1831.537] -- 0:03:42
43500 -- (-1838.516) [-1838.930] (-1843.064) (-1838.830) * (-1834.720) (-1834.862) [-1834.582] (-1839.278) -- 0:03:39
44000 -- (-1841.454) [-1838.210] (-1839.922) (-1837.227) * (-1839.009) [-1831.630] (-1837.442) (-1838.214) -- 0:03:59
44500 -- (-1841.644) [-1832.166] (-1833.105) (-1838.865) * [-1839.156] (-1831.967) (-1840.866) (-1840.656) -- 0:03:56
45000 -- (-1838.472) [-1834.282] (-1836.996) (-1839.727) * (-1835.125) [-1832.391] (-1835.088) (-1835.577) -- 0:03:53
Average standard deviation of split frequencies: 0.000000
45500 -- (-1844.874) [-1833.564] (-1834.786) (-1834.718) * (-1839.707) (-1837.707) [-1837.635] (-1839.921) -- 0:03:50
46000 -- (-1836.523) [-1832.994] (-1835.605) (-1839.621) * (-1834.279) [-1832.163] (-1838.103) (-1835.760) -- 0:03:48
46500 -- (-1835.047) (-1845.525) (-1839.764) [-1834.575] * [-1834.316] (-1834.647) (-1842.037) (-1842.968) -- 0:03:45
47000 -- (-1839.452) (-1836.163) [-1836.606] (-1835.033) * (-1836.689) [-1832.383] (-1840.358) (-1831.876) -- 0:03:43
47500 -- (-1840.787) [-1835.740] (-1834.220) (-1836.378) * [-1838.656] (-1834.872) (-1835.056) (-1839.095) -- 0:03:40
48000 -- (-1837.447) [-1834.319] (-1838.036) (-1835.716) * (-1830.859) (-1839.589) (-1840.598) [-1837.953] -- 0:03:38
48500 -- (-1834.741) [-1832.438] (-1831.656) (-1834.414) * (-1839.075) (-1832.573) (-1841.937) [-1833.171] -- 0:03:55
49000 -- (-1838.914) [-1839.431] (-1842.393) (-1831.539) * [-1838.611] (-1832.738) (-1839.353) (-1830.505) -- 0:03:52
49500 -- [-1828.277] (-1836.368) (-1842.730) (-1835.736) * (-1840.377) [-1835.411] (-1834.461) (-1836.467) -- 0:03:50
50000 -- [-1837.140] (-1844.578) (-1834.098) (-1845.464) * (-1839.690) [-1841.746] (-1841.537) (-1839.047) -- 0:03:48
Average standard deviation of split frequencies: 0.000000
50500 -- (-1834.614) (-1834.177) [-1834.873] (-1835.049) * (-1841.809) [-1839.685] (-1837.183) (-1841.398) -- 0:03:45
51000 -- [-1834.677] (-1836.583) (-1837.051) (-1837.690) * (-1842.301) [-1841.185] (-1834.514) (-1833.007) -- 0:03:43
51500 -- (-1840.571) (-1831.982) (-1836.373) [-1839.730] * (-1837.476) (-1837.341) (-1839.546) [-1835.141] -- 0:03:41
52000 -- [-1840.500] (-1837.217) (-1834.869) (-1840.768) * (-1843.337) (-1834.853) (-1834.903) [-1839.036] -- 0:03:38
52500 -- [-1845.606] (-1835.642) (-1834.486) (-1840.872) * (-1838.200) (-1836.705) [-1834.415] (-1835.911) -- 0:03:54
53000 -- (-1833.608) [-1837.336] (-1837.172) (-1842.860) * (-1844.260) [-1836.217] (-1832.210) (-1836.725) -- 0:03:52
53500 -- (-1832.672) (-1831.103) [-1842.127] (-1840.060) * [-1844.417] (-1837.212) (-1834.029) (-1838.704) -- 0:03:49
54000 -- (-1830.489) (-1832.774) (-1840.097) [-1839.952] * (-1846.969) (-1834.047) (-1844.995) [-1835.308] -- 0:03:47
54500 -- (-1832.393) [-1834.470] (-1835.459) (-1839.041) * (-1838.859) [-1828.822] (-1839.479) (-1831.995) -- 0:03:45
55000 -- [-1834.913] (-1836.325) (-1835.311) (-1840.976) * [-1843.141] (-1836.129) (-1843.513) (-1835.289) -- 0:03:43
Average standard deviation of split frequencies: 0.000000
55500 -- (-1843.232) (-1830.725) (-1834.405) [-1848.138] * (-1833.576) [-1837.699] (-1837.522) (-1835.879) -- 0:03:41
56000 -- (-1841.350) [-1834.663] (-1832.190) (-1844.030) * (-1833.547) [-1832.691] (-1850.529) (-1841.169) -- 0:03:39
56500 -- (-1841.398) (-1832.477) (-1838.919) [-1843.110] * (-1837.043) (-1833.695) (-1844.573) [-1839.810] -- 0:03:37
57000 -- (-1841.123) (-1835.943) (-1836.190) [-1829.439] * (-1839.320) (-1834.905) (-1839.670) [-1835.473] -- 0:03:51
57500 -- (-1839.412) [-1839.922] (-1849.343) (-1834.570) * (-1833.728) [-1833.576] (-1842.552) (-1835.632) -- 0:03:49
58000 -- (-1837.131) [-1836.083] (-1846.733) (-1833.871) * [-1835.762] (-1836.216) (-1840.488) (-1834.348) -- 0:03:47
58500 -- (-1837.682) (-1838.677) (-1839.896) [-1832.672] * (-1836.958) [-1833.215] (-1840.028) (-1831.535) -- 0:03:45
59000 -- (-1841.526) (-1838.424) (-1843.814) [-1838.433] * [-1831.690] (-1832.342) (-1835.332) (-1835.571) -- 0:03:43
59500 -- [-1835.287] (-1837.027) (-1842.248) (-1836.627) * [-1837.384] (-1833.141) (-1835.828) (-1833.930) -- 0:03:41
60000 -- [-1837.624] (-1835.168) (-1846.769) (-1845.189) * (-1836.755) [-1834.856] (-1835.560) (-1837.193) -- 0:03:39
Average standard deviation of split frequencies: 0.000000
60500 -- (-1833.139) [-1836.353] (-1835.428) (-1837.530) * [-1833.981] (-1833.750) (-1840.461) (-1836.315) -- 0:03:37
61000 -- (-1831.239) (-1840.669) (-1829.482) [-1833.302] * (-1835.631) [-1835.339] (-1839.051) (-1837.779) -- 0:03:50
61500 -- (-1848.307) [-1832.582] (-1832.352) (-1837.140) * (-1838.394) (-1838.293) [-1839.508] (-1840.280) -- 0:03:48
62000 -- (-1841.311) (-1838.123) [-1836.058] (-1832.123) * [-1837.049] (-1840.828) (-1838.461) (-1838.750) -- 0:03:46
62500 -- (-1837.508) [-1836.740] (-1842.292) (-1830.390) * [-1837.066] (-1841.516) (-1848.162) (-1837.192) -- 0:03:45
63000 -- (-1842.388) (-1842.328) [-1840.162] (-1838.106) * [-1836.230] (-1842.439) (-1843.553) (-1835.787) -- 0:03:43
63500 -- (-1835.716) (-1846.602) [-1835.962] (-1837.919) * (-1836.574) (-1832.964) (-1832.491) [-1836.224] -- 0:03:41
64000 -- [-1833.623] (-1843.112) (-1834.577) (-1838.090) * (-1831.170) (-1831.077) [-1840.934] (-1832.644) -- 0:03:39
64500 -- [-1834.125] (-1848.494) (-1834.766) (-1833.558) * (-1834.152) (-1832.510) (-1836.062) [-1831.560] -- 0:03:37
65000 -- [-1838.741] (-1835.967) (-1835.181) (-1837.204) * (-1835.125) (-1836.471) (-1832.851) [-1839.543] -- 0:03:35
Average standard deviation of split frequencies: 0.000000
65500 -- (-1839.729) (-1832.890) (-1836.943) [-1840.808] * (-1835.390) [-1834.547] (-1839.793) (-1837.473) -- 0:03:48
66000 -- (-1836.381) (-1838.200) [-1836.490] (-1841.769) * (-1842.744) (-1833.827) (-1834.169) [-1835.582] -- 0:03:46
66500 -- (-1836.415) [-1829.946] (-1845.384) (-1837.672) * (-1834.191) (-1836.402) [-1835.505] (-1837.183) -- 0:03:44
67000 -- (-1840.115) [-1831.360] (-1841.044) (-1837.066) * (-1831.828) (-1836.124) (-1834.080) [-1835.316] -- 0:03:42
67500 -- [-1839.118] (-1834.629) (-1832.403) (-1837.696) * (-1836.586) [-1837.519] (-1832.531) (-1836.291) -- 0:03:41
68000 -- [-1840.255] (-1834.475) (-1844.462) (-1835.325) * (-1834.346) (-1849.791) (-1836.383) [-1839.122] -- 0:03:39
68500 -- (-1838.134) [-1832.633] (-1836.947) (-1836.756) * (-1833.945) (-1843.721) (-1837.979) [-1843.465] -- 0:03:37
69000 -- [-1835.378] (-1833.069) (-1836.081) (-1834.123) * (-1835.017) (-1837.822) [-1833.763] (-1854.622) -- 0:03:35
69500 -- (-1840.907) [-1841.320] (-1835.797) (-1831.405) * [-1831.831] (-1839.405) (-1836.588) (-1848.272) -- 0:03:34
70000 -- (-1832.432) (-1835.621) (-1840.733) [-1841.947] * (-1832.635) (-1836.208) [-1833.778] (-1844.487) -- 0:03:45
Average standard deviation of split frequencies: 0.000000
70500 -- (-1829.371) [-1837.327] (-1836.079) (-1833.822) * (-1836.205) (-1836.027) [-1834.231] (-1840.610) -- 0:03:44
71000 -- (-1834.564) (-1830.861) [-1844.637] (-1836.511) * (-1832.189) (-1838.649) (-1833.484) [-1836.455] -- 0:03:42
71500 -- (-1829.764) [-1836.335] (-1833.596) (-1837.488) * [-1833.352] (-1841.158) (-1839.595) (-1831.670) -- 0:03:40
72000 -- (-1832.156) [-1839.315] (-1837.208) (-1841.308) * [-1835.919] (-1839.449) (-1839.442) (-1829.203) -- 0:03:39
72500 -- (-1840.990) (-1838.786) (-1833.609) [-1834.752] * (-1837.082) [-1835.429] (-1840.536) (-1841.566) -- 0:03:37
73000 -- [-1838.017] (-1838.000) (-1838.893) (-1833.993) * [-1835.570] (-1838.293) (-1837.850) (-1834.369) -- 0:03:35
73500 -- [-1836.122] (-1832.650) (-1831.196) (-1838.878) * (-1835.632) [-1832.913] (-1841.213) (-1833.352) -- 0:03:34
74000 -- [-1839.111] (-1839.803) (-1833.162) (-1831.283) * (-1833.882) (-1833.742) (-1840.787) [-1832.067] -- 0:03:45
74500 -- (-1837.564) [-1838.858] (-1839.665) (-1835.372) * (-1833.374) (-1834.861) (-1831.958) [-1834.200] -- 0:03:43
75000 -- (-1839.426) [-1836.601] (-1834.314) (-1836.342) * (-1841.523) [-1838.136] (-1841.170) (-1837.443) -- 0:03:42
Average standard deviation of split frequencies: 0.000000
75500 -- (-1840.778) [-1832.675] (-1835.720) (-1831.917) * (-1838.112) (-1838.109) (-1841.011) [-1836.133] -- 0:03:40
76000 -- (-1840.048) (-1835.382) [-1838.636] (-1841.614) * (-1835.240) [-1832.538] (-1840.736) (-1833.675) -- 0:03:38
76500 -- (-1836.975) [-1831.089] (-1840.538) (-1838.307) * (-1837.581) (-1835.429) [-1833.682] (-1838.188) -- 0:03:37
77000 -- (-1837.493) (-1840.949) (-1833.186) [-1833.804] * (-1837.889) [-1834.251] (-1837.298) (-1835.112) -- 0:03:35
77500 -- (-1843.412) (-1841.669) (-1834.482) [-1838.284] * (-1839.446) [-1836.390] (-1837.536) (-1832.759) -- 0:03:34
78000 -- (-1840.156) (-1836.222) (-1845.423) [-1835.552] * [-1833.739] (-1838.241) (-1834.469) (-1832.120) -- 0:03:32
78500 -- (-1840.066) [-1837.749] (-1839.610) (-1832.531) * (-1838.049) (-1835.585) (-1838.580) [-1832.800] -- 0:03:43
79000 -- [-1834.144] (-1848.558) (-1843.188) (-1836.973) * (-1836.946) [-1831.954] (-1833.979) (-1839.021) -- 0:03:41
79500 -- (-1835.712) [-1837.774] (-1839.320) (-1838.446) * (-1833.285) [-1836.944] (-1839.237) (-1837.336) -- 0:03:39
80000 -- (-1837.465) (-1835.233) [-1846.076] (-1840.340) * (-1842.185) (-1834.396) [-1834.644] (-1837.304) -- 0:03:38
Average standard deviation of split frequencies: 0.000000
80500 -- (-1841.056) (-1840.338) (-1843.861) [-1841.583] * (-1838.905) (-1839.684) [-1836.302] (-1838.279) -- 0:03:37
81000 -- [-1831.304] (-1834.021) (-1849.592) (-1836.742) * (-1843.568) (-1836.213) [-1829.834] (-1834.872) -- 0:03:35
81500 -- (-1838.207) (-1832.551) (-1832.381) [-1836.619] * (-1834.188) (-1833.210) [-1833.718] (-1833.564) -- 0:03:34
82000 -- (-1848.850) (-1835.541) (-1836.891) [-1841.139] * (-1841.224) (-1837.600) (-1839.792) [-1832.978] -- 0:03:32
82500 -- (-1835.788) (-1842.837) (-1840.914) [-1836.977] * (-1836.764) (-1841.695) (-1838.161) [-1836.958] -- 0:03:42
83000 -- (-1838.156) (-1836.866) (-1834.150) [-1836.750] * (-1833.458) (-1840.221) [-1837.024] (-1838.358) -- 0:03:40
83500 -- [-1835.824] (-1837.198) (-1836.761) (-1845.920) * (-1836.506) (-1836.490) (-1834.147) [-1835.007] -- 0:03:39
84000 -- [-1836.536] (-1833.036) (-1831.792) (-1840.749) * (-1842.167) [-1834.319] (-1832.354) (-1840.746) -- 0:03:38
84500 -- (-1834.586) [-1831.551] (-1839.589) (-1839.547) * (-1836.245) [-1837.704] (-1835.773) (-1831.804) -- 0:03:36
85000 -- [-1833.412] (-1833.483) (-1841.070) (-1839.069) * (-1837.940) (-1846.519) (-1838.333) [-1830.057] -- 0:03:35
Average standard deviation of split frequencies: 0.000000
85500 -- (-1834.130) [-1839.799] (-1838.526) (-1838.179) * (-1831.937) [-1834.264] (-1839.451) (-1832.953) -- 0:03:33
86000 -- [-1835.550] (-1834.789) (-1833.756) (-1835.984) * (-1828.877) [-1835.521] (-1839.000) (-1835.562) -- 0:03:32
86500 -- (-1834.532) (-1835.863) [-1836.738] (-1836.383) * (-1830.315) [-1832.696] (-1840.711) (-1832.986) -- 0:03:31
87000 -- (-1834.873) (-1840.199) (-1836.946) [-1835.707] * (-1833.473) (-1838.789) (-1836.782) [-1832.864] -- 0:03:40
87500 -- [-1834.999] (-1832.525) (-1837.339) (-1838.480) * (-1842.403) (-1840.266) (-1835.369) [-1835.637] -- 0:03:39
88000 -- (-1834.951) (-1835.640) [-1844.284] (-1835.275) * (-1841.656) [-1837.863] (-1839.994) (-1833.568) -- 0:03:37
88500 -- (-1833.456) (-1839.272) [-1834.513] (-1838.891) * [-1839.797] (-1840.185) (-1833.405) (-1839.925) -- 0:03:36
89000 -- (-1842.222) (-1833.997) [-1833.337] (-1842.721) * (-1841.852) (-1835.477) (-1836.616) [-1837.768] -- 0:03:34
89500 -- (-1839.151) (-1839.439) [-1835.618] (-1841.959) * [-1837.238] (-1845.531) (-1830.617) (-1834.738) -- 0:03:33
90000 -- (-1832.753) (-1840.180) (-1837.199) [-1837.653] * (-1841.714) (-1840.068) (-1837.146) [-1833.793] -- 0:03:32
Average standard deviation of split frequencies: 0.000000
90500 -- (-1842.872) (-1834.238) [-1842.692] (-1835.025) * [-1834.702] (-1844.940) (-1845.811) (-1833.916) -- 0:03:31
91000 -- [-1843.535] (-1834.064) (-1835.006) (-1844.183) * (-1836.141) (-1842.452) [-1834.619] (-1833.656) -- 0:03:29
91500 -- (-1839.887) (-1838.365) [-1834.045] (-1836.809) * (-1835.886) [-1838.216] (-1839.505) (-1832.797) -- 0:03:38
92000 -- (-1834.199) (-1836.864) [-1839.825] (-1837.190) * [-1833.348] (-1837.394) (-1842.909) (-1832.942) -- 0:03:37
92500 -- (-1842.811) (-1834.393) [-1839.109] (-1836.530) * [-1834.496] (-1836.921) (-1835.366) (-1839.471) -- 0:03:35
93000 -- (-1837.883) (-1834.603) [-1836.933] (-1839.168) * (-1835.438) [-1831.608] (-1837.899) (-1841.131) -- 0:03:34
93500 -- (-1838.401) [-1837.083] (-1838.543) (-1834.480) * (-1834.000) (-1835.920) (-1836.893) [-1833.918] -- 0:03:33
94000 -- (-1837.041) (-1836.213) [-1837.177] (-1836.644) * (-1839.633) (-1835.855) (-1834.829) [-1836.853] -- 0:03:32
94500 -- (-1836.227) (-1838.025) (-1830.352) [-1841.670] * (-1838.170) (-1834.316) (-1843.348) [-1834.214] -- 0:03:30
95000 -- [-1837.478] (-1837.983) (-1844.367) (-1835.887) * (-1834.615) (-1840.315) (-1840.972) [-1837.816] -- 0:03:29
Average standard deviation of split frequencies: 0.000000
95500 -- [-1832.282] (-1835.027) (-1837.759) (-1834.430) * (-1843.723) (-1839.374) [-1832.365] (-1838.114) -- 0:03:37
96000 -- (-1839.223) (-1838.038) [-1833.117] (-1843.760) * (-1835.782) (-1834.065) (-1838.057) [-1837.169] -- 0:03:36
96500 -- [-1840.931] (-1839.728) (-1836.746) (-1836.765) * (-1837.775) [-1836.450] (-1832.594) (-1830.278) -- 0:03:35
97000 -- (-1836.153) [-1838.411] (-1834.384) (-1837.647) * (-1835.603) [-1840.900] (-1832.068) (-1838.072) -- 0:03:34
97500 -- (-1831.679) [-1841.417] (-1837.536) (-1836.815) * [-1834.657] (-1833.501) (-1836.058) (-1836.199) -- 0:03:32
98000 -- [-1834.536] (-1839.803) (-1838.653) (-1837.330) * (-1842.356) [-1837.108] (-1834.753) (-1838.228) -- 0:03:31
98500 -- (-1840.843) (-1837.850) [-1839.330] (-1836.649) * (-1837.396) [-1831.337] (-1834.302) (-1834.605) -- 0:03:30
99000 -- [-1831.743] (-1832.418) (-1836.382) (-1835.051) * (-1833.656) (-1840.625) [-1835.204] (-1836.172) -- 0:03:29
99500 -- [-1833.360] (-1832.110) (-1831.245) (-1830.338) * [-1834.869] (-1833.407) (-1841.332) (-1838.800) -- 0:03:28
100000 -- (-1829.632) (-1828.838) (-1833.627) [-1833.496] * (-1833.177) [-1829.998] (-1835.405) (-1832.611) -- 0:03:36
Average standard deviation of split frequencies: 0.000000
100500 -- (-1830.193) [-1836.021] (-1835.163) (-1840.916) * (-1836.905) [-1836.743] (-1837.393) (-1839.151) -- 0:03:34
101000 -- (-1837.932) (-1837.551) (-1835.780) [-1834.353] * (-1833.723) (-1836.578) [-1833.109] (-1836.396) -- 0:03:33
101500 -- (-1835.022) [-1833.380] (-1836.396) (-1833.331) * (-1837.793) (-1833.893) (-1835.065) [-1839.946] -- 0:03:32
102000 -- (-1838.525) [-1829.315] (-1833.714) (-1833.224) * [-1839.530] (-1832.038) (-1832.302) (-1847.278) -- 0:03:31
102500 -- [-1836.794] (-1838.898) (-1839.161) (-1837.468) * (-1836.042) (-1837.381) (-1841.961) [-1834.201] -- 0:03:30
103000 -- [-1833.282] (-1843.486) (-1842.113) (-1828.931) * (-1835.745) (-1836.022) (-1839.254) [-1836.097] -- 0:03:29
103500 -- (-1838.720) (-1830.059) (-1839.129) [-1834.039] * (-1835.010) (-1835.201) (-1835.625) [-1836.689] -- 0:03:27
104000 -- (-1837.725) (-1836.188) (-1835.971) [-1835.986] * [-1833.824] (-1832.317) (-1837.754) (-1833.067) -- 0:03:35
104500 -- (-1840.860) (-1836.351) (-1834.526) [-1833.987] * (-1835.706) (-1837.565) [-1834.844] (-1835.726) -- 0:03:34
105000 -- (-1834.687) (-1836.850) [-1833.488] (-1832.596) * (-1845.794) (-1837.671) (-1833.969) [-1831.772] -- 0:03:33
Average standard deviation of split frequencies: 0.000000
105500 -- [-1836.102] (-1831.154) (-1832.620) (-1841.837) * (-1833.966) [-1833.461] (-1839.233) (-1833.115) -- 0:03:31
106000 -- (-1836.044) [-1838.325] (-1837.222) (-1835.725) * [-1837.314] (-1836.437) (-1835.814) (-1834.380) -- 0:03:30
106500 -- (-1837.559) (-1838.564) (-1839.748) [-1838.157] * (-1832.709) [-1832.968] (-1832.801) (-1839.627) -- 0:03:29
107000 -- (-1841.817) [-1839.168] (-1836.534) (-1835.170) * (-1832.115) (-1841.694) (-1842.464) [-1836.522] -- 0:03:28
107500 -- [-1840.368] (-1835.964) (-1835.896) (-1838.403) * (-1836.793) (-1835.302) (-1839.665) [-1840.943] -- 0:03:27
108000 -- (-1836.698) (-1837.789) (-1841.328) [-1838.455] * (-1835.912) (-1837.887) (-1837.731) [-1833.490] -- 0:03:26
108500 -- (-1835.394) [-1831.479] (-1834.111) (-1832.680) * (-1842.951) [-1835.555] (-1845.726) (-1838.385) -- 0:03:33
109000 -- (-1830.845) [-1840.849] (-1832.076) (-1839.572) * (-1832.455) (-1841.982) (-1838.229) [-1836.112] -- 0:03:32
109500 -- (-1841.594) [-1837.688] (-1834.291) (-1833.741) * (-1842.594) (-1838.378) (-1834.744) [-1833.520] -- 0:03:31
110000 -- (-1840.081) (-1839.939) (-1835.013) [-1836.978] * (-1843.750) (-1840.516) (-1836.145) [-1836.653] -- 0:03:30
Average standard deviation of split frequencies: 0.000000
110500 -- (-1835.546) (-1843.235) (-1839.728) [-1836.195] * [-1839.574] (-1839.023) (-1837.643) (-1830.734) -- 0:03:29
111000 -- (-1834.162) (-1834.984) [-1832.151] (-1842.129) * [-1836.952] (-1837.305) (-1833.568) (-1836.266) -- 0:03:28
111500 -- [-1836.613] (-1837.098) (-1833.260) (-1839.512) * (-1835.149) [-1831.119] (-1833.221) (-1834.207) -- 0:03:27
112000 -- (-1831.327) (-1836.442) (-1833.081) [-1837.809] * (-1840.490) (-1836.474) [-1834.427] (-1832.306) -- 0:03:26
112500 -- (-1833.023) [-1835.473] (-1844.388) (-1835.004) * (-1832.763) (-1840.105) [-1843.164] (-1835.121) -- 0:03:33
113000 -- (-1837.245) (-1841.120) (-1839.016) [-1837.129] * (-1835.714) (-1841.570) [-1833.669] (-1830.023) -- 0:03:31
113500 -- (-1836.069) [-1835.434] (-1839.162) (-1834.117) * (-1836.616) [-1836.731] (-1833.661) (-1837.753) -- 0:03:30
114000 -- (-1833.138) [-1836.166] (-1836.121) (-1842.562) * (-1840.126) (-1834.461) [-1833.318] (-1838.580) -- 0:03:29
114500 -- (-1833.946) (-1834.273) [-1834.584] (-1849.033) * (-1840.775) (-1842.813) (-1835.156) [-1835.497] -- 0:03:28
115000 -- (-1832.203) (-1834.761) [-1838.441] (-1841.114) * (-1847.060) (-1844.109) [-1834.821] (-1832.485) -- 0:03:27
Average standard deviation of split frequencies: 0.000000
115500 -- (-1834.679) (-1838.179) [-1840.719] (-1840.660) * (-1837.958) [-1835.709] (-1839.599) (-1832.431) -- 0:03:26
116000 -- [-1842.013] (-1839.463) (-1837.852) (-1843.969) * (-1838.639) [-1837.154] (-1838.479) (-1833.304) -- 0:03:25
116500 -- (-1835.440) [-1834.399] (-1839.761) (-1835.752) * (-1845.633) (-1838.873) (-1833.789) [-1833.573] -- 0:03:24
117000 -- (-1835.498) (-1837.256) [-1833.995] (-1838.938) * [-1830.777] (-1837.932) (-1839.507) (-1845.356) -- 0:03:31
117500 -- (-1835.444) [-1837.725] (-1832.735) (-1833.885) * (-1841.978) [-1830.103] (-1835.283) (-1841.633) -- 0:03:30
118000 -- [-1831.989] (-1847.413) (-1834.912) (-1847.446) * (-1840.826) (-1835.792) [-1832.221] (-1843.216) -- 0:03:29
118500 -- [-1840.139] (-1842.810) (-1835.266) (-1842.652) * (-1841.661) [-1837.639] (-1836.152) (-1837.216) -- 0:03:28
119000 -- (-1835.045) [-1833.948] (-1835.888) (-1842.823) * [-1838.572] (-1833.540) (-1835.326) (-1839.622) -- 0:03:27
119500 -- (-1835.906) [-1834.800] (-1839.800) (-1839.980) * (-1834.024) (-1832.574) (-1835.479) [-1835.483] -- 0:03:26
120000 -- (-1833.555) (-1833.761) (-1839.359) [-1840.690] * (-1838.523) (-1836.798) [-1837.210] (-1836.338) -- 0:03:25
Average standard deviation of split frequencies: 0.000000
120500 -- (-1833.605) (-1832.758) [-1834.501] (-1838.987) * [-1833.909] (-1842.564) (-1831.607) (-1840.321) -- 0:03:24
121000 -- [-1839.219] (-1833.078) (-1836.214) (-1838.486) * [-1835.704] (-1834.881) (-1837.255) (-1844.757) -- 0:03:30
121500 -- [-1839.321] (-1833.099) (-1831.967) (-1834.428) * (-1836.215) (-1837.154) (-1834.824) [-1835.802] -- 0:03:29
122000 -- (-1841.370) (-1836.509) [-1832.736] (-1837.168) * (-1838.704) (-1838.090) (-1833.862) [-1836.227] -- 0:03:28
122500 -- (-1838.300) [-1832.931] (-1832.017) (-1837.439) * (-1831.967) [-1832.010] (-1832.054) (-1837.710) -- 0:03:27
123000 -- (-1842.317) [-1835.073] (-1836.988) (-1841.394) * (-1829.828) [-1835.387] (-1838.215) (-1840.723) -- 0:03:26
123500 -- [-1829.858] (-1834.168) (-1839.170) (-1834.129) * (-1833.837) [-1835.197] (-1839.840) (-1831.564) -- 0:03:25
124000 -- (-1834.023) [-1838.273] (-1840.781) (-1842.112) * (-1831.971) (-1830.120) (-1838.360) [-1831.299] -- 0:03:24
124500 -- (-1836.683) (-1833.005) (-1840.871) [-1831.390] * (-1832.170) (-1833.329) (-1834.570) [-1840.025] -- 0:03:23
125000 -- [-1839.346] (-1833.262) (-1833.474) (-1832.041) * (-1837.717) (-1840.741) [-1839.897] (-1836.661) -- 0:03:23
Average standard deviation of split frequencies: 0.000000
125500 -- (-1835.662) [-1831.330] (-1835.057) (-1831.385) * (-1843.489) (-1841.359) (-1837.493) [-1835.781] -- 0:03:29
126000 -- (-1832.539) (-1835.165) [-1838.280] (-1839.920) * (-1845.646) (-1838.400) (-1836.441) [-1833.935] -- 0:03:28
126500 -- (-1840.496) (-1840.201) (-1836.108) [-1837.374] * (-1837.417) [-1831.803] (-1836.960) (-1834.301) -- 0:03:27
127000 -- (-1831.130) (-1832.004) (-1835.239) [-1837.738] * [-1834.533] (-1834.776) (-1833.401) (-1834.283) -- 0:03:26
127500 -- (-1830.622) (-1837.922) (-1835.550) [-1836.721] * [-1839.296] (-1833.491) (-1840.627) (-1832.552) -- 0:03:25
128000 -- (-1837.945) [-1832.817] (-1835.188) (-1834.002) * (-1841.544) (-1834.553) (-1840.629) [-1835.232] -- 0:03:24
128500 -- (-1836.826) (-1838.762) [-1836.849] (-1836.397) * [-1840.208] (-1835.737) (-1839.158) (-1837.270) -- 0:03:23
129000 -- (-1833.425) [-1833.831] (-1835.016) (-1839.843) * (-1837.209) (-1839.286) [-1830.946] (-1839.298) -- 0:03:22
129500 -- (-1832.805) [-1843.331] (-1838.564) (-1839.722) * (-1839.737) (-1842.617) [-1828.952] (-1831.859) -- 0:03:28
130000 -- (-1835.927) (-1831.103) (-1837.400) [-1836.655] * [-1836.828] (-1845.145) (-1841.473) (-1836.298) -- 0:03:27
Average standard deviation of split frequencies: 0.000000
130500 -- [-1832.659] (-1843.230) (-1833.414) (-1831.930) * [-1837.338] (-1833.762) (-1838.404) (-1842.977) -- 0:03:26
131000 -- (-1838.323) (-1837.703) (-1837.132) [-1831.170] * (-1839.351) [-1836.583] (-1833.765) (-1838.298) -- 0:03:25
131500 -- (-1833.708) [-1836.020] (-1834.544) (-1833.678) * (-1846.010) [-1832.511] (-1833.352) (-1841.669) -- 0:03:24
132000 -- (-1837.523) [-1836.078] (-1833.301) (-1837.399) * (-1836.124) [-1836.817] (-1833.607) (-1835.531) -- 0:03:23
132500 -- (-1836.615) (-1834.739) [-1832.930] (-1842.808) * [-1834.207] (-1835.130) (-1845.896) (-1834.631) -- 0:03:22
133000 -- (-1842.847) (-1835.155) (-1844.545) [-1837.503] * (-1837.648) [-1838.927] (-1829.457) (-1834.266) -- 0:03:22
133500 -- (-1841.856) [-1833.075] (-1834.773) (-1840.038) * (-1852.335) [-1845.725] (-1834.732) (-1837.106) -- 0:03:21
134000 -- (-1837.809) (-1831.684) (-1839.500) [-1831.935] * (-1842.392) (-1832.390) [-1834.955] (-1835.416) -- 0:03:26
134500 -- (-1837.551) (-1837.920) [-1835.873] (-1835.573) * (-1849.991) (-1835.375) (-1834.673) [-1837.296] -- 0:03:25
135000 -- (-1833.521) (-1836.804) [-1837.683] (-1840.810) * (-1844.381) (-1836.749) (-1835.224) [-1833.835] -- 0:03:25
Average standard deviation of split frequencies: 0.000000
135500 -- [-1835.560] (-1840.345) (-1835.357) (-1837.910) * (-1841.735) [-1832.789] (-1837.405) (-1833.632) -- 0:03:24
136000 -- (-1835.563) (-1836.486) (-1836.037) [-1836.080] * (-1843.991) [-1837.070] (-1835.543) (-1830.266) -- 0:03:23
136500 -- (-1833.102) (-1839.032) (-1836.108) [-1831.343] * (-1849.094) (-1846.429) (-1841.536) [-1834.221] -- 0:03:22
137000 -- (-1832.420) [-1835.716] (-1831.066) (-1831.823) * (-1851.877) (-1835.299) [-1838.364] (-1835.766) -- 0:03:21
137500 -- (-1833.303) (-1841.089) (-1837.446) [-1832.785] * (-1841.642) [-1835.188] (-1838.329) (-1839.687) -- 0:03:20
138000 -- (-1838.667) (-1831.681) (-1835.511) [-1834.398] * (-1839.330) (-1834.386) [-1838.447] (-1838.692) -- 0:03:19
138500 -- (-1836.736) (-1841.084) [-1834.299] (-1832.434) * (-1836.366) [-1836.803] (-1842.611) (-1833.560) -- 0:03:25
139000 -- (-1835.084) (-1838.448) [-1832.986] (-1834.242) * (-1834.558) [-1832.585] (-1834.747) (-1844.007) -- 0:03:24
139500 -- (-1834.624) (-1840.162) (-1841.919) [-1834.855] * [-1834.742] (-1841.763) (-1832.468) (-1836.414) -- 0:03:23
140000 -- (-1838.031) (-1844.825) (-1842.591) [-1831.381] * [-1834.100] (-1833.197) (-1837.751) (-1840.114) -- 0:03:22
Average standard deviation of split frequencies: 0.000000
140500 -- (-1837.463) (-1834.449) (-1839.258) [-1835.391] * (-1834.721) (-1834.883) (-1838.240) [-1839.589] -- 0:03:21
141000 -- (-1837.649) (-1832.375) (-1837.308) [-1832.144] * (-1834.530) [-1835.094] (-1837.873) (-1835.353) -- 0:03:21
141500 -- (-1835.280) [-1833.804] (-1839.519) (-1836.032) * (-1835.259) [-1834.004] (-1837.765) (-1835.107) -- 0:03:20
142000 -- [-1834.603] (-1833.991) (-1833.215) (-1840.487) * (-1833.871) (-1832.419) [-1839.337] (-1842.468) -- 0:03:19
142500 -- (-1834.322) [-1832.951] (-1840.154) (-1845.753) * (-1834.661) (-1834.676) (-1832.836) [-1842.072] -- 0:03:18
143000 -- [-1834.987] (-1844.052) (-1830.796) (-1841.035) * (-1834.064) (-1842.265) [-1831.854] (-1847.800) -- 0:03:23
143500 -- (-1835.919) [-1837.393] (-1836.990) (-1842.463) * [-1836.382] (-1837.788) (-1837.886) (-1842.700) -- 0:03:22
144000 -- (-1832.756) (-1837.177) [-1841.231] (-1839.319) * (-1835.516) (-1831.022) [-1834.297] (-1842.289) -- 0:03:22
144500 -- [-1838.130] (-1833.194) (-1838.334) (-1840.976) * (-1835.027) (-1837.073) [-1831.907] (-1833.366) -- 0:03:21
145000 -- (-1843.620) [-1831.801] (-1835.808) (-1838.880) * [-1837.586] (-1835.933) (-1839.776) (-1834.199) -- 0:03:20
Average standard deviation of split frequencies: 0.000000
145500 -- (-1836.990) [-1836.034] (-1833.286) (-1835.697) * (-1839.118) [-1836.891] (-1834.138) (-1839.337) -- 0:03:19
146000 -- (-1836.964) (-1847.452) (-1834.673) [-1834.839] * [-1841.433] (-1834.688) (-1834.636) (-1836.238) -- 0:03:18
146500 -- (-1838.410) [-1837.720] (-1831.132) (-1838.408) * (-1833.761) (-1838.073) (-1839.925) [-1836.568] -- 0:03:18
147000 -- (-1838.498) [-1834.581] (-1837.017) (-1837.077) * (-1833.839) (-1835.027) (-1837.402) [-1834.390] -- 0:03:23
147500 -- (-1848.167) (-1838.060) (-1831.409) [-1838.987] * (-1838.665) (-1833.422) (-1833.718) [-1830.751] -- 0:03:22
148000 -- (-1841.895) (-1836.243) (-1832.959) [-1835.567] * (-1833.257) (-1832.007) (-1838.851) [-1835.803] -- 0:03:21
148500 -- (-1846.734) [-1832.084] (-1832.158) (-1840.061) * (-1837.363) [-1838.517] (-1836.116) (-1831.653) -- 0:03:20
149000 -- (-1838.977) (-1832.975) [-1836.520] (-1840.007) * (-1838.289) (-1838.657) [-1834.221] (-1831.198) -- 0:03:19
149500 -- (-1841.348) [-1835.002] (-1833.631) (-1834.584) * [-1832.129] (-1837.293) (-1832.435) (-1836.626) -- 0:03:19
150000 -- [-1840.804] (-1831.675) (-1834.665) (-1835.203) * (-1841.788) (-1833.088) (-1835.855) [-1832.389] -- 0:03:18
Average standard deviation of split frequencies: 0.000000
150500 -- [-1832.069] (-1838.382) (-1837.555) (-1833.095) * (-1835.062) [-1834.608] (-1837.789) (-1841.700) -- 0:03:17
151000 -- (-1834.787) [-1831.449] (-1834.199) (-1835.394) * (-1833.335) (-1836.064) [-1838.140] (-1837.769) -- 0:03:16
151500 -- (-1830.774) (-1833.180) (-1832.803) [-1839.415] * (-1830.772) (-1833.580) [-1836.979] (-1839.905) -- 0:03:21
152000 -- (-1831.470) (-1840.245) [-1832.060] (-1842.357) * (-1839.281) (-1830.790) (-1838.848) [-1839.455] -- 0:03:20
152500 -- (-1838.120) (-1834.277) (-1846.020) [-1847.113] * (-1835.834) (-1837.131) [-1835.779] (-1834.033) -- 0:03:20
153000 -- (-1839.938) (-1840.185) [-1837.708] (-1842.845) * (-1836.116) (-1837.848) (-1829.865) [-1837.851] -- 0:03:19
153500 -- (-1835.218) [-1835.650] (-1835.577) (-1840.696) * (-1838.107) (-1837.496) (-1835.175) [-1833.477] -- 0:03:18
154000 -- [-1839.948] (-1839.235) (-1831.913) (-1841.612) * (-1833.285) (-1835.840) [-1836.187] (-1835.488) -- 0:03:17
154500 -- (-1832.837) (-1838.402) [-1839.923] (-1838.031) * [-1835.943] (-1833.982) (-1831.265) (-1840.554) -- 0:03:17
155000 -- (-1837.048) [-1832.810] (-1835.168) (-1836.735) * [-1838.508] (-1841.844) (-1833.585) (-1834.867) -- 0:03:16
Average standard deviation of split frequencies: 0.000000
155500 -- [-1834.791] (-1832.874) (-1841.889) (-1838.543) * (-1841.673) (-1835.346) (-1833.222) [-1838.390] -- 0:03:15
156000 -- [-1831.929] (-1836.604) (-1835.164) (-1845.771) * (-1840.945) (-1840.455) (-1834.422) [-1831.785] -- 0:03:20
156500 -- (-1832.252) (-1832.382) (-1838.749) [-1837.890] * (-1837.685) [-1830.497] (-1837.878) (-1834.299) -- 0:03:19
157000 -- (-1838.491) [-1833.510] (-1835.501) (-1843.969) * (-1837.169) [-1838.618] (-1838.572) (-1836.120) -- 0:03:18
157500 -- (-1838.882) [-1839.943] (-1833.385) (-1839.164) * (-1837.462) (-1835.247) (-1842.315) [-1833.759] -- 0:03:17
158000 -- (-1837.717) (-1851.606) [-1838.117] (-1837.002) * (-1834.252) [-1839.804] (-1843.636) (-1834.718) -- 0:03:17
158500 -- [-1835.089] (-1838.698) (-1833.610) (-1843.483) * (-1834.338) (-1840.121) (-1833.312) [-1832.908] -- 0:03:16
159000 -- (-1830.662) (-1838.473) (-1830.001) [-1836.913] * (-1832.591) (-1840.862) (-1839.658) [-1837.133] -- 0:03:15
159500 -- (-1829.040) (-1831.261) [-1839.480] (-1840.439) * (-1834.798) [-1842.226] (-1842.256) (-1840.090) -- 0:03:14
160000 -- [-1835.303] (-1834.852) (-1835.483) (-1847.455) * [-1837.225] (-1838.232) (-1842.861) (-1833.887) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
160500 -- (-1835.286) [-1834.777] (-1835.165) (-1840.820) * (-1840.376) (-1834.552) [-1833.312] (-1838.286) -- 0:03:18
161000 -- [-1837.431] (-1832.750) (-1844.477) (-1835.375) * [-1833.117] (-1837.521) (-1830.321) (-1836.063) -- 0:03:18
161500 -- (-1836.522) (-1838.718) (-1838.273) [-1837.302] * (-1838.160) (-1842.262) (-1837.254) [-1831.775] -- 0:03:17
162000 -- [-1837.081] (-1840.532) (-1830.810) (-1838.244) * [-1839.625] (-1841.082) (-1838.570) (-1836.197) -- 0:03:16
162500 -- (-1841.566) (-1838.986) (-1833.519) [-1838.291] * (-1830.591) (-1837.881) (-1846.415) [-1831.476] -- 0:03:15
163000 -- (-1840.639) (-1833.680) [-1831.662] (-1836.064) * (-1846.408) (-1835.934) [-1833.980] (-1835.109) -- 0:03:15
163500 -- (-1833.649) (-1832.611) (-1830.835) [-1837.392] * (-1839.967) (-1837.910) (-1833.146) [-1837.660] -- 0:03:14
164000 -- (-1840.939) (-1835.045) [-1834.282] (-1837.063) * (-1836.693) (-1838.167) [-1833.827] (-1836.356) -- 0:03:13
164500 -- (-1839.491) [-1833.135] (-1834.266) (-1835.641) * (-1838.692) (-1834.884) (-1831.377) [-1842.230] -- 0:03:18
165000 -- (-1833.978) (-1830.531) (-1835.105) [-1833.048] * (-1832.995) (-1833.489) [-1831.540] (-1840.315) -- 0:03:17
Average standard deviation of split frequencies: 0.000000
165500 -- [-1830.920] (-1836.897) (-1841.890) (-1831.901) * (-1838.395) [-1842.433] (-1834.449) (-1831.547) -- 0:03:16
166000 -- [-1834.884] (-1835.237) (-1836.508) (-1833.459) * [-1839.242] (-1835.705) (-1831.927) (-1836.514) -- 0:03:15
166500 -- [-1833.978] (-1837.097) (-1834.698) (-1835.176) * [-1834.498] (-1836.005) (-1840.871) (-1839.043) -- 0:03:15
167000 -- [-1836.399] (-1838.412) (-1833.297) (-1835.331) * (-1838.299) (-1845.280) [-1837.466] (-1838.732) -- 0:03:14
167500 -- (-1835.466) (-1838.809) (-1837.032) [-1838.840] * (-1839.110) [-1838.354] (-1837.158) (-1841.081) -- 0:03:13
168000 -- (-1835.438) [-1837.176] (-1836.430) (-1839.309) * [-1837.153] (-1841.793) (-1836.147) (-1842.358) -- 0:03:13
168500 -- (-1832.137) (-1837.706) [-1840.533] (-1835.729) * (-1834.148) (-1837.966) [-1836.691] (-1837.958) -- 0:03:17
169000 -- (-1831.873) (-1841.383) (-1832.656) [-1835.522] * (-1836.736) (-1837.424) (-1833.451) [-1839.173] -- 0:03:16
169500 -- [-1838.562] (-1838.133) (-1834.854) (-1837.108) * (-1837.474) [-1840.580] (-1833.486) (-1838.742) -- 0:03:15
170000 -- (-1832.887) (-1836.516) [-1834.266] (-1839.195) * [-1833.830] (-1838.085) (-1837.741) (-1834.416) -- 0:03:15
Average standard deviation of split frequencies: 0.000000
170500 -- (-1835.053) (-1840.800) (-1832.182) [-1835.316] * [-1830.878] (-1837.324) (-1836.656) (-1837.632) -- 0:03:14
171000 -- (-1835.981) (-1839.451) (-1832.261) [-1836.260] * (-1841.554) [-1838.410] (-1841.320) (-1836.256) -- 0:03:13
171500 -- (-1835.492) (-1843.916) [-1832.558] (-1835.930) * (-1832.495) (-1836.596) [-1830.505] (-1829.820) -- 0:03:13
172000 -- [-1834.808] (-1837.536) (-1834.688) (-1839.355) * (-1838.830) (-1834.933) (-1834.677) [-1837.101] -- 0:03:12
172500 -- [-1833.997] (-1832.027) (-1832.649) (-1833.919) * (-1831.413) [-1839.434] (-1839.867) (-1834.899) -- 0:03:11
173000 -- (-1840.990) (-1837.456) [-1836.879] (-1837.189) * (-1839.674) [-1844.155] (-1840.968) (-1831.394) -- 0:03:15
173500 -- (-1832.299) [-1838.347] (-1841.474) (-1838.428) * [-1835.915] (-1835.546) (-1834.458) (-1834.892) -- 0:03:15
174000 -- (-1837.084) (-1834.361) (-1834.897) [-1837.247] * (-1833.050) (-1834.319) [-1832.475] (-1836.825) -- 0:03:14
174500 -- [-1835.543] (-1831.947) (-1834.390) (-1838.140) * [-1847.476] (-1838.153) (-1833.882) (-1835.384) -- 0:03:13
175000 -- (-1836.330) [-1837.745] (-1833.786) (-1842.658) * (-1842.426) [-1836.060] (-1841.115) (-1841.919) -- 0:03:13
Average standard deviation of split frequencies: 0.000000
175500 -- (-1841.697) (-1841.632) [-1833.300] (-1839.521) * (-1839.450) (-1838.862) [-1832.734] (-1838.244) -- 0:03:12
176000 -- (-1840.139) [-1834.931] (-1838.597) (-1845.494) * (-1836.117) [-1834.404] (-1837.936) (-1843.471) -- 0:03:11
176500 -- (-1840.366) (-1837.215) [-1840.267] (-1836.734) * (-1835.833) (-1843.399) [-1833.121] (-1838.297) -- 0:03:11
177000 -- (-1843.752) [-1835.498] (-1836.602) (-1838.998) * (-1834.663) (-1839.671) [-1833.873] (-1840.044) -- 0:03:10
177500 -- (-1832.370) [-1836.025] (-1837.239) (-1834.154) * (-1834.912) [-1837.751] (-1834.255) (-1832.392) -- 0:03:14
178000 -- (-1841.565) (-1835.839) (-1835.894) [-1838.364] * (-1836.427) (-1843.839) (-1835.493) [-1840.224] -- 0:03:13
178500 -- (-1835.920) (-1839.884) (-1837.291) [-1838.274] * [-1837.528] (-1845.516) (-1837.971) (-1838.398) -- 0:03:13
179000 -- (-1830.124) (-1837.785) (-1844.009) [-1843.449] * (-1835.353) (-1837.701) (-1844.259) [-1833.776] -- 0:03:12
179500 -- (-1834.690) (-1838.842) [-1832.169] (-1839.695) * [-1833.804] (-1838.043) (-1834.419) (-1837.612) -- 0:03:11
180000 -- [-1834.158] (-1835.947) (-1841.543) (-1839.661) * (-1836.684) [-1833.896] (-1836.506) (-1836.051) -- 0:03:11
Average standard deviation of split frequencies: 0.000000
180500 -- (-1831.340) [-1841.688] (-1835.573) (-1838.284) * [-1833.097] (-1835.290) (-1840.119) (-1836.058) -- 0:03:10
181000 -- (-1835.720) (-1839.380) [-1832.535] (-1844.263) * [-1840.266] (-1837.052) (-1830.595) (-1837.843) -- 0:03:10
181500 -- (-1840.400) (-1846.426) (-1837.717) [-1837.850] * [-1836.067] (-1835.280) (-1835.478) (-1835.689) -- 0:03:13
182000 -- (-1843.622) (-1840.985) [-1832.015] (-1834.497) * [-1837.453] (-1840.978) (-1843.719) (-1832.767) -- 0:03:13
182500 -- [-1838.569] (-1845.784) (-1833.987) (-1832.026) * (-1847.629) (-1836.114) [-1830.894] (-1834.669) -- 0:03:12
183000 -- (-1838.805) (-1843.128) (-1840.161) [-1834.574] * [-1834.489] (-1834.092) (-1834.940) (-1845.529) -- 0:03:11
183500 -- (-1838.310) (-1842.465) [-1832.742] (-1834.301) * (-1839.914) [-1838.825] (-1846.504) (-1838.334) -- 0:03:11
184000 -- (-1833.724) (-1842.464) [-1833.748] (-1833.390) * [-1835.129] (-1835.444) (-1839.958) (-1839.596) -- 0:03:10
184500 -- [-1836.310] (-1835.627) (-1837.929) (-1833.714) * (-1839.167) (-1837.149) [-1843.733] (-1840.248) -- 0:03:10
185000 -- (-1831.784) [-1833.992] (-1834.275) (-1851.675) * [-1839.365] (-1834.013) (-1837.820) (-1836.500) -- 0:03:09
Average standard deviation of split frequencies: 0.000000
185500 -- (-1837.661) (-1835.110) (-1834.826) [-1837.107] * (-1835.351) [-1844.218] (-1840.543) (-1836.909) -- 0:03:08
186000 -- (-1835.501) (-1831.644) (-1836.050) [-1835.173] * (-1835.320) (-1839.208) (-1833.224) [-1834.448] -- 0:03:12
186500 -- (-1834.610) [-1835.814] (-1840.983) (-1836.452) * (-1833.188) [-1834.974] (-1838.123) (-1841.727) -- 0:03:11
187000 -- [-1833.633] (-1838.165) (-1834.781) (-1832.323) * (-1834.277) [-1832.165] (-1837.886) (-1837.306) -- 0:03:11
187500 -- (-1832.838) (-1837.303) [-1833.935] (-1840.563) * [-1833.997] (-1831.094) (-1836.851) (-1838.013) -- 0:03:10
188000 -- [-1833.818] (-1833.776) (-1835.648) (-1841.256) * (-1836.481) (-1836.726) [-1838.250] (-1840.337) -- 0:03:10
188500 -- (-1836.493) [-1830.194] (-1834.067) (-1833.207) * [-1840.699] (-1841.699) (-1839.188) (-1839.719) -- 0:03:09
189000 -- (-1837.332) [-1838.104] (-1837.141) (-1833.202) * (-1835.753) (-1842.589) [-1838.879] (-1831.315) -- 0:03:08
189500 -- (-1837.564) (-1835.473) [-1831.309] (-1837.845) * [-1835.791] (-1853.749) (-1839.530) (-1832.364) -- 0:03:08
190000 -- (-1849.956) (-1843.228) [-1834.177] (-1832.956) * (-1840.518) (-1844.048) [-1836.912] (-1839.981) -- 0:03:07
Average standard deviation of split frequencies: 0.000000
190500 -- (-1835.764) [-1835.585] (-1834.090) (-1843.686) * (-1833.319) (-1845.491) [-1838.808] (-1831.059) -- 0:03:11
191000 -- (-1842.360) [-1836.047] (-1832.511) (-1838.956) * [-1836.379] (-1848.517) (-1844.855) (-1841.676) -- 0:03:10
191500 -- (-1836.219) (-1841.650) (-1839.911) [-1837.304] * (-1835.596) (-1838.916) [-1834.180] (-1839.424) -- 0:03:09
192000 -- (-1838.141) (-1836.549) (-1835.150) [-1837.100] * (-1836.517) (-1836.727) (-1838.137) [-1838.270] -- 0:03:09
192500 -- (-1841.466) (-1837.713) (-1838.580) [-1839.381] * (-1836.670) [-1832.911] (-1838.659) (-1835.150) -- 0:03:08
193000 -- (-1830.082) (-1836.469) (-1834.428) [-1835.292] * (-1837.597) (-1841.865) (-1835.722) [-1830.976] -- 0:03:08
193500 -- (-1837.032) [-1835.693] (-1833.209) (-1836.270) * (-1835.070) (-1836.184) [-1832.611] (-1837.033) -- 0:03:07
194000 -- [-1832.860] (-1835.128) (-1843.300) (-1830.827) * (-1833.245) [-1833.671] (-1834.888) (-1841.646) -- 0:03:06
194500 -- (-1834.812) [-1833.157] (-1838.470) (-1833.195) * (-1837.532) [-1833.323] (-1834.499) (-1838.090) -- 0:03:10
195000 -- [-1831.566] (-1840.989) (-1840.395) (-1835.338) * (-1839.022) (-1837.259) (-1835.975) [-1834.734] -- 0:03:09
Average standard deviation of split frequencies: 0.000000
195500 -- (-1832.138) (-1836.400) [-1840.254] (-1833.585) * (-1836.387) (-1837.695) (-1833.698) [-1840.892] -- 0:03:09
196000 -- [-1835.778] (-1836.705) (-1837.773) (-1830.194) * (-1840.493) (-1835.657) (-1839.312) [-1840.470] -- 0:03:08
196500 -- (-1833.781) (-1841.190) [-1835.355] (-1839.581) * (-1836.260) (-1838.732) (-1842.392) [-1837.825] -- 0:03:08
197000 -- [-1836.129] (-1831.997) (-1844.629) (-1833.871) * (-1837.224) [-1834.883] (-1832.975) (-1844.419) -- 0:03:07
197500 -- (-1839.844) [-1839.854] (-1838.038) (-1837.045) * [-1841.456] (-1839.151) (-1837.528) (-1836.138) -- 0:03:06
198000 -- (-1833.037) [-1838.627] (-1843.047) (-1836.056) * (-1841.147) [-1831.975] (-1841.669) (-1838.620) -- 0:03:06
198500 -- (-1839.745) (-1848.118) (-1836.799) [-1832.816] * (-1842.206) (-1832.658) (-1837.234) [-1834.116] -- 0:03:05
199000 -- (-1832.617) (-1837.112) (-1832.954) [-1834.944] * (-1837.673) [-1837.132] (-1844.326) (-1833.943) -- 0:03:09
199500 -- (-1836.391) (-1839.833) [-1833.566] (-1834.857) * (-1840.218) (-1840.310) [-1844.760] (-1836.417) -- 0:03:08
200000 -- [-1834.132] (-1839.481) (-1835.787) (-1836.047) * (-1839.677) (-1837.008) (-1836.986) [-1834.981] -- 0:03:08
Average standard deviation of split frequencies: 0.000000
200500 -- (-1833.859) (-1838.581) [-1834.225] (-1832.343) * (-1837.073) [-1832.363] (-1839.766) (-1841.833) -- 0:03:07
201000 -- (-1835.869) (-1834.781) [-1835.972] (-1836.746) * (-1839.606) (-1835.246) (-1836.224) [-1839.097] -- 0:03:06
201500 -- [-1833.240] (-1836.335) (-1843.219) (-1835.470) * (-1838.552) [-1835.795] (-1835.591) (-1840.340) -- 0:03:06
202000 -- (-1840.710) (-1837.043) (-1833.086) [-1835.320] * [-1836.703] (-1837.201) (-1835.603) (-1840.556) -- 0:03:05
202500 -- (-1835.844) (-1834.727) [-1832.170] (-1839.431) * (-1834.402) (-1834.150) (-1837.311) [-1837.033] -- 0:03:05
203000 -- (-1844.987) (-1835.476) (-1837.706) [-1835.861] * [-1836.061] (-1839.500) (-1833.938) (-1838.632) -- 0:03:08
203500 -- (-1843.687) [-1836.545] (-1835.041) (-1845.864) * (-1834.982) (-1833.854) (-1838.115) [-1836.743] -- 0:03:07
204000 -- [-1840.223] (-1839.879) (-1840.629) (-1833.108) * [-1835.250] (-1836.758) (-1842.215) (-1842.667) -- 0:03:07
204500 -- (-1833.518) (-1833.073) [-1837.372] (-1833.026) * (-1833.769) (-1836.117) (-1836.942) [-1833.443] -- 0:03:06
205000 -- (-1835.388) (-1832.864) (-1837.962) [-1836.522] * (-1830.167) (-1839.169) (-1838.190) [-1838.569] -- 0:03:06
Average standard deviation of split frequencies: 0.000000
205500 -- (-1836.771) (-1842.726) (-1846.765) [-1833.788] * [-1836.319] (-1842.739) (-1840.550) (-1839.782) -- 0:03:05
206000 -- (-1834.603) [-1839.269] (-1834.617) (-1834.761) * [-1834.238] (-1838.067) (-1833.631) (-1834.355) -- 0:03:05
206500 -- (-1845.442) [-1833.705] (-1835.086) (-1833.151) * [-1842.741] (-1833.320) (-1841.939) (-1841.341) -- 0:03:04
207000 -- (-1836.024) (-1834.665) (-1834.258) [-1833.071] * (-1835.609) [-1834.692] (-1834.414) (-1834.932) -- 0:03:03
207500 -- (-1841.070) (-1830.927) [-1837.832] (-1832.505) * (-1838.553) (-1838.241) [-1837.392] (-1836.896) -- 0:03:07
208000 -- (-1835.735) [-1833.804] (-1835.316) (-1831.626) * (-1842.079) [-1837.794] (-1835.134) (-1835.605) -- 0:03:06
208500 -- (-1836.261) (-1837.425) [-1837.912] (-1835.395) * (-1834.392) (-1834.342) [-1839.094] (-1836.920) -- 0:03:06
209000 -- (-1837.186) (-1837.030) (-1834.697) [-1835.015] * (-1845.276) [-1834.486] (-1833.674) (-1836.439) -- 0:03:05
209500 -- (-1840.807) (-1832.330) (-1832.397) [-1841.244] * [-1835.010] (-1838.530) (-1835.742) (-1838.722) -- 0:03:04
210000 -- (-1834.073) (-1839.697) (-1833.709) [-1835.738] * (-1837.599) [-1833.806] (-1839.435) (-1836.578) -- 0:03:04
Average standard deviation of split frequencies: 0.000000
210500 -- (-1841.607) [-1838.926] (-1838.439) (-1835.070) * (-1837.599) (-1835.701) [-1843.627] (-1833.820) -- 0:03:03
211000 -- [-1834.690] (-1835.883) (-1834.073) (-1843.342) * [-1840.069] (-1835.558) (-1845.529) (-1835.655) -- 0:03:03
211500 -- (-1831.691) [-1841.078] (-1835.297) (-1842.616) * (-1836.220) (-1834.828) (-1841.413) [-1832.850] -- 0:03:02
212000 -- [-1840.127] (-1833.024) (-1834.634) (-1839.047) * (-1839.943) [-1836.991] (-1835.058) (-1839.472) -- 0:03:05
212500 -- [-1831.330] (-1837.637) (-1834.794) (-1841.587) * (-1831.353) [-1834.844] (-1835.589) (-1845.689) -- 0:03:05
213000 -- [-1833.174] (-1843.900) (-1838.365) (-1833.226) * [-1838.400] (-1840.345) (-1837.694) (-1843.296) -- 0:03:04
213500 -- (-1838.568) (-1837.158) [-1832.694] (-1845.983) * [-1835.395] (-1843.833) (-1834.743) (-1831.964) -- 0:03:04
214000 -- (-1838.322) (-1843.405) (-1832.967) [-1834.122] * [-1834.808] (-1856.259) (-1838.312) (-1834.548) -- 0:03:03
214500 -- (-1845.315) (-1836.606) (-1835.391) [-1834.803] * (-1832.401) (-1843.506) [-1833.349] (-1839.230) -- 0:03:03
215000 -- (-1836.932) (-1833.477) [-1845.803] (-1832.291) * (-1833.602) (-1834.801) (-1834.876) [-1837.528] -- 0:03:02
Average standard deviation of split frequencies: 0.000000
215500 -- [-1838.994] (-1848.259) (-1834.999) (-1833.341) * (-1836.622) (-1832.520) [-1834.003] (-1839.535) -- 0:03:02
216000 -- (-1834.946) (-1835.569) [-1834.422] (-1837.323) * (-1840.243) (-1841.140) (-1835.691) [-1829.811] -- 0:03:05
216500 -- (-1835.741) (-1834.299) (-1834.337) [-1835.399] * (-1838.521) [-1834.298] (-1840.041) (-1836.715) -- 0:03:04
217000 -- (-1842.378) [-1840.326] (-1838.212) (-1848.411) * [-1835.123] (-1832.435) (-1834.589) (-1835.022) -- 0:03:04
217500 -- (-1835.147) (-1836.072) [-1841.959] (-1846.051) * (-1833.838) (-1836.947) (-1831.378) [-1839.729] -- 0:03:03
218000 -- [-1835.345] (-1840.557) (-1843.655) (-1836.385) * (-1838.810) (-1838.710) [-1835.064] (-1838.468) -- 0:03:02
218500 -- (-1838.629) (-1839.228) (-1845.807) [-1831.341] * [-1836.455] (-1833.428) (-1836.414) (-1840.325) -- 0:03:02
219000 -- (-1838.745) (-1835.070) [-1838.484] (-1834.981) * [-1834.604] (-1831.731) (-1836.058) (-1832.183) -- 0:03:01
219500 -- (-1835.539) (-1833.223) [-1837.029] (-1838.025) * [-1831.513] (-1834.318) (-1852.709) (-1832.603) -- 0:03:01
220000 -- (-1837.036) (-1835.122) [-1834.913] (-1842.632) * (-1839.640) (-1845.446) [-1833.480] (-1836.796) -- 0:03:00
Average standard deviation of split frequencies: 0.000000
220500 -- [-1830.147] (-1836.500) (-1836.694) (-1845.458) * (-1832.793) (-1849.500) (-1839.135) [-1837.919] -- 0:03:03
221000 -- (-1835.888) [-1834.047] (-1837.789) (-1840.944) * (-1842.981) (-1845.458) (-1834.304) [-1835.728] -- 0:03:03
221500 -- (-1841.173) [-1838.434] (-1842.315) (-1843.968) * [-1835.662] (-1837.876) (-1836.198) (-1840.832) -- 0:03:02
222000 -- [-1835.554] (-1840.820) (-1837.937) (-1837.241) * [-1836.647] (-1833.626) (-1839.199) (-1837.097) -- 0:03:02
222500 -- (-1836.470) [-1834.495] (-1832.805) (-1839.848) * (-1833.890) [-1837.653] (-1837.932) (-1834.131) -- 0:03:01
223000 -- (-1835.015) (-1836.923) (-1831.068) [-1840.431] * (-1833.326) [-1837.034] (-1836.359) (-1833.530) -- 0:03:01
223500 -- [-1833.132] (-1846.198) (-1841.031) (-1838.455) * [-1830.033] (-1836.680) (-1837.576) (-1837.844) -- 0:03:00
224000 -- (-1836.849) [-1837.105] (-1836.058) (-1834.707) * (-1835.803) (-1835.878) (-1834.699) [-1841.001] -- 0:03:00
224500 -- (-1834.804) (-1836.914) [-1832.969] (-1834.844) * (-1833.593) (-1842.629) (-1835.245) [-1832.344] -- 0:02:59
225000 -- (-1834.425) (-1832.394) [-1835.703] (-1838.191) * (-1834.547) [-1834.948] (-1837.148) (-1837.027) -- 0:03:02
Average standard deviation of split frequencies: 0.000000
225500 -- (-1832.648) (-1833.478) (-1841.306) [-1833.211] * [-1839.114] (-1838.469) (-1837.032) (-1836.335) -- 0:03:02
226000 -- (-1834.021) (-1832.060) (-1841.589) [-1834.337] * (-1837.971) (-1833.936) (-1837.783) [-1836.091] -- 0:03:01
226500 -- (-1834.424) (-1838.924) [-1837.273] (-1835.218) * [-1833.457] (-1835.112) (-1837.835) (-1832.702) -- 0:03:00
227000 -- (-1838.404) [-1833.325] (-1835.105) (-1834.983) * [-1840.010] (-1831.819) (-1829.614) (-1836.286) -- 0:03:00
227500 -- [-1831.052] (-1834.281) (-1831.502) (-1841.708) * (-1837.285) (-1841.486) (-1833.750) [-1843.942] -- 0:02:59
228000 -- (-1843.534) (-1842.229) [-1836.652] (-1834.712) * (-1837.474) (-1833.409) (-1835.354) [-1835.652] -- 0:02:59
228500 -- (-1834.998) (-1841.518) (-1833.811) [-1835.179] * (-1834.682) (-1832.607) [-1836.219] (-1831.277) -- 0:02:58
229000 -- [-1833.581] (-1845.630) (-1843.260) (-1830.874) * (-1834.561) (-1830.911) [-1847.180] (-1837.861) -- 0:03:01
229500 -- (-1834.427) (-1842.650) (-1840.071) [-1836.684] * (-1837.824) (-1836.246) (-1837.242) [-1837.105] -- 0:03:01
230000 -- (-1834.926) (-1838.031) (-1837.568) [-1832.550] * (-1845.744) [-1829.574] (-1840.141) (-1832.755) -- 0:03:00
Average standard deviation of split frequencies: 0.000000
230500 -- (-1832.821) (-1834.545) (-1835.784) [-1835.127] * (-1851.823) [-1834.888] (-1833.161) (-1830.900) -- 0:03:00
231000 -- (-1834.534) (-1830.951) (-1836.248) [-1831.356] * (-1838.304) (-1833.554) [-1835.263] (-1840.884) -- 0:02:59
231500 -- (-1840.914) [-1834.602] (-1841.994) (-1832.894) * (-1834.897) (-1834.290) [-1838.727] (-1836.564) -- 0:02:59
232000 -- (-1838.663) (-1829.094) [-1835.803] (-1843.434) * (-1845.587) [-1834.857] (-1840.503) (-1838.800) -- 0:02:58
232500 -- (-1835.143) (-1835.147) [-1836.262] (-1835.047) * (-1836.833) (-1832.919) (-1831.265) [-1841.408] -- 0:02:58
233000 -- [-1832.496] (-1837.290) (-1835.119) (-1848.885) * (-1836.056) (-1834.760) [-1830.954] (-1836.740) -- 0:02:57
233500 -- (-1835.924) [-1833.975] (-1831.830) (-1832.676) * (-1842.755) (-1836.941) (-1836.297) [-1832.894] -- 0:03:00
234000 -- (-1841.228) (-1833.144) (-1830.209) [-1837.117] * [-1834.656] (-1836.361) (-1834.487) (-1836.553) -- 0:03:00
234500 -- (-1837.270) (-1836.061) [-1834.551] (-1836.740) * [-1839.637] (-1835.102) (-1833.672) (-1843.767) -- 0:02:59
235000 -- (-1832.541) (-1834.912) (-1833.198) [-1832.592] * (-1838.435) [-1833.164] (-1838.774) (-1834.133) -- 0:02:59
Average standard deviation of split frequencies: 0.000000
235500 -- [-1839.448] (-1837.448) (-1832.667) (-1840.994) * (-1832.829) [-1832.397] (-1853.521) (-1834.777) -- 0:02:58
236000 -- (-1836.111) (-1832.449) (-1838.159) [-1831.267] * (-1830.083) [-1838.823] (-1837.314) (-1839.350) -- 0:02:58
236500 -- (-1834.775) (-1830.912) [-1832.904] (-1834.770) * (-1835.871) [-1835.117] (-1839.527) (-1833.597) -- 0:02:57
237000 -- (-1835.238) [-1835.855] (-1833.777) (-1839.824) * (-1837.601) (-1840.532) [-1830.724] (-1835.475) -- 0:02:57
237500 -- (-1836.824) [-1831.742] (-1832.361) (-1840.656) * (-1839.900) (-1841.286) (-1832.716) [-1836.686] -- 0:02:56
238000 -- (-1833.381) (-1829.954) [-1829.884] (-1841.131) * (-1836.208) (-1836.546) [-1832.244] (-1839.376) -- 0:02:59
238500 -- (-1838.598) (-1835.857) [-1838.883] (-1841.990) * (-1834.938) (-1840.647) (-1834.632) [-1837.677] -- 0:02:58
239000 -- (-1836.320) [-1832.878] (-1836.005) (-1835.911) * (-1837.875) [-1835.406] (-1835.414) (-1841.487) -- 0:02:58
239500 -- [-1834.561] (-1834.140) (-1835.945) (-1836.424) * (-1839.923) [-1838.105] (-1836.262) (-1841.786) -- 0:02:57
240000 -- (-1836.330) (-1833.276) (-1831.682) [-1837.828] * (-1836.438) (-1832.793) (-1831.215) [-1836.107] -- 0:02:57
Average standard deviation of split frequencies: 0.000000
240500 -- (-1840.750) (-1834.652) (-1836.590) [-1837.114] * (-1839.434) (-1836.601) (-1835.740) [-1836.080] -- 0:02:56
241000 -- (-1840.830) (-1836.289) (-1835.508) [-1834.164] * (-1838.789) [-1835.631] (-1839.949) (-1837.427) -- 0:02:56
241500 -- (-1837.706) (-1831.437) (-1835.994) [-1838.516] * (-1838.577) [-1838.510] (-1835.715) (-1844.751) -- 0:02:55
242000 -- [-1835.305] (-1835.527) (-1832.117) (-1842.716) * (-1834.665) (-1839.931) (-1833.945) [-1832.967] -- 0:02:58
242500 -- (-1836.890) (-1837.021) [-1835.950] (-1832.387) * (-1845.542) [-1832.519] (-1832.697) (-1839.522) -- 0:02:58
243000 -- (-1841.730) (-1841.501) [-1836.748] (-1833.147) * (-1837.088) (-1834.480) [-1836.458] (-1837.911) -- 0:02:57
243500 -- [-1837.695] (-1849.059) (-1832.667) (-1838.487) * (-1833.991) [-1832.848] (-1836.432) (-1838.312) -- 0:02:57
244000 -- [-1840.438] (-1839.794) (-1834.242) (-1840.783) * (-1837.692) [-1832.243] (-1836.803) (-1837.756) -- 0:02:56
244500 -- [-1833.251] (-1837.892) (-1831.754) (-1841.487) * (-1834.478) (-1835.646) (-1845.105) [-1836.957] -- 0:02:56
245000 -- [-1838.363] (-1839.094) (-1834.455) (-1842.187) * (-1837.147) (-1837.116) [-1836.631] (-1831.663) -- 0:02:55
Average standard deviation of split frequencies: 0.000000
245500 -- (-1837.042) (-1836.294) (-1830.957) [-1836.305] * [-1834.580] (-1832.699) (-1840.297) (-1835.678) -- 0:02:55
246000 -- (-1833.269) [-1837.020] (-1835.705) (-1833.492) * (-1837.246) (-1835.951) [-1840.032] (-1831.897) -- 0:02:54
246500 -- (-1833.243) [-1832.443] (-1832.895) (-1838.475) * (-1838.802) [-1834.203] (-1837.907) (-1834.446) -- 0:02:57
247000 -- (-1831.102) (-1836.418) [-1835.008] (-1835.701) * (-1842.171) (-1839.968) (-1835.034) [-1831.836] -- 0:02:56
247500 -- (-1844.493) (-1839.025) [-1835.915] (-1833.496) * (-1841.285) [-1834.610] (-1835.255) (-1839.733) -- 0:02:56
248000 -- (-1837.761) (-1841.236) [-1832.863] (-1835.041) * [-1835.139] (-1832.115) (-1839.268) (-1839.465) -- 0:02:55
248500 -- (-1840.054) (-1834.214) (-1829.191) [-1835.547] * (-1832.123) [-1834.666] (-1830.745) (-1838.241) -- 0:02:55
249000 -- (-1836.972) [-1831.087] (-1831.410) (-1840.742) * (-1831.591) (-1836.793) (-1833.289) [-1834.442] -- 0:02:54
249500 -- (-1843.341) [-1835.514] (-1838.299) (-1847.514) * [-1836.002] (-1838.656) (-1836.583) (-1843.973) -- 0:02:54
250000 -- [-1837.230] (-1832.037) (-1834.239) (-1840.148) * (-1836.606) [-1833.598] (-1838.374) (-1833.263) -- 0:02:54
Average standard deviation of split frequencies: 0.000000
250500 -- (-1834.577) (-1846.383) [-1838.365] (-1840.488) * (-1833.448) (-1839.919) (-1841.273) [-1837.532] -- 0:02:56
251000 -- [-1835.949] (-1840.821) (-1831.140) (-1836.186) * (-1833.587) (-1841.327) [-1833.662] (-1842.936) -- 0:02:56
251500 -- (-1836.959) (-1835.418) [-1829.811] (-1837.578) * [-1835.321] (-1841.747) (-1834.300) (-1836.737) -- 0:02:55
252000 -- (-1839.950) [-1835.564] (-1841.441) (-1835.814) * (-1836.938) (-1840.055) [-1835.789] (-1848.808) -- 0:02:55
252500 -- [-1833.170] (-1835.240) (-1840.188) (-1833.480) * (-1840.293) (-1836.542) [-1836.831] (-1849.835) -- 0:02:54
253000 -- (-1836.098) [-1840.577] (-1838.626) (-1834.401) * (-1835.704) [-1836.735] (-1836.375) (-1845.829) -- 0:02:54
253500 -- (-1837.796) (-1835.618) (-1833.651) [-1831.272] * (-1832.494) [-1837.093] (-1844.082) (-1839.837) -- 0:02:53
254000 -- [-1841.854] (-1835.253) (-1836.235) (-1838.278) * (-1834.650) (-1841.403) [-1833.506] (-1834.676) -- 0:02:53
254500 -- [-1838.610] (-1835.978) (-1833.505) (-1837.020) * (-1836.340) [-1836.724] (-1838.314) (-1836.678) -- 0:02:52
255000 -- [-1837.687] (-1843.315) (-1836.472) (-1835.502) * [-1836.813] (-1838.310) (-1841.441) (-1838.303) -- 0:02:55
Average standard deviation of split frequencies: 0.000000
255500 -- (-1836.618) (-1834.367) (-1832.991) [-1833.162] * (-1839.828) (-1839.313) (-1846.910) [-1831.532] -- 0:02:54
256000 -- (-1835.834) (-1837.548) [-1834.657] (-1836.433) * (-1833.647) [-1833.817] (-1834.829) (-1841.984) -- 0:02:54
256500 -- (-1839.847) (-1835.056) (-1834.299) [-1834.065] * (-1837.669) (-1839.802) (-1836.279) [-1831.691] -- 0:02:53
257000 -- (-1834.856) (-1836.334) [-1840.612] (-1835.351) * (-1832.963) [-1831.228] (-1838.119) (-1834.366) -- 0:02:53
257500 -- (-1839.375) (-1834.085) [-1838.606] (-1840.360) * (-1833.782) [-1831.245] (-1844.242) (-1835.617) -- 0:02:53
258000 -- (-1840.449) [-1838.262] (-1836.876) (-1836.872) * (-1835.187) (-1832.900) [-1836.922] (-1835.311) -- 0:02:52
258500 -- (-1841.487) (-1835.313) [-1838.001] (-1832.682) * (-1839.550) [-1837.932] (-1835.976) (-1840.045) -- 0:02:52
259000 -- (-1837.509) [-1842.228] (-1834.985) (-1837.577) * [-1835.990] (-1838.725) (-1833.184) (-1836.991) -- 0:02:51
259500 -- (-1834.010) [-1834.882] (-1834.575) (-1837.029) * (-1835.054) [-1834.658] (-1835.381) (-1834.363) -- 0:02:54
260000 -- (-1838.565) (-1833.409) (-1835.752) [-1847.348] * (-1840.109) [-1831.223] (-1835.850) (-1834.519) -- 0:02:53
Average standard deviation of split frequencies: 0.000000
260500 -- (-1838.025) (-1837.834) [-1837.506] (-1838.147) * (-1838.907) (-1838.961) [-1835.185] (-1835.330) -- 0:02:53
261000 -- (-1838.008) (-1838.670) (-1834.952) [-1840.475] * (-1837.398) (-1832.090) [-1835.631] (-1839.924) -- 0:02:52
261500 -- [-1828.452] (-1836.498) (-1836.891) (-1840.933) * [-1834.555] (-1833.328) (-1832.326) (-1833.769) -- 0:02:52
262000 -- [-1833.757] (-1837.239) (-1833.892) (-1837.193) * (-1831.381) (-1837.713) (-1831.755) [-1838.031] -- 0:02:51
262500 -- [-1835.635] (-1844.353) (-1837.360) (-1835.034) * (-1835.915) (-1834.945) (-1837.245) [-1833.349] -- 0:02:51
263000 -- (-1834.447) [-1836.466] (-1849.021) (-1839.697) * (-1833.767) (-1836.902) (-1837.640) [-1834.461] -- 0:02:50
263500 -- (-1838.793) [-1834.458] (-1830.649) (-1841.707) * (-1837.333) (-1833.923) (-1838.720) [-1839.833] -- 0:02:53
264000 -- (-1841.393) [-1832.473] (-1836.401) (-1839.537) * (-1835.188) [-1833.331] (-1836.738) (-1839.026) -- 0:02:52
264500 -- (-1840.381) [-1833.223] (-1836.510) (-1843.906) * (-1839.219) (-1833.817) [-1837.930] (-1835.650) -- 0:02:52
265000 -- (-1833.234) (-1837.949) [-1833.478] (-1844.790) * [-1838.276] (-1833.891) (-1833.846) (-1838.282) -- 0:02:51
Average standard deviation of split frequencies: 0.000000
265500 -- (-1832.383) [-1834.718] (-1837.657) (-1848.197) * (-1834.201) (-1839.588) (-1835.887) [-1833.699] -- 0:02:51
266000 -- (-1838.636) (-1833.350) [-1833.668] (-1833.084) * (-1837.424) (-1836.376) (-1836.384) [-1833.465] -- 0:02:51
266500 -- (-1834.269) (-1834.871) [-1833.304] (-1835.185) * (-1840.645) (-1833.084) (-1834.224) [-1835.143] -- 0:02:50
267000 -- (-1835.120) (-1838.166) (-1835.584) [-1834.153] * (-1833.825) (-1836.656) (-1830.519) [-1831.758] -- 0:02:50
267500 -- (-1836.134) (-1835.711) (-1836.463) [-1831.775] * (-1840.988) (-1845.341) [-1831.903] (-1838.248) -- 0:02:49
268000 -- [-1832.810] (-1836.220) (-1834.668) (-1832.350) * (-1832.195) [-1835.989] (-1833.813) (-1838.051) -- 0:02:52
268500 -- (-1831.988) (-1836.910) [-1833.894] (-1839.339) * (-1831.554) (-1835.609) (-1838.032) [-1832.861] -- 0:02:51
269000 -- [-1837.742] (-1836.697) (-1839.184) (-1841.182) * [-1835.466] (-1832.587) (-1836.542) (-1832.428) -- 0:02:51
269500 -- (-1841.011) [-1839.300] (-1840.901) (-1837.883) * [-1841.097] (-1832.288) (-1836.480) (-1836.790) -- 0:02:50
270000 -- [-1834.103] (-1842.418) (-1837.835) (-1839.057) * (-1840.749) (-1835.923) [-1836.525] (-1837.144) -- 0:02:50
Average standard deviation of split frequencies: 0.000000
270500 -- (-1834.442) (-1839.682) (-1837.810) [-1834.016] * (-1838.763) [-1831.581] (-1842.590) (-1840.724) -- 0:02:49
271000 -- (-1838.871) (-1839.605) [-1832.250] (-1837.679) * (-1835.905) [-1831.238] (-1851.781) (-1836.340) -- 0:02:49
271500 -- (-1831.179) (-1841.561) [-1835.505] (-1842.354) * (-1843.001) [-1831.044] (-1839.207) (-1835.276) -- 0:02:49
272000 -- (-1843.641) (-1841.251) [-1830.044] (-1837.954) * (-1836.982) [-1832.493] (-1846.161) (-1836.366) -- 0:02:51
272500 -- [-1835.965] (-1834.061) (-1832.947) (-1834.031) * (-1835.279) [-1834.804] (-1836.059) (-1838.309) -- 0:02:50
273000 -- (-1836.566) (-1836.913) [-1837.219] (-1836.605) * (-1835.974) (-1832.018) [-1832.627] (-1846.254) -- 0:02:50
273500 -- (-1842.318) [-1834.087] (-1835.233) (-1833.402) * [-1837.354] (-1833.838) (-1838.635) (-1837.928) -- 0:02:50
274000 -- [-1835.405] (-1842.263) (-1841.001) (-1836.334) * [-1837.307] (-1834.981) (-1839.744) (-1837.718) -- 0:02:49
274500 -- (-1838.049) (-1836.873) (-1832.030) [-1829.680] * (-1837.844) (-1832.471) (-1835.589) [-1835.299] -- 0:02:49
275000 -- (-1832.785) (-1833.702) (-1835.846) [-1832.204] * (-1833.858) [-1831.647] (-1837.053) (-1841.060) -- 0:02:48
Average standard deviation of split frequencies: 0.000000
275500 -- (-1842.144) [-1840.028] (-1833.233) (-1832.141) * [-1834.113] (-1832.857) (-1837.146) (-1834.190) -- 0:02:48
276000 -- (-1836.559) (-1850.523) (-1838.724) [-1832.306] * (-1835.903) (-1831.327) [-1834.845] (-1834.538) -- 0:02:47
276500 -- (-1833.723) (-1838.804) [-1834.383] (-1840.032) * (-1838.924) (-1833.484) (-1832.433) [-1836.945] -- 0:02:50
277000 -- [-1834.757] (-1838.506) (-1835.855) (-1832.416) * [-1844.639] (-1837.037) (-1835.694) (-1836.317) -- 0:02:49
277500 -- [-1829.924] (-1834.908) (-1838.827) (-1838.601) * (-1836.707) (-1835.807) (-1835.281) [-1830.848] -- 0:02:49
278000 -- (-1838.103) [-1841.069] (-1837.934) (-1838.145) * [-1841.275] (-1838.444) (-1836.167) (-1836.879) -- 0:02:48
278500 -- [-1837.147] (-1836.232) (-1838.274) (-1843.463) * [-1835.686] (-1845.129) (-1836.947) (-1840.926) -- 0:02:48
279000 -- (-1832.956) (-1841.144) [-1835.737] (-1841.076) * (-1835.032) (-1844.832) (-1839.291) [-1832.589] -- 0:02:47
279500 -- (-1832.096) [-1836.210] (-1836.961) (-1835.323) * (-1841.707) [-1838.526] (-1839.232) (-1834.533) -- 0:02:47
280000 -- (-1842.023) (-1831.351) (-1837.851) [-1834.842] * (-1841.879) (-1837.300) (-1836.127) [-1833.151] -- 0:02:47
Average standard deviation of split frequencies: 0.000000
280500 -- (-1835.322) (-1838.119) [-1835.573] (-1839.408) * [-1835.402] (-1843.208) (-1844.954) (-1830.209) -- 0:02:49
281000 -- (-1831.332) (-1831.467) [-1833.279] (-1839.604) * (-1836.044) (-1834.344) [-1836.911] (-1836.915) -- 0:02:48
281500 -- (-1838.551) (-1833.313) (-1838.066) [-1836.385] * (-1830.113) [-1836.500] (-1841.262) (-1839.264) -- 0:02:48
282000 -- [-1835.966] (-1847.189) (-1836.196) (-1836.891) * (-1835.810) [-1831.349] (-1836.819) (-1831.522) -- 0:02:48
282500 -- (-1840.599) (-1841.023) (-1840.453) [-1830.455] * (-1837.868) (-1839.892) (-1833.890) [-1831.796] -- 0:02:47
283000 -- (-1843.498) (-1836.857) [-1835.843] (-1835.289) * [-1835.468] (-1850.020) (-1838.766) (-1830.338) -- 0:02:47
283500 -- (-1834.681) (-1834.441) [-1834.630] (-1832.294) * (-1834.968) (-1845.797) (-1843.380) [-1832.844] -- 0:02:46
284000 -- (-1839.280) [-1836.225] (-1836.453) (-1837.880) * [-1832.914] (-1840.632) (-1842.691) (-1841.890) -- 0:02:46
284500 -- (-1844.851) (-1837.259) [-1833.748] (-1834.505) * (-1843.488) (-1845.376) (-1840.096) [-1836.937] -- 0:02:45
285000 -- (-1836.115) [-1832.252] (-1845.534) (-1835.019) * (-1836.644) [-1835.155] (-1838.455) (-1831.291) -- 0:02:48
Average standard deviation of split frequencies: 0.000000
285500 -- (-1848.291) (-1835.654) [-1834.801] (-1831.361) * (-1834.146) (-1834.656) (-1839.911) [-1830.010] -- 0:02:47
286000 -- (-1839.583) (-1839.043) (-1837.697) [-1833.441] * (-1832.847) (-1838.181) (-1835.132) [-1840.093] -- 0:02:47
286500 -- (-1842.454) (-1836.578) (-1831.282) [-1837.740] * [-1833.211] (-1840.537) (-1834.136) (-1835.538) -- 0:02:46
287000 -- (-1842.970) [-1833.312] (-1840.304) (-1834.635) * (-1832.851) (-1836.210) (-1837.028) [-1836.819] -- 0:02:46
287500 -- (-1835.330) (-1838.379) [-1843.511] (-1834.104) * [-1834.836] (-1835.816) (-1833.356) (-1835.566) -- 0:02:46
288000 -- [-1840.076] (-1838.812) (-1840.358) (-1843.669) * [-1831.243] (-1831.483) (-1834.489) (-1834.103) -- 0:02:45
288500 -- (-1842.300) [-1834.643] (-1836.589) (-1842.981) * (-1841.680) [-1832.537] (-1833.584) (-1845.844) -- 0:02:45
289000 -- [-1838.272] (-1834.292) (-1836.362) (-1839.784) * [-1833.874] (-1840.000) (-1835.374) (-1837.891) -- 0:02:44
289500 -- (-1841.323) [-1838.948] (-1834.415) (-1846.156) * (-1838.980) (-1836.634) [-1839.694] (-1835.341) -- 0:02:46
290000 -- (-1839.710) [-1834.120] (-1832.031) (-1843.505) * (-1829.801) (-1844.460) (-1838.434) [-1837.510] -- 0:02:46
Average standard deviation of split frequencies: 0.000000
290500 -- (-1839.176) [-1829.550] (-1842.425) (-1842.735) * (-1837.469) (-1843.070) (-1840.481) [-1836.310] -- 0:02:46
291000 -- (-1837.725) (-1835.275) [-1838.492] (-1840.535) * (-1842.533) [-1833.090] (-1834.984) (-1839.829) -- 0:02:45
291500 -- (-1840.145) (-1835.829) (-1835.736) [-1832.437] * (-1838.024) [-1841.648] (-1836.436) (-1830.060) -- 0:02:45
292000 -- (-1834.491) (-1830.993) (-1837.574) [-1834.350] * (-1831.116) (-1836.911) (-1837.177) [-1836.835] -- 0:02:44
292500 -- (-1834.204) [-1835.600] (-1834.693) (-1839.684) * [-1835.021] (-1837.213) (-1834.547) (-1844.248) -- 0:02:44
293000 -- [-1837.553] (-1839.529) (-1833.009) (-1839.142) * [-1834.334] (-1837.162) (-1835.886) (-1831.723) -- 0:02:44
293500 -- [-1836.477] (-1838.929) (-1836.772) (-1838.450) * [-1834.709] (-1838.820) (-1840.188) (-1834.547) -- 0:02:46
294000 -- (-1838.065) [-1831.912] (-1841.997) (-1835.448) * [-1838.114] (-1838.058) (-1841.689) (-1836.028) -- 0:02:45
294500 -- [-1838.966] (-1835.934) (-1843.846) (-1834.943) * (-1833.627) [-1835.813] (-1842.446) (-1835.013) -- 0:02:45
295000 -- (-1842.092) (-1839.204) (-1840.255) [-1835.665] * [-1841.001] (-1840.039) (-1840.896) (-1836.054) -- 0:02:44
Average standard deviation of split frequencies: 0.000000
295500 -- (-1836.495) (-1851.209) (-1838.394) [-1834.134] * (-1835.095) (-1840.285) (-1838.872) [-1833.822] -- 0:02:44
296000 -- (-1837.919) (-1842.217) [-1834.501] (-1832.544) * (-1832.686) (-1839.109) [-1839.385] (-1834.810) -- 0:02:44
296500 -- (-1839.104) (-1838.481) [-1835.424] (-1843.870) * (-1838.334) (-1835.690) (-1847.292) [-1837.686] -- 0:02:43
297000 -- [-1838.590] (-1842.954) (-1836.710) (-1833.621) * [-1829.189] (-1835.003) (-1843.543) (-1833.376) -- 0:02:43
297500 -- (-1841.185) [-1833.130] (-1837.115) (-1834.942) * [-1832.719] (-1840.722) (-1839.939) (-1832.692) -- 0:02:42
298000 -- (-1836.865) (-1835.326) [-1834.509] (-1834.612) * (-1835.025) (-1839.538) (-1836.419) [-1834.011] -- 0:02:44
298500 -- (-1835.466) (-1836.746) [-1835.895] (-1831.007) * (-1831.881) [-1834.562] (-1840.009) (-1838.331) -- 0:02:44
299000 -- (-1839.842) [-1840.884] (-1841.047) (-1834.872) * (-1834.615) (-1834.221) (-1841.014) [-1834.579] -- 0:02:44
299500 -- (-1837.298) (-1835.318) (-1842.904) [-1832.926] * [-1836.908] (-1836.315) (-1837.742) (-1839.780) -- 0:02:43
300000 -- [-1833.788] (-1835.568) (-1838.967) (-1834.425) * (-1838.466) (-1836.749) [-1838.218] (-1840.849) -- 0:02:43
Average standard deviation of split frequencies: 0.000000
300500 -- (-1836.357) (-1841.109) (-1837.204) [-1835.371] * (-1840.946) (-1837.774) [-1835.338] (-1835.990) -- 0:02:42
301000 -- (-1833.196) (-1833.834) (-1834.052) [-1833.563] * [-1836.177] (-1835.637) (-1842.385) (-1837.759) -- 0:02:42
301500 -- (-1838.595) (-1835.883) (-1841.513) [-1833.419] * [-1833.989] (-1840.370) (-1832.592) (-1833.291) -- 0:02:42
302000 -- (-1833.265) (-1839.455) [-1833.002] (-1839.073) * (-1842.713) (-1834.751) (-1834.934) [-1831.699] -- 0:02:41
302500 -- (-1839.118) (-1840.112) (-1836.969) [-1836.879] * (-1835.390) (-1839.266) (-1831.609) [-1832.284] -- 0:02:43
303000 -- (-1838.521) [-1832.985] (-1842.589) (-1840.094) * (-1840.066) (-1843.044) [-1836.920] (-1830.253) -- 0:02:43
303500 -- (-1839.903) (-1837.394) (-1834.613) [-1843.858] * [-1833.474] (-1841.733) (-1834.305) (-1833.730) -- 0:02:42
304000 -- (-1837.244) [-1832.956] (-1844.818) (-1845.327) * [-1831.146] (-1833.425) (-1837.680) (-1840.319) -- 0:02:42
304500 -- (-1835.964) [-1841.182] (-1839.057) (-1846.669) * (-1847.045) [-1839.631] (-1838.086) (-1836.166) -- 0:02:42
305000 -- (-1836.869) [-1832.962] (-1836.744) (-1844.567) * (-1836.713) [-1835.273] (-1836.293) (-1840.445) -- 0:02:41
Average standard deviation of split frequencies: 0.000000
305500 -- (-1844.140) (-1837.433) [-1840.735] (-1836.664) * (-1841.562) [-1837.368] (-1841.807) (-1833.014) -- 0:02:41
306000 -- (-1835.542) (-1837.443) (-1841.312) [-1840.943] * (-1848.238) [-1844.815] (-1840.046) (-1846.468) -- 0:02:41
306500 -- [-1834.087] (-1841.954) (-1834.763) (-1836.447) * (-1839.035) [-1834.882] (-1832.850) (-1840.010) -- 0:02:42
307000 -- (-1832.992) (-1835.953) (-1836.916) [-1833.381] * [-1838.666] (-1834.862) (-1834.408) (-1835.654) -- 0:02:42
307500 -- [-1837.127] (-1833.934) (-1836.524) (-1839.337) * (-1841.165) [-1835.428] (-1837.655) (-1833.716) -- 0:02:42
308000 -- (-1841.455) (-1840.033) (-1835.509) [-1833.688] * (-1842.783) [-1838.499] (-1836.875) (-1834.830) -- 0:02:41
308500 -- (-1832.187) [-1837.657] (-1840.597) (-1839.275) * (-1838.875) (-1834.092) (-1837.286) [-1833.477] -- 0:02:41
309000 -- [-1838.893] (-1834.494) (-1846.496) (-1837.715) * (-1838.048) [-1834.690] (-1838.521) (-1843.777) -- 0:02:41
309500 -- (-1834.497) [-1837.288] (-1835.927) (-1836.346) * [-1832.347] (-1831.471) (-1843.673) (-1843.416) -- 0:02:40
310000 -- (-1834.769) (-1837.049) (-1836.173) [-1832.031] * (-1837.344) [-1831.270] (-1839.318) (-1832.485) -- 0:02:40
Average standard deviation of split frequencies: 0.000000
310500 -- (-1838.152) [-1835.566] (-1837.203) (-1834.710) * (-1834.672) (-1835.851) [-1833.140] (-1843.090) -- 0:02:39
311000 -- (-1844.542) (-1836.373) (-1834.935) [-1836.548] * (-1843.808) [-1837.214] (-1836.767) (-1837.103) -- 0:02:41
311500 -- [-1841.775] (-1835.731) (-1837.071) (-1834.173) * (-1843.794) (-1839.687) [-1833.760] (-1841.687) -- 0:02:41
312000 -- (-1853.449) (-1840.071) [-1834.685] (-1833.017) * (-1836.913) [-1841.069] (-1833.307) (-1840.947) -- 0:02:40
312500 -- (-1842.011) [-1839.988] (-1836.165) (-1836.989) * (-1834.409) (-1836.173) (-1835.424) [-1841.257] -- 0:02:40
313000 -- (-1851.036) [-1833.979] (-1832.876) (-1836.368) * (-1832.751) (-1835.490) [-1832.121] (-1835.822) -- 0:02:40
313500 -- (-1851.489) (-1843.694) (-1838.470) [-1837.792] * (-1836.284) (-1832.860) [-1840.555] (-1844.547) -- 0:02:39
314000 -- (-1841.370) [-1832.543] (-1839.313) (-1833.478) * (-1835.244) (-1845.090) (-1833.564) [-1837.714] -- 0:02:39
314500 -- (-1836.142) [-1830.362] (-1834.664) (-1834.977) * [-1830.829] (-1833.806) (-1835.656) (-1831.481) -- 0:02:39
315000 -- (-1831.067) (-1838.417) (-1834.856) [-1833.321] * (-1838.859) (-1828.416) (-1847.032) [-1835.826] -- 0:02:40
Average standard deviation of split frequencies: 0.000000
315500 -- [-1833.788] (-1839.723) (-1837.761) (-1850.221) * (-1834.481) [-1834.966] (-1833.178) (-1835.091) -- 0:02:40
316000 -- (-1837.758) [-1837.802] (-1832.259) (-1835.018) * [-1841.483] (-1830.677) (-1841.289) (-1837.435) -- 0:02:40
316500 -- (-1841.466) [-1837.559] (-1831.638) (-1842.282) * (-1838.693) (-1829.920) (-1832.772) [-1836.252] -- 0:02:39
317000 -- [-1833.547] (-1836.794) (-1834.578) (-1848.198) * (-1834.221) (-1836.487) [-1832.530] (-1836.221) -- 0:02:39
317500 -- (-1838.529) [-1837.885] (-1840.555) (-1837.209) * (-1844.621) [-1840.765] (-1843.890) (-1841.834) -- 0:02:39
318000 -- [-1834.286] (-1837.812) (-1844.716) (-1842.211) * (-1845.655) (-1839.805) [-1837.796] (-1833.908) -- 0:02:38
318500 -- (-1835.657) (-1833.829) [-1838.178] (-1844.346) * (-1841.309) (-1841.368) [-1842.468] (-1832.752) -- 0:02:38
319000 -- (-1842.437) [-1834.041] (-1834.132) (-1835.050) * [-1838.006] (-1840.934) (-1836.004) (-1831.042) -- 0:02:37
319500 -- (-1835.795) (-1832.341) (-1834.760) [-1834.082] * (-1837.371) (-1836.366) [-1830.863] (-1834.305) -- 0:02:39
320000 -- (-1833.888) (-1833.156) (-1838.917) [-1832.662] * [-1841.577] (-1834.997) (-1836.831) (-1835.391) -- 0:02:39
Average standard deviation of split frequencies: 0.000000
320500 -- [-1834.053] (-1841.587) (-1835.385) (-1836.502) * (-1834.724) (-1833.610) (-1840.070) [-1839.875] -- 0:02:39
321000 -- (-1833.190) (-1840.660) (-1834.396) [-1836.036] * [-1838.721] (-1839.191) (-1833.591) (-1833.235) -- 0:02:38
321500 -- [-1833.737] (-1839.932) (-1841.257) (-1834.576) * (-1838.094) [-1837.201] (-1834.039) (-1834.765) -- 0:02:38
322000 -- [-1839.191] (-1839.691) (-1837.125) (-1838.190) * (-1843.364) (-1837.313) [-1831.674] (-1841.044) -- 0:02:37
322500 -- [-1831.730] (-1832.085) (-1836.507) (-1837.065) * [-1839.896] (-1835.964) (-1834.318) (-1838.749) -- 0:02:37
323000 -- (-1842.761) (-1837.148) [-1836.860] (-1838.552) * [-1834.193] (-1834.373) (-1835.694) (-1841.257) -- 0:02:37
323500 -- (-1845.248) [-1835.420] (-1837.611) (-1835.334) * (-1830.825) (-1831.267) (-1831.402) [-1840.383] -- 0:02:36
324000 -- (-1844.893) (-1842.842) [-1836.229] (-1834.261) * (-1837.993) [-1835.426] (-1833.398) (-1833.688) -- 0:02:38
324500 -- (-1838.814) (-1836.357) [-1835.229] (-1839.859) * (-1838.501) (-1838.174) (-1839.322) [-1846.286] -- 0:02:38
325000 -- (-1830.546) [-1836.085] (-1833.091) (-1830.256) * (-1840.195) [-1839.252] (-1834.535) (-1834.176) -- 0:02:37
Average standard deviation of split frequencies: 0.000000
325500 -- (-1833.859) (-1841.909) (-1831.120) [-1835.630] * [-1835.795] (-1837.852) (-1835.777) (-1839.260) -- 0:02:37
326000 -- (-1832.171) [-1840.331] (-1843.961) (-1835.217) * (-1834.004) (-1840.246) (-1834.091) [-1834.708] -- 0:02:37
326500 -- (-1832.783) (-1833.301) [-1838.048] (-1837.668) * (-1835.778) (-1836.643) (-1838.327) [-1832.153] -- 0:02:36
327000 -- (-1838.857) [-1831.729] (-1834.332) (-1838.433) * (-1834.371) (-1835.203) (-1836.187) [-1835.592] -- 0:02:36
327500 -- [-1833.273] (-1839.178) (-1834.357) (-1835.149) * (-1832.296) (-1835.598) [-1832.195] (-1832.785) -- 0:02:36
328000 -- [-1834.778] (-1832.805) (-1840.742) (-1836.019) * [-1831.316] (-1842.823) (-1836.505) (-1837.452) -- 0:02:35
328500 -- (-1840.529) (-1842.561) (-1835.722) [-1831.558] * [-1833.704] (-1837.780) (-1841.231) (-1838.140) -- 0:02:37
329000 -- (-1839.643) (-1836.149) (-1838.848) [-1835.408] * (-1837.317) (-1837.544) (-1835.990) [-1835.239] -- 0:02:37
329500 -- (-1841.120) (-1836.029) (-1836.761) [-1832.630] * (-1834.280) [-1834.926] (-1832.511) (-1839.644) -- 0:02:36
330000 -- (-1848.359) (-1838.939) (-1836.039) [-1836.207] * [-1843.840] (-1830.628) (-1837.124) (-1841.045) -- 0:02:36
Average standard deviation of split frequencies: 0.000000
330500 -- (-1839.186) (-1838.119) [-1834.675] (-1835.636) * [-1839.988] (-1835.699) (-1832.005) (-1832.946) -- 0:02:35
331000 -- (-1835.883) (-1841.657) (-1833.484) [-1835.288] * (-1845.128) [-1838.103] (-1837.342) (-1834.114) -- 0:02:35
331500 -- (-1835.419) (-1844.924) [-1831.226] (-1831.351) * (-1833.729) (-1840.458) (-1844.271) [-1837.443] -- 0:02:35
332000 -- (-1840.709) (-1840.809) [-1836.754] (-1833.586) * (-1838.443) [-1839.673] (-1837.122) (-1839.857) -- 0:02:34
332500 -- (-1832.745) (-1838.009) (-1840.928) [-1834.795] * (-1846.605) (-1843.751) [-1835.535] (-1839.343) -- 0:02:36
333000 -- (-1838.919) (-1836.359) (-1834.872) [-1832.619] * [-1833.809] (-1838.080) (-1835.845) (-1842.870) -- 0:02:36
333500 -- (-1837.329) [-1834.059] (-1840.393) (-1833.568) * (-1831.566) [-1838.863] (-1841.974) (-1836.826) -- 0:02:35
334000 -- (-1842.023) (-1835.454) [-1835.007] (-1831.782) * (-1831.972) [-1840.232] (-1839.826) (-1834.916) -- 0:02:35
334500 -- (-1836.776) (-1833.557) (-1830.783) [-1833.724] * [-1836.806] (-1836.101) (-1836.329) (-1838.257) -- 0:02:35
335000 -- (-1833.300) [-1834.353] (-1834.933) (-1832.666) * [-1836.301] (-1839.681) (-1836.220) (-1840.861) -- 0:02:34
Average standard deviation of split frequencies: 0.000000
335500 -- [-1833.782] (-1837.863) (-1831.119) (-1845.910) * (-1834.169) [-1834.725] (-1832.645) (-1838.139) -- 0:02:34
336000 -- (-1835.262) [-1838.698] (-1834.427) (-1838.508) * (-1836.491) [-1834.259] (-1840.242) (-1841.928) -- 0:02:34
336500 -- (-1835.334) (-1833.591) [-1836.964] (-1840.711) * [-1839.754] (-1830.077) (-1836.380) (-1835.879) -- 0:02:33
337000 -- [-1831.296] (-1840.284) (-1837.537) (-1835.705) * (-1838.179) (-1832.363) [-1840.567] (-1836.237) -- 0:02:35
337500 -- (-1833.210) (-1839.191) (-1833.099) [-1837.645] * (-1838.636) (-1842.506) (-1831.905) [-1842.050] -- 0:02:35
338000 -- (-1830.071) (-1836.105) [-1835.013] (-1843.376) * (-1841.222) (-1832.330) (-1831.452) [-1833.881] -- 0:02:34
338500 -- (-1836.665) (-1836.421) [-1834.870] (-1841.063) * (-1830.400) (-1838.268) [-1834.442] (-1835.592) -- 0:02:34
339000 -- [-1833.605] (-1834.213) (-1841.519) (-1838.443) * [-1832.878] (-1838.613) (-1833.679) (-1839.382) -- 0:02:34
339500 -- (-1832.587) (-1836.492) [-1840.324] (-1839.350) * (-1834.959) (-1832.436) [-1839.592] (-1839.220) -- 0:02:33
340000 -- (-1835.695) (-1831.558) [-1839.966] (-1834.014) * (-1835.134) (-1833.675) (-1839.024) [-1835.801] -- 0:02:33
Average standard deviation of split frequencies: 0.000000
340500 -- [-1832.640] (-1839.783) (-1847.956) (-1834.536) * [-1836.027] (-1833.244) (-1843.960) (-1837.269) -- 0:02:33
341000 -- (-1835.134) [-1836.175] (-1835.641) (-1831.598) * [-1834.784] (-1844.320) (-1836.721) (-1835.003) -- 0:02:34
341500 -- (-1832.516) (-1834.330) (-1840.598) [-1837.500] * (-1831.805) (-1842.011) (-1835.226) [-1832.458] -- 0:02:34
342000 -- (-1836.558) (-1840.584) (-1842.661) [-1838.714] * (-1837.047) (-1841.193) [-1829.344] (-1831.870) -- 0:02:33
342500 -- [-1834.503] (-1831.806) (-1839.670) (-1834.972) * (-1844.745) (-1839.191) [-1837.131] (-1838.667) -- 0:02:33
343000 -- (-1833.161) [-1830.479] (-1830.668) (-1837.226) * (-1845.482) (-1835.728) [-1831.550] (-1840.148) -- 0:02:33
343500 -- [-1834.606] (-1833.400) (-1836.906) (-1845.291) * (-1839.365) [-1836.248] (-1834.595) (-1841.079) -- 0:02:32
344000 -- [-1835.943] (-1834.818) (-1833.269) (-1839.122) * [-1835.538] (-1838.481) (-1837.881) (-1837.037) -- 0:02:32
344500 -- (-1834.784) (-1840.584) (-1836.047) [-1840.969] * (-1833.439) [-1834.911] (-1830.663) (-1833.352) -- 0:02:32
345000 -- (-1837.144) [-1835.061] (-1836.879) (-1833.608) * [-1833.917] (-1834.768) (-1831.367) (-1835.240) -- 0:02:31
Average standard deviation of split frequencies: 0.000000
345500 -- (-1834.537) (-1832.726) (-1834.508) [-1838.029] * (-1835.838) (-1850.685) (-1839.887) [-1837.409] -- 0:02:33
346000 -- (-1834.265) [-1834.036] (-1833.935) (-1837.841) * (-1833.640) (-1839.144) (-1836.141) [-1838.654] -- 0:02:33
346500 -- (-1839.461) (-1844.839) (-1836.050) [-1833.767] * (-1834.723) (-1836.233) (-1836.312) [-1839.566] -- 0:02:32
347000 -- (-1838.757) [-1836.951] (-1836.911) (-1833.044) * [-1836.792] (-1830.337) (-1835.453) (-1832.384) -- 0:02:32
347500 -- [-1835.945] (-1837.751) (-1832.334) (-1834.150) * (-1830.810) (-1833.977) (-1835.604) [-1832.410] -- 0:02:32
348000 -- (-1838.486) (-1833.874) [-1831.284] (-1839.605) * [-1838.873] (-1834.867) (-1834.928) (-1837.998) -- 0:02:31
348500 -- [-1838.163] (-1832.360) (-1836.274) (-1831.782) * (-1839.762) (-1832.459) [-1833.706] (-1840.341) -- 0:02:31
349000 -- (-1836.527) (-1835.609) [-1834.041] (-1840.803) * (-1845.511) [-1833.997] (-1840.612) (-1840.657) -- 0:02:31
349500 -- (-1837.158) (-1836.077) [-1833.828] (-1833.419) * [-1835.653] (-1832.938) (-1834.843) (-1837.787) -- 0:02:30
350000 -- (-1836.250) [-1836.080] (-1833.457) (-1841.550) * [-1840.944] (-1831.575) (-1840.073) (-1837.754) -- 0:02:32
Average standard deviation of split frequencies: 0.000000
350500 -- (-1838.313) (-1844.342) [-1830.575] (-1835.821) * (-1840.980) [-1836.733] (-1836.641) (-1841.861) -- 0:02:31
351000 -- (-1832.276) (-1835.678) (-1834.313) [-1831.975] * [-1832.557] (-1838.254) (-1837.567) (-1836.556) -- 0:02:31
351500 -- (-1835.212) [-1836.837] (-1841.888) (-1835.159) * (-1838.248) [-1830.405] (-1837.836) (-1832.205) -- 0:02:31
352000 -- (-1832.010) (-1836.682) (-1839.647) [-1834.409] * [-1836.097] (-1835.688) (-1843.189) (-1837.242) -- 0:02:30
352500 -- (-1839.513) (-1841.719) (-1839.695) [-1830.148] * (-1836.728) [-1830.466] (-1840.320) (-1836.159) -- 0:02:30
353000 -- (-1838.365) (-1845.594) (-1832.659) [-1831.844] * (-1834.378) (-1840.149) (-1842.704) [-1834.675] -- 0:02:30
353500 -- (-1833.634) (-1835.753) [-1835.201] (-1833.152) * [-1831.767] (-1835.160) (-1839.019) (-1840.127) -- 0:02:29
354000 -- (-1838.936) [-1834.802] (-1835.889) (-1839.316) * (-1835.622) [-1833.839] (-1832.783) (-1834.973) -- 0:02:31
354500 -- [-1833.714] (-1830.841) (-1836.074) (-1833.546) * (-1836.513) (-1830.651) (-1838.392) [-1838.687] -- 0:02:31
355000 -- [-1835.918] (-1840.109) (-1839.870) (-1839.366) * (-1834.342) (-1839.487) (-1842.146) [-1829.369] -- 0:02:30
Average standard deviation of split frequencies: 0.000000
355500 -- (-1836.649) (-1836.304) (-1832.567) [-1834.872] * (-1832.935) (-1835.119) [-1837.364] (-1844.306) -- 0:02:30
356000 -- [-1836.319] (-1838.608) (-1834.487) (-1837.835) * (-1836.480) (-1838.310) (-1836.716) [-1843.127] -- 0:02:30
356500 -- (-1839.157) (-1840.985) [-1835.679] (-1838.396) * (-1833.843) (-1834.834) [-1832.075] (-1842.274) -- 0:02:29
357000 -- (-1833.820) (-1838.867) [-1838.415] (-1838.408) * (-1834.452) [-1835.367] (-1831.241) (-1834.969) -- 0:02:29
357500 -- (-1831.639) (-1842.589) (-1843.519) [-1833.718] * (-1835.063) [-1836.769] (-1831.544) (-1835.535) -- 0:02:29
358000 -- (-1838.164) (-1847.868) (-1836.773) [-1831.970] * (-1834.100) (-1836.418) [-1837.984] (-1845.572) -- 0:02:28
358500 -- (-1837.511) (-1841.432) (-1834.008) [-1836.637] * (-1832.539) (-1838.206) [-1837.072] (-1844.775) -- 0:02:30
359000 -- (-1832.680) [-1831.700] (-1833.405) (-1835.560) * (-1839.468) (-1833.640) [-1835.122] (-1836.900) -- 0:02:29
359500 -- (-1835.957) (-1837.399) (-1838.798) [-1837.411] * [-1838.538] (-1839.984) (-1836.246) (-1838.887) -- 0:02:29
360000 -- (-1831.178) (-1830.606) [-1840.430] (-1834.875) * [-1832.784] (-1843.252) (-1837.495) (-1843.924) -- 0:02:29
Average standard deviation of split frequencies: 0.000000
360500 -- (-1834.337) (-1837.060) (-1839.119) [-1837.276] * (-1835.155) (-1847.345) (-1842.231) [-1834.746] -- 0:02:29
361000 -- (-1829.596) [-1836.973] (-1834.690) (-1838.886) * (-1841.074) (-1847.258) (-1839.457) [-1831.671] -- 0:02:28
361500 -- [-1837.059] (-1832.832) (-1840.319) (-1832.799) * (-1840.257) (-1834.316) [-1834.778] (-1835.781) -- 0:02:28
362000 -- (-1841.454) [-1838.104] (-1834.433) (-1835.395) * (-1835.655) (-1838.029) (-1832.553) [-1843.781] -- 0:02:28
362500 -- (-1844.494) (-1838.479) (-1843.932) [-1835.300] * [-1836.367] (-1835.266) (-1838.023) (-1839.223) -- 0:02:29
363000 -- (-1836.546) (-1844.634) (-1837.714) [-1832.724] * [-1833.021] (-1836.701) (-1836.381) (-1837.164) -- 0:02:29
363500 -- (-1838.470) (-1838.628) (-1841.095) [-1840.266] * (-1842.464) (-1836.198) [-1831.177] (-1836.741) -- 0:02:28
364000 -- (-1832.460) [-1836.460] (-1847.399) (-1834.353) * [-1830.648] (-1836.919) (-1838.831) (-1834.171) -- 0:02:28
364500 -- (-1836.546) (-1834.116) [-1839.950] (-1836.932) * (-1837.130) [-1837.228] (-1839.216) (-1834.602) -- 0:02:28
365000 -- [-1833.630] (-1831.818) (-1838.299) (-1843.594) * [-1838.475] (-1835.516) (-1833.383) (-1838.760) -- 0:02:27
Average standard deviation of split frequencies: 0.000000
365500 -- (-1833.666) (-1841.377) [-1837.779] (-1834.211) * [-1833.782] (-1839.273) (-1835.176) (-1835.129) -- 0:02:27
366000 -- [-1837.737] (-1833.674) (-1833.082) (-1835.573) * [-1836.213] (-1837.337) (-1838.685) (-1830.731) -- 0:02:27
366500 -- (-1839.107) (-1837.732) [-1835.861] (-1834.208) * [-1833.433] (-1843.935) (-1844.128) (-1838.697) -- 0:02:26
367000 -- (-1845.526) (-1837.376) (-1837.665) [-1833.606] * (-1833.721) (-1837.896) [-1834.783] (-1835.410) -- 0:02:28
367500 -- (-1833.922) [-1836.100] (-1833.996) (-1836.740) * (-1834.930) (-1838.126) [-1840.547] (-1839.443) -- 0:02:28
368000 -- [-1837.447] (-1835.683) (-1832.818) (-1839.054) * [-1833.170] (-1837.951) (-1834.779) (-1837.565) -- 0:02:27
368500 -- (-1837.011) [-1838.531] (-1833.985) (-1836.234) * [-1836.358] (-1837.867) (-1839.834) (-1834.834) -- 0:02:27
369000 -- (-1833.186) [-1833.938] (-1838.080) (-1833.961) * (-1840.175) (-1840.165) (-1839.346) [-1835.372] -- 0:02:27
369500 -- [-1833.781] (-1835.520) (-1838.191) (-1842.198) * (-1838.513) (-1838.977) [-1831.395] (-1848.252) -- 0:02:26
370000 -- (-1842.538) (-1834.323) [-1832.801] (-1841.628) * (-1841.459) (-1836.404) [-1829.675] (-1840.035) -- 0:02:26
Average standard deviation of split frequencies: 0.000000
370500 -- [-1833.805] (-1836.234) (-1830.785) (-1842.882) * (-1836.506) (-1832.979) (-1832.961) [-1839.142] -- 0:02:26
371000 -- (-1838.629) [-1836.451] (-1832.237) (-1841.593) * [-1835.594] (-1835.376) (-1835.349) (-1840.164) -- 0:02:25
371500 -- (-1837.848) [-1831.382] (-1834.213) (-1840.399) * (-1835.538) (-1834.556) [-1831.391] (-1837.382) -- 0:02:27
372000 -- (-1831.294) (-1836.925) (-1833.150) [-1840.126] * (-1830.073) (-1846.392) (-1834.255) [-1831.909] -- 0:02:26
372500 -- (-1835.552) [-1833.661] (-1838.311) (-1843.077) * (-1832.343) (-1838.730) [-1833.128] (-1836.307) -- 0:02:26
373000 -- (-1835.946) [-1832.290] (-1842.120) (-1833.619) * [-1837.920] (-1835.645) (-1834.519) (-1829.608) -- 0:02:26
373500 -- (-1839.603) [-1833.035] (-1838.654) (-1835.499) * [-1831.724] (-1831.132) (-1830.928) (-1834.581) -- 0:02:25
374000 -- (-1832.020) (-1837.521) (-1837.571) [-1835.080] * (-1834.718) (-1830.862) (-1837.327) [-1834.008] -- 0:02:25
374500 -- (-1835.391) [-1832.030] (-1844.447) (-1833.817) * (-1842.095) (-1838.104) (-1840.525) [-1832.686] -- 0:02:25
375000 -- [-1834.702] (-1834.661) (-1843.885) (-1832.860) * [-1834.899] (-1840.023) (-1836.397) (-1836.923) -- 0:02:25
Average standard deviation of split frequencies: 0.000000
375500 -- (-1832.804) (-1837.113) [-1832.785] (-1839.522) * (-1840.101) (-1839.260) (-1832.474) [-1834.332] -- 0:02:26
376000 -- (-1833.382) (-1842.668) [-1834.652] (-1838.380) * (-1834.962) (-1838.715) (-1835.882) [-1838.830] -- 0:02:26
376500 -- [-1836.569] (-1836.974) (-1839.785) (-1836.791) * (-1832.735) (-1832.320) (-1833.252) [-1833.432] -- 0:02:25
377000 -- (-1837.061) [-1834.370] (-1833.182) (-1838.606) * (-1834.902) (-1836.699) (-1835.835) [-1834.073] -- 0:02:25
377500 -- (-1834.442) (-1832.689) (-1841.180) [-1835.088] * (-1835.370) (-1844.172) [-1836.442] (-1834.368) -- 0:02:25
378000 -- (-1837.916) [-1837.490] (-1836.656) (-1829.251) * (-1832.664) (-1832.273) [-1835.842] (-1837.981) -- 0:02:24
378500 -- [-1835.928] (-1833.048) (-1844.935) (-1836.052) * (-1831.416) [-1830.969] (-1831.678) (-1837.694) -- 0:02:24
379000 -- (-1842.487) (-1831.936) (-1836.343) [-1829.835] * (-1834.409) (-1834.961) (-1833.770) [-1835.474] -- 0:02:24
379500 -- (-1837.571) [-1835.184] (-1839.122) (-1836.882) * (-1832.329) (-1847.574) (-1839.885) [-1833.163] -- 0:02:23
380000 -- (-1834.700) (-1837.511) (-1836.343) [-1833.257] * (-1835.598) [-1831.821] (-1833.080) (-1832.177) -- 0:02:25
Average standard deviation of split frequencies: 0.000000
380500 -- (-1840.955) (-1830.187) [-1835.140] (-1834.002) * (-1835.279) (-1831.445) (-1842.114) [-1838.663] -- 0:02:24
381000 -- (-1842.859) (-1836.962) (-1834.037) [-1830.537] * [-1837.168] (-1834.773) (-1837.605) (-1837.603) -- 0:02:24
381500 -- [-1838.961] (-1834.068) (-1837.379) (-1833.549) * (-1834.987) (-1830.824) (-1841.938) [-1833.354] -- 0:02:24
382000 -- (-1835.609) [-1834.540] (-1832.745) (-1836.287) * (-1837.592) [-1835.093] (-1835.253) (-1835.176) -- 0:02:23
382500 -- (-1843.401) (-1837.227) [-1834.459] (-1834.375) * (-1839.613) [-1840.816] (-1841.153) (-1833.966) -- 0:02:23
383000 -- (-1842.604) (-1828.767) [-1832.607] (-1832.035) * (-1840.989) (-1836.700) (-1838.799) [-1838.866] -- 0:02:23
383500 -- [-1838.952] (-1837.396) (-1845.487) (-1838.962) * (-1836.648) [-1838.661] (-1833.733) (-1837.659) -- 0:02:23
384000 -- [-1836.549] (-1837.339) (-1838.079) (-1836.378) * (-1835.041) (-1835.012) [-1831.809] (-1843.562) -- 0:02:24
384500 -- (-1834.829) (-1840.166) [-1839.003] (-1838.015) * (-1846.699) (-1835.823) [-1836.687] (-1833.761) -- 0:02:24
385000 -- (-1833.807) (-1837.090) (-1842.991) [-1829.941] * (-1835.818) (-1835.406) [-1833.312] (-1840.839) -- 0:02:23
Average standard deviation of split frequencies: 0.000000
385500 -- [-1836.446] (-1838.907) (-1836.468) (-1843.544) * [-1834.222] (-1834.646) (-1832.676) (-1842.768) -- 0:02:23
386000 -- (-1830.434) (-1837.979) (-1831.841) [-1833.193] * (-1833.217) (-1839.007) (-1835.458) [-1836.661] -- 0:02:23
386500 -- (-1833.601) (-1842.954) (-1835.719) [-1839.899] * (-1844.963) [-1830.430] (-1842.926) (-1833.697) -- 0:02:22
387000 -- (-1836.353) [-1834.615] (-1835.837) (-1840.385) * (-1839.700) [-1835.318] (-1838.864) (-1839.057) -- 0:02:22
387500 -- (-1834.174) (-1843.611) (-1834.917) [-1836.829] * [-1839.227] (-1834.312) (-1840.726) (-1836.894) -- 0:02:22
388000 -- (-1836.039) (-1842.295) [-1832.928] (-1836.806) * (-1839.262) (-1838.646) (-1836.981) [-1836.137] -- 0:02:21
388500 -- [-1833.868] (-1837.384) (-1838.825) (-1843.946) * (-1837.439) (-1831.755) [-1831.152] (-1833.585) -- 0:02:23
389000 -- (-1835.902) [-1831.544] (-1841.057) (-1840.526) * (-1835.695) (-1839.360) (-1841.100) [-1835.849] -- 0:02:22
389500 -- (-1840.431) (-1835.263) [-1836.973] (-1839.127) * [-1833.875] (-1837.029) (-1844.954) (-1832.580) -- 0:02:22
390000 -- [-1842.173] (-1835.416) (-1833.658) (-1839.286) * (-1838.490) (-1835.047) (-1838.170) [-1837.218] -- 0:02:22
Average standard deviation of split frequencies: 0.000000
390500 -- (-1834.820) (-1836.112) [-1837.254] (-1843.529) * (-1840.518) (-1834.713) (-1834.643) [-1837.376] -- 0:02:22
391000 -- [-1835.122] (-1840.433) (-1836.492) (-1836.030) * (-1832.692) (-1838.940) (-1839.101) [-1837.650] -- 0:02:21
391500 -- (-1836.896) (-1841.898) (-1837.104) [-1837.954] * [-1834.693] (-1840.169) (-1838.650) (-1845.113) -- 0:02:21
392000 -- [-1836.911] (-1838.940) (-1841.161) (-1833.185) * (-1841.386) [-1839.127] (-1836.648) (-1846.206) -- 0:02:21
392500 -- (-1839.511) (-1836.408) [-1834.708] (-1836.077) * (-1832.966) [-1843.234] (-1839.021) (-1837.041) -- 0:02:20
393000 -- (-1837.209) [-1836.524] (-1844.444) (-1838.127) * [-1832.241] (-1837.044) (-1846.110) (-1845.502) -- 0:02:22
393500 -- (-1839.937) [-1837.120] (-1837.103) (-1837.950) * [-1838.610] (-1832.896) (-1835.123) (-1833.227) -- 0:02:21
394000 -- (-1837.364) [-1834.080] (-1834.473) (-1836.220) * (-1834.057) (-1835.460) (-1833.838) [-1839.517] -- 0:02:21
394500 -- (-1835.718) [-1841.615] (-1836.729) (-1833.226) * (-1834.906) (-1830.812) (-1837.568) [-1837.076] -- 0:02:21
395000 -- (-1842.451) (-1840.541) (-1837.745) [-1835.535] * (-1830.603) [-1833.634] (-1835.260) (-1839.918) -- 0:02:20
Average standard deviation of split frequencies: 0.000000
395500 -- (-1840.217) [-1834.607] (-1840.853) (-1836.189) * (-1836.916) [-1834.025] (-1836.605) (-1829.080) -- 0:02:20
396000 -- (-1835.266) (-1831.495) (-1839.737) [-1835.276] * (-1837.345) (-1844.936) [-1838.418] (-1831.078) -- 0:02:20
396500 -- (-1838.631) (-1836.446) (-1839.749) [-1837.369] * (-1836.579) (-1836.414) [-1832.271] (-1833.952) -- 0:02:20
397000 -- (-1836.843) (-1841.465) (-1836.984) [-1835.640] * (-1834.172) (-1841.537) [-1832.073] (-1837.132) -- 0:02:21
397500 -- (-1834.949) (-1832.293) (-1834.237) [-1835.420] * (-1839.662) (-1839.232) [-1837.692] (-1835.319) -- 0:02:20
398000 -- [-1836.611] (-1831.349) (-1835.190) (-1838.719) * [-1839.640] (-1834.315) (-1841.701) (-1837.265) -- 0:02:20
398500 -- (-1844.834) (-1839.468) [-1837.689] (-1832.857) * (-1834.735) [-1834.071] (-1838.566) (-1835.075) -- 0:02:20
399000 -- (-1840.420) [-1835.726] (-1835.032) (-1837.678) * [-1829.240] (-1843.525) (-1841.376) (-1835.145) -- 0:02:20
399500 -- (-1834.526) (-1836.440) [-1841.827] (-1837.821) * [-1835.114] (-1831.181) (-1832.248) (-1832.886) -- 0:02:19
400000 -- [-1839.542] (-1841.107) (-1835.616) (-1835.346) * (-1844.219) (-1832.591) (-1833.898) [-1837.685] -- 0:02:19
Average standard deviation of split frequencies: 0.000000
400500 -- (-1845.086) (-1833.518) [-1837.341] (-1836.941) * (-1833.604) [-1830.866] (-1834.364) (-1838.114) -- 0:02:19
401000 -- (-1837.437) (-1834.645) (-1842.405) [-1834.417] * (-1833.016) (-1838.799) (-1834.340) [-1833.778] -- 0:02:18
401500 -- (-1836.256) [-1832.955] (-1840.103) (-1842.854) * (-1834.939) [-1833.137] (-1834.141) (-1837.919) -- 0:02:20
402000 -- (-1834.487) (-1837.340) [-1836.032] (-1838.324) * [-1834.275] (-1832.189) (-1833.664) (-1831.492) -- 0:02:19
402500 -- (-1837.090) [-1835.239] (-1839.274) (-1838.453) * (-1833.703) (-1841.640) (-1833.619) [-1834.284] -- 0:02:19
403000 -- (-1837.918) [-1831.751] (-1838.582) (-1833.208) * (-1840.894) (-1835.279) [-1832.833] (-1840.278) -- 0:02:19
403500 -- [-1832.134] (-1828.955) (-1833.481) (-1841.592) * (-1835.378) [-1837.529] (-1845.429) (-1841.161) -- 0:02:18
404000 -- (-1841.411) [-1838.167] (-1832.945) (-1837.861) * (-1832.071) (-1837.887) [-1830.712] (-1835.648) -- 0:02:18
404500 -- (-1839.008) (-1835.798) (-1834.370) [-1835.151] * (-1833.299) (-1834.712) (-1830.469) [-1836.314] -- 0:02:18
405000 -- (-1839.483) (-1834.878) (-1841.726) [-1830.533] * (-1837.087) (-1834.548) [-1837.899] (-1837.261) -- 0:02:18
Average standard deviation of split frequencies: 0.000000
405500 -- (-1837.808) (-1838.408) (-1837.004) [-1841.798] * (-1840.284) (-1838.324) (-1833.462) [-1838.412] -- 0:02:19
406000 -- (-1838.000) [-1837.886] (-1834.779) (-1838.205) * (-1834.372) (-1836.437) [-1837.260] (-1832.072) -- 0:02:18
406500 -- [-1835.162] (-1838.857) (-1836.463) (-1841.228) * [-1836.032] (-1839.939) (-1839.627) (-1839.984) -- 0:02:18
407000 -- (-1839.850) [-1835.896] (-1831.975) (-1834.067) * (-1836.001) (-1834.437) (-1837.579) [-1840.475] -- 0:02:18
407500 -- (-1835.911) (-1833.771) (-1833.473) [-1834.770] * [-1831.211] (-1830.620) (-1837.974) (-1840.165) -- 0:02:18
408000 -- [-1834.571] (-1831.218) (-1835.610) (-1843.433) * (-1834.613) [-1831.687] (-1838.046) (-1844.718) -- 0:02:17
408500 -- [-1845.078] (-1833.302) (-1831.804) (-1842.214) * (-1834.172) [-1832.903] (-1834.141) (-1834.574) -- 0:02:17
409000 -- (-1837.094) [-1833.061] (-1834.448) (-1835.180) * (-1837.045) (-1834.922) [-1830.230] (-1844.323) -- 0:02:17
409500 -- (-1831.995) (-1842.091) [-1832.637] (-1835.680) * (-1837.023) [-1834.565] (-1836.925) (-1841.535) -- 0:02:16
410000 -- (-1836.331) (-1832.370) [-1833.549] (-1839.209) * (-1842.918) (-1840.076) [-1839.932] (-1836.506) -- 0:02:18
Average standard deviation of split frequencies: 0.000000
410500 -- (-1833.362) [-1832.897] (-1841.547) (-1835.057) * (-1840.048) [-1839.604] (-1840.490) (-1834.717) -- 0:02:17
411000 -- (-1837.921) (-1839.557) [-1833.572] (-1836.647) * [-1838.874] (-1836.910) (-1833.762) (-1837.721) -- 0:02:17
411500 -- [-1836.935] (-1838.173) (-1835.783) (-1832.136) * (-1830.839) [-1836.706] (-1832.841) (-1834.735) -- 0:02:17
412000 -- (-1836.541) [-1836.709] (-1833.619) (-1841.171) * (-1841.770) [-1837.146] (-1837.453) (-1832.539) -- 0:02:17
412500 -- (-1838.604) (-1838.281) [-1832.279] (-1838.066) * (-1831.005) (-1833.868) [-1835.408] (-1836.701) -- 0:02:16
413000 -- [-1835.455] (-1840.202) (-1839.299) (-1846.731) * (-1835.346) [-1835.422] (-1834.537) (-1835.132) -- 0:02:16
413500 -- (-1837.733) [-1837.219] (-1830.138) (-1837.235) * [-1833.626] (-1836.379) (-1834.057) (-1840.779) -- 0:02:16
414000 -- (-1830.855) (-1836.860) [-1832.659] (-1836.505) * (-1836.828) (-1839.130) [-1838.408] (-1842.112) -- 0:02:15
414500 -- (-1834.794) (-1841.381) (-1835.416) [-1833.374] * (-1832.146) (-1843.347) [-1836.226] (-1842.952) -- 0:02:17
415000 -- [-1836.014] (-1845.175) (-1837.355) (-1833.803) * (-1836.426) (-1840.856) [-1832.970] (-1833.054) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
415500 -- [-1833.811] (-1838.859) (-1836.832) (-1834.553) * [-1836.609] (-1836.239) (-1843.644) (-1834.551) -- 0:02:16
416000 -- (-1835.214) (-1844.833) (-1836.266) [-1838.421] * [-1836.018] (-1837.371) (-1836.998) (-1835.569) -- 0:02:16
416500 -- (-1837.559) (-1833.646) [-1834.478] (-1835.713) * [-1836.162] (-1834.800) (-1835.667) (-1840.499) -- 0:02:15
417000 -- (-1835.078) (-1845.561) (-1839.698) [-1840.286] * (-1834.600) [-1834.519] (-1833.967) (-1838.343) -- 0:02:15
417500 -- (-1840.371) [-1834.857] (-1836.620) (-1843.681) * (-1836.985) [-1834.386] (-1834.869) (-1840.641) -- 0:02:15
418000 -- [-1834.999] (-1836.605) (-1836.468) (-1845.314) * (-1832.370) [-1834.985] (-1833.840) (-1838.892) -- 0:02:15
418500 -- (-1841.502) [-1841.418] (-1835.506) (-1844.510) * [-1830.231] (-1841.206) (-1844.577) (-1841.561) -- 0:02:16
419000 -- (-1839.665) [-1837.118] (-1841.195) (-1845.091) * (-1836.986) (-1832.556) [-1832.985] (-1838.646) -- 0:02:15
419500 -- (-1838.206) [-1834.506] (-1838.878) (-1841.463) * [-1832.176] (-1833.820) (-1839.558) (-1839.713) -- 0:02:15
420000 -- (-1838.748) (-1841.700) (-1837.873) [-1836.946] * (-1836.899) (-1835.556) (-1839.086) [-1836.960] -- 0:02:15
Average standard deviation of split frequencies: 0.000000
420500 -- (-1839.496) [-1838.993] (-1836.833) (-1838.798) * (-1846.840) (-1832.956) [-1833.646] (-1839.392) -- 0:02:15
421000 -- (-1844.662) (-1837.503) [-1836.013] (-1838.420) * [-1841.170] (-1836.338) (-1832.785) (-1842.883) -- 0:02:14
421500 -- (-1839.665) [-1833.901] (-1833.312) (-1842.906) * (-1844.253) (-1837.509) [-1834.303] (-1846.910) -- 0:02:14
422000 -- (-1839.679) (-1831.464) (-1837.393) [-1834.524] * (-1843.521) (-1831.746) (-1835.218) [-1838.536] -- 0:02:14
422500 -- (-1831.490) (-1845.578) [-1835.475] (-1837.234) * (-1841.750) (-1834.469) (-1833.269) [-1834.113] -- 0:02:13
423000 -- (-1838.423) (-1841.459) [-1833.731] (-1834.464) * [-1835.909] (-1837.138) (-1833.706) (-1841.218) -- 0:02:15
423500 -- (-1837.788) [-1837.395] (-1838.230) (-1837.984) * (-1835.722) [-1835.309] (-1833.527) (-1837.330) -- 0:02:14
424000 -- (-1835.386) (-1840.088) (-1833.675) [-1834.709] * [-1836.739] (-1842.518) (-1835.534) (-1838.629) -- 0:02:14
424500 -- (-1833.274) (-1837.005) (-1830.382) [-1841.648] * (-1834.693) (-1841.427) [-1832.467] (-1836.656) -- 0:02:14
425000 -- (-1835.639) [-1834.256] (-1834.662) (-1842.164) * [-1835.047] (-1839.716) (-1834.576) (-1836.689) -- 0:02:13
Average standard deviation of split frequencies: 0.000000
425500 -- (-1845.181) (-1837.126) [-1834.445] (-1837.031) * (-1836.382) (-1831.342) (-1838.471) [-1835.875] -- 0:02:13
426000 -- [-1837.287] (-1836.137) (-1838.181) (-1841.100) * (-1832.796) [-1836.951] (-1834.448) (-1831.135) -- 0:02:13
426500 -- (-1839.134) [-1833.192] (-1834.309) (-1843.756) * [-1840.689] (-1832.669) (-1838.654) (-1835.343) -- 0:02:13
427000 -- (-1840.480) [-1830.863] (-1833.051) (-1833.758) * (-1849.906) [-1833.369] (-1841.103) (-1837.046) -- 0:02:12
427500 -- (-1837.642) [-1834.388] (-1834.316) (-1835.306) * (-1837.430) (-1838.561) [-1839.537] (-1836.319) -- 0:02:13
428000 -- (-1843.919) (-1833.149) (-1836.852) [-1836.730] * (-1839.651) (-1837.478) (-1835.504) [-1841.079] -- 0:02:13
428500 -- (-1843.753) (-1834.044) (-1829.728) [-1836.593] * [-1833.619] (-1834.181) (-1837.891) (-1840.196) -- 0:02:13
429000 -- (-1838.386) [-1841.644] (-1853.123) (-1834.329) * [-1835.800] (-1835.939) (-1840.668) (-1837.543) -- 0:02:13
429500 -- [-1837.275] (-1839.223) (-1835.798) (-1832.608) * (-1837.112) [-1836.954] (-1844.717) (-1835.344) -- 0:02:12
430000 -- [-1835.045] (-1837.385) (-1838.805) (-1832.810) * (-1837.847) (-1838.281) [-1841.199] (-1835.557) -- 0:02:12
Average standard deviation of split frequencies: 0.000000
430500 -- (-1833.777) [-1833.011] (-1839.522) (-1834.192) * (-1833.486) (-1829.853) [-1842.078] (-1834.894) -- 0:02:12
431000 -- (-1835.571) [-1837.419] (-1835.723) (-1833.430) * [-1831.457] (-1836.725) (-1845.160) (-1836.506) -- 0:02:12
431500 -- (-1834.371) (-1837.271) [-1837.266] (-1838.981) * (-1829.760) [-1836.533] (-1835.571) (-1838.031) -- 0:02:13
432000 -- [-1834.193] (-1831.183) (-1836.528) (-1837.439) * (-1842.468) [-1836.293] (-1837.407) (-1830.553) -- 0:02:12
432500 -- (-1837.872) (-1835.971) (-1841.698) [-1837.858] * (-1839.809) (-1838.092) (-1838.659) [-1831.877] -- 0:02:12
433000 -- (-1844.268) [-1842.233] (-1837.731) (-1836.709) * (-1836.460) (-1837.940) (-1840.337) [-1832.520] -- 0:02:12
433500 -- [-1838.272] (-1839.712) (-1836.927) (-1836.454) * (-1831.445) [-1835.495] (-1831.112) (-1832.464) -- 0:02:11
434000 -- (-1844.707) [-1840.282] (-1834.989) (-1840.788) * (-1839.340) (-1843.030) (-1835.434) [-1832.981] -- 0:02:11
434500 -- (-1837.636) [-1831.963] (-1835.564) (-1834.453) * [-1835.676] (-1832.402) (-1837.450) (-1839.856) -- 0:02:11
435000 -- (-1834.123) (-1835.766) [-1838.235] (-1841.373) * (-1836.847) [-1836.159] (-1835.612) (-1839.839) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
435500 -- (-1837.041) (-1836.730) (-1840.615) [-1835.008] * (-1831.631) (-1831.424) (-1842.673) [-1841.583] -- 0:02:10
436000 -- [-1841.282] (-1838.154) (-1836.193) (-1834.784) * (-1838.313) (-1833.044) [-1843.152] (-1836.875) -- 0:02:11
436500 -- (-1835.682) (-1835.764) (-1836.670) [-1834.733] * (-1837.994) [-1837.581] (-1838.464) (-1832.568) -- 0:02:11
437000 -- (-1831.339) (-1836.188) [-1832.379] (-1833.732) * (-1830.204) [-1832.522] (-1840.803) (-1841.713) -- 0:02:11
437500 -- [-1839.001] (-1839.786) (-1833.017) (-1839.878) * (-1839.438) [-1836.663] (-1837.664) (-1837.246) -- 0:02:11
438000 -- [-1836.080] (-1836.569) (-1834.987) (-1837.734) * [-1838.275] (-1832.417) (-1834.360) (-1831.895) -- 0:02:10
438500 -- [-1831.347] (-1835.251) (-1838.706) (-1840.130) * [-1834.620] (-1835.611) (-1829.428) (-1837.126) -- 0:02:10
439000 -- [-1834.299] (-1836.316) (-1842.602) (-1841.604) * (-1832.942) (-1833.246) [-1832.951] (-1835.210) -- 0:02:10
439500 -- (-1840.717) (-1834.801) [-1838.651] (-1843.171) * (-1836.877) (-1833.159) (-1838.485) [-1834.710] -- 0:02:10
440000 -- [-1832.536] (-1836.736) (-1841.268) (-1838.392) * (-1840.586) [-1831.701] (-1837.121) (-1831.831) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
440500 -- (-1834.300) (-1835.887) (-1833.077) [-1831.878] * (-1836.804) (-1838.055) (-1837.880) [-1832.091] -- 0:02:10
441000 -- [-1831.280] (-1838.766) (-1838.628) (-1837.177) * (-1834.734) (-1841.508) [-1836.122] (-1838.455) -- 0:02:10
441500 -- (-1837.719) (-1844.185) (-1836.933) [-1840.069] * (-1843.015) (-1840.134) [-1840.099] (-1837.313) -- 0:02:10
442000 -- (-1831.947) [-1838.998] (-1833.199) (-1843.561) * (-1840.457) (-1848.533) (-1836.518) [-1838.970] -- 0:02:10
442500 -- (-1835.482) (-1837.343) [-1837.955] (-1833.716) * (-1831.415) (-1840.984) (-1831.689) [-1835.579] -- 0:02:09
443000 -- (-1831.265) (-1845.863) [-1840.705] (-1835.572) * (-1832.140) (-1838.528) [-1831.120] (-1834.746) -- 0:02:09
443500 -- (-1836.316) (-1833.999) (-1842.129) [-1833.812] * [-1828.832] (-1838.084) (-1837.736) (-1843.647) -- 0:02:09
444000 -- (-1831.207) (-1837.690) (-1831.662) [-1832.293] * (-1833.265) (-1837.566) [-1831.639] (-1836.268) -- 0:02:08
444500 -- (-1839.284) (-1833.803) (-1830.649) [-1839.429] * (-1835.532) [-1837.360] (-1836.904) (-1834.760) -- 0:02:09
445000 -- (-1835.572) (-1838.669) [-1832.107] (-1833.488) * [-1836.608] (-1833.450) (-1841.078) (-1835.526) -- 0:02:09
Average standard deviation of split frequencies: 0.000000
445500 -- (-1832.895) [-1834.310] (-1837.037) (-1838.827) * (-1838.277) [-1830.131] (-1834.796) (-1841.564) -- 0:02:09
446000 -- (-1836.609) (-1838.752) (-1839.472) [-1835.460] * (-1840.264) [-1831.100] (-1835.258) (-1838.570) -- 0:02:09
446500 -- [-1839.854] (-1840.400) (-1834.550) (-1843.382) * [-1836.870] (-1837.590) (-1837.335) (-1838.925) -- 0:02:08
447000 -- (-1832.240) (-1839.643) (-1838.243) [-1833.902] * (-1833.469) (-1830.917) [-1836.904] (-1841.284) -- 0:02:08
447500 -- (-1831.717) (-1836.939) (-1841.138) [-1832.170] * (-1834.872) [-1834.198] (-1837.601) (-1834.604) -- 0:02:08
448000 -- (-1836.573) (-1836.640) [-1838.837] (-1834.125) * [-1832.825] (-1837.980) (-1837.545) (-1844.342) -- 0:02:08
448500 -- [-1840.518] (-1839.055) (-1845.434) (-1836.783) * [-1840.901] (-1840.370) (-1837.970) (-1842.929) -- 0:02:07
449000 -- (-1842.758) [-1833.213] (-1843.108) (-1832.787) * (-1832.121) (-1833.942) (-1841.858) [-1834.468] -- 0:02:08
449500 -- (-1831.694) [-1833.680] (-1841.739) (-1834.646) * [-1839.128] (-1834.804) (-1835.127) (-1845.096) -- 0:02:08
450000 -- (-1835.085) [-1844.904] (-1844.206) (-1836.968) * (-1841.237) (-1833.644) (-1839.750) [-1836.066] -- 0:02:08
Average standard deviation of split frequencies: 0.000000
450500 -- [-1833.250] (-1834.591) (-1840.382) (-1835.772) * (-1833.460) [-1831.950] (-1840.930) (-1832.974) -- 0:02:08
451000 -- (-1837.576) [-1835.629] (-1837.012) (-1838.504) * [-1833.642] (-1837.046) (-1838.241) (-1832.303) -- 0:02:07
451500 -- (-1833.949) (-1837.186) (-1838.523) [-1835.913] * [-1832.680] (-1841.543) (-1840.880) (-1841.524) -- 0:02:07
452000 -- [-1843.416] (-1841.383) (-1839.116) (-1843.884) * (-1835.770) (-1838.843) [-1840.085] (-1837.998) -- 0:02:07
452500 -- (-1844.116) (-1835.882) [-1834.076] (-1833.669) * (-1838.229) [-1831.893] (-1839.947) (-1839.647) -- 0:02:07
453000 -- (-1843.676) (-1840.076) [-1831.586] (-1835.920) * (-1834.321) [-1833.349] (-1837.527) (-1837.835) -- 0:02:06
453500 -- (-1838.518) (-1837.664) (-1834.635) [-1835.253] * (-1833.705) (-1843.449) [-1837.452] (-1838.016) -- 0:02:07
454000 -- [-1836.505] (-1832.887) (-1837.680) (-1833.511) * (-1831.932) (-1839.412) [-1831.899] (-1831.663) -- 0:02:07
454500 -- [-1848.059] (-1835.406) (-1840.520) (-1834.087) * (-1838.120) [-1836.290] (-1836.413) (-1832.166) -- 0:02:07
455000 -- [-1838.825] (-1842.176) (-1841.478) (-1834.303) * [-1833.355] (-1831.728) (-1841.417) (-1835.863) -- 0:02:06
Average standard deviation of split frequencies: 0.000000
455500 -- (-1832.886) (-1832.268) [-1840.071] (-1838.090) * (-1843.712) (-1835.613) (-1836.343) [-1836.474] -- 0:02:06
456000 -- (-1839.965) [-1837.950] (-1841.867) (-1837.293) * (-1833.183) [-1833.854] (-1832.026) (-1836.881) -- 0:02:06
456500 -- (-1845.014) (-1840.041) [-1832.995] (-1837.962) * (-1834.693) [-1836.059] (-1838.954) (-1842.385) -- 0:02:06
457000 -- (-1845.957) (-1834.614) [-1833.849] (-1834.979) * (-1836.672) (-1839.137) [-1834.770] (-1837.812) -- 0:02:05
457500 -- (-1836.322) [-1836.011] (-1844.730) (-1840.607) * (-1848.844) [-1840.482] (-1844.915) (-1832.723) -- 0:02:06
458000 -- [-1839.221] (-1836.165) (-1852.337) (-1835.795) * [-1839.962] (-1835.215) (-1843.960) (-1835.783) -- 0:02:06
458500 -- (-1831.775) (-1835.212) [-1835.322] (-1840.754) * (-1836.950) (-1832.807) [-1842.434] (-1836.409) -- 0:02:06
459000 -- [-1830.431] (-1834.796) (-1836.669) (-1844.645) * (-1834.665) (-1837.890) [-1833.879] (-1849.636) -- 0:02:06
459500 -- [-1832.102] (-1835.144) (-1835.907) (-1836.728) * [-1839.766] (-1843.742) (-1839.227) (-1835.973) -- 0:02:05
460000 -- (-1836.289) (-1837.395) [-1832.896] (-1834.354) * (-1832.764) (-1840.062) [-1840.850] (-1840.962) -- 0:02:05
Average standard deviation of split frequencies: 0.000000
460500 -- [-1834.013] (-1839.755) (-1838.576) (-1838.288) * (-1840.119) [-1839.977] (-1832.225) (-1840.760) -- 0:02:05
461000 -- (-1832.727) [-1833.644] (-1834.564) (-1840.332) * (-1831.773) (-1838.073) [-1835.537] (-1836.214) -- 0:02:05
461500 -- (-1834.821) (-1838.713) [-1837.051] (-1843.718) * (-1836.748) (-1840.010) (-1837.031) [-1834.014] -- 0:02:04
462000 -- (-1843.207) (-1843.456) (-1838.004) [-1840.326] * (-1846.200) (-1838.922) (-1846.675) [-1831.793] -- 0:02:05
462500 -- [-1836.192] (-1842.600) (-1838.153) (-1837.872) * (-1841.487) (-1841.089) (-1837.977) [-1836.378] -- 0:02:05
463000 -- (-1832.024) (-1834.863) [-1839.791] (-1839.552) * (-1838.992) [-1838.309] (-1836.422) (-1830.272) -- 0:02:05
463500 -- (-1834.730) [-1836.378] (-1835.539) (-1835.562) * (-1838.543) (-1841.597) (-1837.539) [-1837.994] -- 0:02:05
464000 -- [-1836.919] (-1836.459) (-1834.661) (-1837.843) * [-1831.693] (-1847.316) (-1836.546) (-1836.724) -- 0:02:04
464500 -- [-1833.439] (-1835.425) (-1835.834) (-1838.143) * [-1837.025] (-1843.698) (-1835.612) (-1840.696) -- 0:02:04
465000 -- (-1832.118) [-1834.379] (-1832.963) (-1845.393) * (-1838.040) (-1843.673) [-1833.760] (-1832.187) -- 0:02:04
Average standard deviation of split frequencies: 0.000000
465500 -- (-1842.436) (-1840.688) (-1835.993) [-1842.379] * (-1835.793) (-1851.138) [-1835.186] (-1833.623) -- 0:02:04
466000 -- (-1838.194) (-1833.675) [-1836.097] (-1829.228) * (-1836.128) (-1840.313) [-1837.474] (-1831.583) -- 0:02:03
466500 -- (-1845.041) [-1835.487] (-1832.825) (-1837.349) * (-1836.242) [-1841.029] (-1834.322) (-1838.866) -- 0:02:04
467000 -- [-1831.348] (-1833.721) (-1831.827) (-1834.085) * (-1835.217) (-1839.354) (-1843.776) [-1835.337] -- 0:02:04
467500 -- (-1835.173) [-1837.088] (-1837.374) (-1834.555) * [-1835.964] (-1841.351) (-1840.198) (-1833.720) -- 0:02:04
468000 -- (-1835.895) [-1838.075] (-1836.897) (-1835.206) * (-1837.700) (-1845.599) [-1840.311] (-1837.620) -- 0:02:03
468500 -- [-1833.427] (-1840.416) (-1835.823) (-1835.605) * (-1837.758) [-1840.596] (-1842.238) (-1836.390) -- 0:02:03
469000 -- [-1833.218] (-1835.389) (-1833.963) (-1833.489) * (-1836.643) (-1837.713) [-1837.375] (-1836.215) -- 0:02:03
469500 -- (-1832.474) (-1833.492) [-1830.433] (-1844.295) * (-1828.725) [-1837.234] (-1832.958) (-1835.863) -- 0:02:03
470000 -- [-1830.860] (-1837.727) (-1832.931) (-1837.640) * (-1833.500) [-1836.646] (-1833.311) (-1840.350) -- 0:02:02
Average standard deviation of split frequencies: 0.000000
470500 -- (-1835.672) (-1840.022) [-1831.738] (-1835.383) * (-1831.643) (-1840.026) (-1842.269) [-1838.248] -- 0:02:03
471000 -- (-1832.927) (-1830.449) [-1840.743] (-1839.628) * (-1834.168) (-1836.822) [-1832.753] (-1838.449) -- 0:02:03
471500 -- (-1835.387) (-1830.844) [-1834.097] (-1832.002) * (-1838.354) [-1840.614] (-1834.001) (-1839.599) -- 0:02:03
472000 -- (-1838.239) (-1830.218) [-1837.844] (-1832.661) * (-1835.271) (-1838.315) [-1833.100] (-1832.910) -- 0:02:03
472500 -- [-1838.360] (-1838.988) (-1836.154) (-1849.168) * (-1834.640) (-1840.911) [-1836.719] (-1835.967) -- 0:02:02
473000 -- (-1832.622) (-1835.740) (-1832.781) [-1834.411] * (-1835.540) (-1836.724) (-1838.147) [-1839.110] -- 0:02:02
473500 -- (-1840.246) [-1835.791] (-1838.325) (-1836.636) * [-1838.647] (-1838.500) (-1838.292) (-1841.309) -- 0:02:02
474000 -- (-1839.616) (-1834.701) [-1836.858] (-1842.900) * [-1835.870] (-1842.934) (-1830.707) (-1849.468) -- 0:02:02
474500 -- (-1839.062) [-1836.206] (-1840.392) (-1834.143) * [-1833.036] (-1849.671) (-1841.973) (-1835.643) -- 0:02:01
475000 -- (-1835.540) (-1840.198) (-1833.195) [-1834.525] * (-1836.298) (-1841.503) [-1837.918] (-1837.292) -- 0:02:02
Average standard deviation of split frequencies: 0.000000
475500 -- (-1833.379) [-1832.943] (-1839.746) (-1832.029) * (-1833.267) [-1833.859] (-1839.577) (-1837.730) -- 0:02:02
476000 -- (-1838.790) [-1832.302] (-1835.648) (-1834.084) * (-1836.672) [-1832.218] (-1839.805) (-1831.420) -- 0:02:02
476500 -- (-1832.684) (-1831.891) (-1848.810) [-1836.899] * [-1841.039] (-1828.999) (-1844.240) (-1835.867) -- 0:02:01
477000 -- (-1839.738) (-1832.580) (-1849.066) [-1835.291] * [-1834.503] (-1834.517) (-1835.887) (-1836.248) -- 0:02:01
477500 -- (-1839.991) (-1833.271) [-1835.341] (-1841.287) * (-1836.236) [-1833.621] (-1836.134) (-1840.475) -- 0:02:01
478000 -- (-1844.308) [-1831.890] (-1833.138) (-1839.334) * (-1837.915) (-1840.286) (-1829.943) [-1837.182] -- 0:02:01
478500 -- (-1834.294) [-1838.125] (-1832.830) (-1837.036) * (-1831.240) (-1836.393) [-1833.035] (-1838.194) -- 0:02:00
479000 -- [-1838.130] (-1832.295) (-1835.698) (-1837.138) * (-1836.557) (-1840.269) (-1837.050) [-1836.888] -- 0:02:01
479500 -- (-1834.708) (-1831.908) (-1834.998) [-1834.730] * [-1837.911] (-1840.574) (-1838.595) (-1832.751) -- 0:02:01
480000 -- [-1835.865] (-1838.671) (-1834.254) (-1842.210) * (-1844.435) (-1836.041) [-1832.332] (-1839.580) -- 0:02:01
Average standard deviation of split frequencies: 0.000000
480500 -- (-1840.610) (-1836.395) [-1831.734] (-1836.779) * (-1838.188) (-1836.662) (-1835.298) [-1833.829] -- 0:02:01
481000 -- (-1842.072) (-1837.560) [-1830.325] (-1841.385) * (-1836.371) (-1839.062) (-1838.821) [-1841.184] -- 0:02:00
481500 -- (-1838.870) (-1836.475) (-1840.471) [-1834.564] * (-1830.108) (-1834.894) (-1846.022) [-1836.076] -- 0:02:00
482000 -- (-1840.133) (-1838.697) [-1839.809] (-1838.420) * (-1833.861) (-1833.335) (-1833.587) [-1840.834] -- 0:02:00
482500 -- (-1837.934) (-1838.724) [-1840.202] (-1830.833) * (-1837.451) (-1836.034) [-1838.283] (-1835.720) -- 0:02:00
483000 -- (-1840.337) (-1841.762) [-1838.278] (-1840.052) * (-1851.705) [-1835.961] (-1840.342) (-1835.074) -- 0:01:59
483500 -- (-1839.445) (-1830.885) [-1838.196] (-1843.699) * [-1838.788] (-1842.964) (-1839.771) (-1842.287) -- 0:02:00
484000 -- (-1834.389) (-1835.959) [-1831.947] (-1839.379) * [-1834.329] (-1837.035) (-1838.657) (-1841.269) -- 0:02:00
484500 -- (-1832.711) (-1835.740) (-1836.680) [-1834.465] * [-1829.758] (-1835.257) (-1837.015) (-1835.433) -- 0:02:00
485000 -- [-1841.528] (-1840.169) (-1838.821) (-1837.989) * (-1835.105) (-1835.844) (-1837.185) [-1836.091] -- 0:01:59
Average standard deviation of split frequencies: 0.000000
485500 -- [-1832.863] (-1834.867) (-1836.101) (-1834.456) * (-1835.508) (-1839.238) [-1831.889] (-1837.371) -- 0:01:59
486000 -- (-1834.046) [-1837.428] (-1836.317) (-1837.821) * (-1834.396) (-1836.077) [-1837.382] (-1835.535) -- 0:01:59
486500 -- (-1835.332) (-1847.321) [-1835.795] (-1830.030) * (-1838.663) (-1836.470) (-1834.963) [-1837.856] -- 0:01:59
487000 -- (-1834.655) [-1834.897] (-1843.533) (-1841.569) * [-1839.802] (-1834.804) (-1833.136) (-1832.817) -- 0:01:59
487500 -- (-1841.833) (-1833.040) [-1833.809] (-1845.882) * (-1832.830) [-1834.049] (-1838.011) (-1832.059) -- 0:01:58
488000 -- (-1834.019) (-1832.166) (-1846.918) [-1838.324] * (-1842.682) [-1829.504] (-1832.828) (-1835.098) -- 0:01:59
488500 -- [-1832.579] (-1842.871) (-1843.382) (-1840.626) * (-1834.014) (-1835.195) (-1831.849) [-1833.065] -- 0:01:59
489000 -- [-1832.539] (-1846.792) (-1841.482) (-1840.838) * (-1835.611) (-1840.845) (-1833.747) [-1833.753] -- 0:01:59
489500 -- [-1836.944] (-1841.038) (-1840.492) (-1836.319) * (-1837.349) [-1833.584] (-1838.627) (-1834.083) -- 0:01:58
490000 -- (-1833.573) (-1840.888) (-1837.503) [-1834.454] * (-1839.724) (-1830.356) [-1833.757] (-1834.941) -- 0:01:58
Average standard deviation of split frequencies: 0.000000
490500 -- (-1839.782) [-1837.262] (-1838.988) (-1842.366) * (-1838.400) (-1834.313) (-1836.755) [-1833.964] -- 0:01:58
491000 -- (-1847.676) [-1831.724] (-1844.584) (-1838.428) * [-1843.008] (-1833.725) (-1836.308) (-1834.462) -- 0:01:58
491500 -- [-1834.412] (-1835.446) (-1832.393) (-1837.397) * (-1838.945) (-1834.135) (-1837.844) [-1837.632] -- 0:01:57
492000 -- [-1832.693] (-1832.551) (-1838.034) (-1833.567) * (-1834.249) [-1836.525] (-1841.142) (-1834.644) -- 0:01:58
492500 -- (-1841.907) (-1831.853) (-1834.303) [-1834.375] * (-1833.292) (-1837.849) (-1838.907) [-1834.085] -- 0:01:58
493000 -- (-1833.638) (-1836.718) [-1840.270] (-1835.312) * [-1832.046] (-1836.371) (-1837.363) (-1837.928) -- 0:01:58
493500 -- (-1833.781) [-1832.392] (-1841.522) (-1839.054) * [-1837.819] (-1836.495) (-1839.946) (-1843.305) -- 0:01:58
494000 -- (-1835.011) [-1834.264] (-1838.068) (-1840.614) * [-1837.864] (-1850.735) (-1833.681) (-1836.828) -- 0:01:57
494500 -- [-1839.371] (-1836.519) (-1834.723) (-1841.156) * (-1840.135) (-1838.349) (-1835.781) [-1836.343] -- 0:01:57
495000 -- (-1839.304) (-1836.996) [-1837.140] (-1840.563) * (-1832.763) (-1839.888) [-1836.257] (-1837.811) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
495500 -- (-1838.239) [-1833.251] (-1840.037) (-1835.916) * [-1832.884] (-1829.034) (-1841.994) (-1837.556) -- 0:01:57
496000 -- (-1839.914) (-1836.538) (-1831.185) [-1832.093] * (-1839.879) [-1833.937] (-1846.402) (-1831.159) -- 0:01:56
496500 -- (-1839.953) (-1838.778) (-1833.347) [-1837.028] * [-1828.032] (-1832.029) (-1842.893) (-1830.280) -- 0:01:57
497000 -- (-1835.992) (-1836.544) (-1831.994) [-1832.069] * (-1837.892) [-1838.734] (-1842.035) (-1838.914) -- 0:01:57
497500 -- (-1837.503) (-1838.886) (-1835.094) [-1839.797] * (-1834.241) (-1844.674) (-1837.114) [-1835.284] -- 0:01:57
498000 -- (-1837.229) (-1842.106) [-1834.472] (-1838.771) * [-1835.676] (-1841.635) (-1837.811) (-1836.937) -- 0:01:56
498500 -- (-1837.606) [-1834.303] (-1841.323) (-1839.965) * [-1836.287] (-1845.955) (-1837.565) (-1839.668) -- 0:01:56
499000 -- [-1832.955] (-1831.472) (-1838.942) (-1842.588) * (-1834.682) [-1833.343] (-1840.906) (-1841.731) -- 0:01:56
499500 -- (-1838.473) (-1831.841) [-1834.260] (-1835.200) * (-1832.009) (-1837.674) [-1838.520] (-1836.014) -- 0:01:56
500000 -- [-1834.711] (-1833.328) (-1831.667) (-1839.868) * (-1833.147) (-1834.522) (-1833.096) [-1832.496] -- 0:01:56
Average standard deviation of split frequencies: 0.000000
500500 -- (-1840.775) (-1835.332) [-1837.466] (-1836.701) * (-1834.935) (-1837.312) (-1833.823) [-1834.061] -- 0:01:55
501000 -- (-1834.554) (-1833.556) [-1837.127] (-1834.689) * (-1833.918) (-1837.289) [-1832.237] (-1838.617) -- 0:01:56
501500 -- (-1841.459) (-1841.436) [-1833.036] (-1831.402) * (-1835.309) (-1836.976) (-1837.594) [-1836.127] -- 0:01:56
502000 -- (-1836.662) [-1832.849] (-1834.525) (-1840.881) * (-1839.379) (-1838.224) (-1835.801) [-1840.236] -- 0:01:56
502500 -- (-1839.383) (-1838.698) [-1836.540] (-1839.143) * [-1837.986] (-1839.993) (-1836.825) (-1835.073) -- 0:01:55
503000 -- [-1837.647] (-1835.659) (-1847.714) (-1836.067) * (-1847.563) (-1840.952) [-1836.821] (-1831.508) -- 0:01:55
503500 -- (-1834.626) (-1837.953) (-1835.425) [-1833.981] * [-1837.654] (-1838.817) (-1831.527) (-1839.667) -- 0:01:55
504000 -- (-1837.448) [-1833.990] (-1839.948) (-1840.878) * [-1832.545] (-1837.145) (-1835.595) (-1843.145) -- 0:01:55
504500 -- (-1835.266) [-1834.240] (-1831.809) (-1836.293) * (-1839.632) (-1842.019) [-1835.458] (-1839.108) -- 0:01:54
505000 -- (-1837.817) (-1832.174) (-1836.760) [-1831.567] * (-1834.771) (-1839.804) (-1833.992) [-1840.895] -- 0:01:55
Average standard deviation of split frequencies: 0.000000
505500 -- [-1829.324] (-1836.297) (-1832.683) (-1836.327) * (-1830.811) [-1836.937] (-1834.184) (-1838.211) -- 0:01:55
506000 -- (-1830.814) [-1836.994] (-1835.164) (-1835.766) * [-1835.380] (-1837.581) (-1838.602) (-1837.134) -- 0:01:55
506500 -- [-1838.929] (-1840.309) (-1846.624) (-1835.324) * (-1831.313) [-1829.751] (-1834.435) (-1831.088) -- 0:01:54
507000 -- [-1834.304] (-1832.326) (-1836.900) (-1834.944) * (-1833.838) (-1835.038) [-1836.033] (-1831.383) -- 0:01:54
507500 -- (-1832.303) (-1836.961) [-1841.476] (-1833.847) * (-1834.747) (-1836.593) [-1841.261] (-1843.968) -- 0:01:54
508000 -- (-1830.651) [-1833.273] (-1843.464) (-1832.483) * (-1841.034) [-1839.954] (-1835.145) (-1839.051) -- 0:01:54
508500 -- (-1833.345) (-1836.149) (-1836.246) [-1832.919] * (-1840.462) [-1833.251] (-1836.855) (-1834.064) -- 0:01:54
509000 -- (-1835.301) (-1833.323) [-1835.733] (-1836.136) * (-1841.001) (-1840.453) (-1836.076) [-1831.339] -- 0:01:53
509500 -- (-1835.891) (-1833.957) [-1837.578] (-1833.279) * [-1834.032] (-1841.430) (-1835.814) (-1833.889) -- 0:01:54
510000 -- (-1838.836) [-1836.671] (-1844.490) (-1834.637) * [-1835.311] (-1833.134) (-1845.030) (-1832.995) -- 0:01:54
Average standard deviation of split frequencies: 0.000000
510500 -- [-1840.469] (-1837.384) (-1835.758) (-1837.176) * (-1831.844) (-1834.687) [-1829.919] (-1837.074) -- 0:01:54
511000 -- (-1835.937) (-1839.744) [-1837.670] (-1840.460) * (-1837.162) (-1837.867) [-1836.497] (-1835.529) -- 0:01:53
511500 -- (-1836.366) (-1838.979) [-1834.450] (-1834.260) * (-1834.179) (-1838.345) [-1835.536] (-1837.263) -- 0:01:53
512000 -- (-1836.890) [-1840.559] (-1834.984) (-1837.186) * [-1831.595] (-1831.690) (-1838.481) (-1831.958) -- 0:01:53
512500 -- [-1833.395] (-1839.532) (-1834.072) (-1834.592) * (-1838.799) (-1830.531) (-1840.047) [-1829.062] -- 0:01:53
513000 -- [-1834.020] (-1838.948) (-1835.698) (-1837.798) * (-1837.853) (-1835.985) (-1835.820) [-1833.565] -- 0:01:52
513500 -- (-1840.200) [-1837.402] (-1836.568) (-1833.429) * (-1832.073) (-1834.549) [-1831.187] (-1834.531) -- 0:01:52
514000 -- (-1840.569) (-1837.910) [-1837.122] (-1840.694) * (-1835.252) (-1831.327) [-1830.968] (-1837.322) -- 0:01:53
514500 -- (-1836.383) [-1837.932] (-1846.727) (-1835.309) * (-1834.033) (-1831.700) [-1836.796] (-1834.602) -- 0:01:53
515000 -- (-1841.661) (-1835.662) (-1836.921) [-1837.425] * (-1832.926) (-1839.118) (-1843.858) [-1833.099] -- 0:01:53
Average standard deviation of split frequencies: 0.000000
515500 -- (-1839.121) (-1836.533) [-1838.442] (-1840.059) * [-1842.900] (-1835.262) (-1838.452) (-1836.713) -- 0:01:52
516000 -- [-1837.707] (-1834.103) (-1845.319) (-1846.215) * [-1831.675] (-1837.577) (-1837.780) (-1833.577) -- 0:01:52
516500 -- (-1831.964) (-1838.566) [-1838.295] (-1842.182) * (-1838.015) (-1836.515) (-1837.137) [-1830.297] -- 0:01:52
517000 -- (-1829.667) (-1836.118) (-1833.280) [-1837.556] * [-1836.726] (-1836.194) (-1833.580) (-1833.790) -- 0:01:52
517500 -- (-1838.925) (-1843.838) (-1843.285) [-1833.659] * (-1835.222) (-1835.605) (-1835.579) [-1830.972] -- 0:01:51
518000 -- (-1840.360) (-1835.028) (-1833.482) [-1831.752] * (-1835.276) (-1832.481) (-1832.015) [-1832.263] -- 0:01:52
518500 -- (-1836.305) (-1838.432) (-1836.188) [-1835.456] * (-1839.313) (-1835.267) [-1838.335] (-1837.979) -- 0:01:52
519000 -- (-1833.460) [-1835.528] (-1833.747) (-1835.521) * (-1833.615) [-1839.798] (-1838.182) (-1844.995) -- 0:01:52
519500 -- (-1834.924) [-1832.312] (-1836.201) (-1835.060) * (-1830.517) (-1838.841) [-1832.990] (-1832.950) -- 0:01:51
520000 -- (-1837.282) (-1840.696) (-1835.981) [-1831.438] * [-1833.860] (-1832.987) (-1847.186) (-1836.441) -- 0:01:51
Average standard deviation of split frequencies: 0.000000
520500 -- (-1834.698) [-1849.771] (-1840.030) (-1836.629) * (-1833.997) (-1833.240) (-1837.148) [-1835.674] -- 0:01:51
521000 -- [-1834.338] (-1840.718) (-1839.792) (-1835.470) * [-1833.733] (-1834.082) (-1838.300) (-1833.699) -- 0:01:51
521500 -- (-1832.271) (-1833.362) (-1843.062) [-1832.494] * (-1834.902) [-1833.918] (-1843.352) (-1834.608) -- 0:01:51
522000 -- (-1837.848) (-1838.000) [-1841.143] (-1836.635) * [-1836.539] (-1836.201) (-1836.917) (-1837.390) -- 0:01:50
522500 -- (-1831.175) (-1833.529) [-1834.185] (-1837.801) * (-1834.868) [-1834.806] (-1838.984) (-1839.584) -- 0:01:51
523000 -- (-1834.633) (-1836.474) (-1845.036) [-1838.373] * (-1837.860) (-1832.097) [-1840.200] (-1837.728) -- 0:01:51
523500 -- (-1838.972) (-1838.857) (-1841.443) [-1835.670] * (-1840.272) [-1839.524] (-1851.246) (-1833.018) -- 0:01:51
524000 -- (-1832.338) (-1835.538) [-1835.400] (-1831.280) * (-1836.587) (-1836.018) (-1838.726) [-1835.859] -- 0:01:50
524500 -- (-1835.320) [-1834.999] (-1841.710) (-1834.121) * (-1835.775) [-1834.039] (-1832.318) (-1833.468) -- 0:01:50
525000 -- [-1833.027] (-1836.198) (-1837.925) (-1836.391) * (-1832.665) [-1836.220] (-1837.153) (-1834.613) -- 0:01:50
Average standard deviation of split frequencies: 0.000000
525500 -- [-1832.637] (-1843.072) (-1835.392) (-1833.883) * (-1833.096) (-1833.460) (-1833.599) [-1834.888] -- 0:01:50
526000 -- [-1828.151] (-1839.256) (-1839.357) (-1833.030) * (-1835.364) (-1833.964) (-1831.356) [-1838.480] -- 0:01:49
526500 -- (-1834.608) (-1841.803) [-1828.239] (-1841.315) * (-1834.131) [-1841.539] (-1829.500) (-1832.376) -- 0:01:49
527000 -- (-1834.802) (-1843.540) [-1837.574] (-1839.466) * (-1834.879) [-1839.508] (-1829.674) (-1830.941) -- 0:01:50
527500 -- (-1833.754) (-1841.930) (-1839.087) [-1834.665] * (-1836.405) (-1836.023) [-1834.554] (-1833.620) -- 0:01:50
528000 -- (-1840.085) (-1840.707) [-1837.796] (-1833.114) * [-1831.753] (-1839.434) (-1839.487) (-1833.783) -- 0:01:49
528500 -- [-1839.069] (-1837.905) (-1840.607) (-1839.028) * (-1838.818) (-1842.680) (-1836.739) [-1832.795] -- 0:01:49
529000 -- [-1838.135] (-1838.718) (-1842.787) (-1838.352) * [-1841.952] (-1833.343) (-1836.048) (-1839.016) -- 0:01:49
529500 -- (-1838.040) [-1835.431] (-1837.904) (-1834.900) * [-1838.954] (-1837.477) (-1835.460) (-1840.758) -- 0:01:49
530000 -- [-1835.869] (-1832.137) (-1831.997) (-1834.102) * (-1839.828) [-1836.616] (-1834.336) (-1839.786) -- 0:01:49
Average standard deviation of split frequencies: 0.000000
530500 -- (-1830.970) (-1837.045) (-1835.980) [-1831.784] * (-1837.834) (-1839.177) (-1836.134) [-1836.287] -- 0:01:48
531000 -- (-1839.482) (-1834.209) [-1834.095] (-1834.811) * (-1834.816) (-1842.086) [-1837.521] (-1832.054) -- 0:01:49
531500 -- [-1838.438] (-1834.768) (-1836.744) (-1837.552) * (-1834.655) (-1847.472) [-1833.616] (-1837.452) -- 0:01:49
532000 -- (-1839.689) (-1834.715) [-1836.070] (-1835.868) * [-1834.806] (-1833.247) (-1834.764) (-1839.943) -- 0:01:49
532500 -- (-1847.530) [-1836.498] (-1841.578) (-1838.771) * (-1842.244) [-1835.626] (-1831.577) (-1834.003) -- 0:01:48
533000 -- (-1833.616) [-1835.207] (-1836.398) (-1836.168) * (-1842.460) [-1833.439] (-1839.437) (-1840.758) -- 0:01:48
533500 -- (-1835.147) (-1834.295) (-1840.187) [-1838.045] * (-1836.421) [-1832.293] (-1836.201) (-1837.512) -- 0:01:48
534000 -- (-1831.758) [-1837.496] (-1836.066) (-1836.375) * (-1844.809) (-1835.376) [-1839.653] (-1840.019) -- 0:01:48
534500 -- (-1832.367) (-1833.447) [-1836.595] (-1831.490) * (-1845.675) [-1835.531] (-1837.702) (-1841.448) -- 0:01:47
535000 -- (-1837.418) (-1832.294) (-1840.445) [-1837.090] * (-1838.793) (-1835.176) (-1839.606) [-1834.548] -- 0:01:47
Average standard deviation of split frequencies: 0.000000
535500 -- [-1833.575] (-1832.341) (-1830.554) (-1839.824) * (-1840.461) (-1849.613) [-1841.057] (-1837.404) -- 0:01:48
536000 -- (-1838.735) (-1833.930) (-1829.791) [-1833.702] * (-1837.586) [-1834.350] (-1846.379) (-1835.739) -- 0:01:48
536500 -- (-1835.701) (-1833.399) (-1835.276) [-1834.052] * [-1837.803] (-1835.690) (-1840.629) (-1834.509) -- 0:01:47
537000 -- (-1838.282) [-1838.741] (-1834.333) (-1842.264) * (-1834.864) (-1836.873) (-1840.067) [-1834.111] -- 0:01:47
537500 -- (-1835.960) (-1842.375) [-1832.854] (-1839.570) * [-1833.650] (-1835.567) (-1834.566) (-1841.579) -- 0:01:47
538000 -- [-1838.574] (-1843.016) (-1835.528) (-1841.397) * (-1830.130) [-1832.908] (-1833.555) (-1842.395) -- 0:01:47
538500 -- (-1839.015) (-1834.337) [-1835.682] (-1840.768) * (-1832.823) [-1837.064] (-1836.389) (-1838.960) -- 0:01:47
539000 -- (-1837.019) [-1840.546] (-1840.311) (-1834.103) * (-1842.257) (-1838.669) (-1835.853) [-1835.726] -- 0:01:46
539500 -- [-1832.367] (-1837.465) (-1834.808) (-1833.617) * (-1835.359) (-1838.985) [-1833.960] (-1846.752) -- 0:01:46
540000 -- (-1835.709) (-1831.775) [-1835.144] (-1835.682) * (-1838.774) (-1833.331) (-1835.356) [-1835.487] -- 0:01:47
Average standard deviation of split frequencies: 0.000000
540500 -- [-1834.311] (-1831.707) (-1834.475) (-1841.520) * (-1832.761) [-1836.034] (-1841.340) (-1836.989) -- 0:01:47
541000 -- (-1838.737) [-1832.610] (-1832.905) (-1847.706) * [-1840.094] (-1840.246) (-1839.962) (-1839.280) -- 0:01:46
541500 -- (-1836.412) [-1834.192] (-1835.956) (-1845.508) * (-1834.354) (-1837.997) [-1831.242] (-1836.574) -- 0:01:46
542000 -- (-1833.835) (-1837.089) [-1834.001] (-1846.849) * (-1839.291) (-1835.777) [-1832.481] (-1843.246) -- 0:01:46
542500 -- [-1835.538] (-1831.322) (-1836.686) (-1839.105) * (-1838.261) (-1838.311) (-1830.765) [-1842.744] -- 0:01:46
543000 -- (-1842.519) [-1838.886] (-1840.413) (-1840.722) * (-1834.509) (-1831.815) (-1833.489) [-1835.305] -- 0:01:46
543500 -- (-1835.188) [-1845.841] (-1836.901) (-1845.583) * (-1840.967) [-1832.687] (-1836.136) (-1836.662) -- 0:01:45
544000 -- [-1833.172] (-1832.078) (-1837.494) (-1838.398) * (-1838.996) (-1832.802) [-1832.785] (-1836.273) -- 0:01:46
544500 -- (-1834.115) (-1839.325) (-1836.866) [-1839.935] * [-1834.476] (-1831.876) (-1836.884) (-1841.382) -- 0:01:46
545000 -- (-1842.330) [-1837.503] (-1843.703) (-1835.270) * (-1839.240) (-1838.512) [-1840.219] (-1838.922) -- 0:01:46
Average standard deviation of split frequencies: 0.000000
545500 -- (-1841.011) (-1836.585) [-1834.467] (-1836.460) * (-1838.735) (-1839.414) [-1834.958] (-1835.729) -- 0:01:45
546000 -- (-1830.755) [-1834.442] (-1836.942) (-1841.142) * [-1834.932] (-1833.557) (-1840.931) (-1836.392) -- 0:01:45
546500 -- (-1842.123) (-1835.076) [-1832.818] (-1842.986) * [-1836.490] (-1835.706) (-1841.031) (-1838.104) -- 0:01:45
547000 -- (-1839.479) [-1834.264] (-1840.151) (-1843.453) * (-1836.484) (-1844.122) [-1844.044] (-1842.891) -- 0:01:45
547500 -- (-1831.461) (-1836.706) [-1835.838] (-1837.724) * (-1839.754) [-1837.285] (-1846.168) (-1848.174) -- 0:01:44
548000 -- (-1840.131) (-1834.727) [-1835.597] (-1838.372) * (-1839.273) [-1833.408] (-1835.157) (-1842.931) -- 0:01:44
548500 -- [-1841.114] (-1841.164) (-1835.336) (-1847.205) * (-1842.574) (-1832.896) [-1833.198] (-1838.348) -- 0:01:45
549000 -- (-1832.906) (-1839.367) [-1833.745] (-1837.841) * (-1842.642) (-1833.849) [-1832.439] (-1833.951) -- 0:01:45
549500 -- [-1836.233] (-1841.220) (-1837.427) (-1837.305) * (-1844.141) (-1835.679) (-1833.556) [-1837.453] -- 0:01:44
550000 -- (-1838.396) (-1831.072) [-1831.544] (-1838.759) * (-1836.970) (-1833.268) [-1834.963] (-1830.556) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
550500 -- (-1838.376) (-1831.120) [-1831.823] (-1839.125) * (-1839.229) (-1831.043) (-1839.942) [-1835.565] -- 0:01:44
551000 -- (-1841.816) [-1833.332] (-1837.611) (-1855.301) * (-1836.964) (-1837.766) (-1839.266) [-1835.887] -- 0:01:44
551500 -- (-1835.771) [-1840.170] (-1831.544) (-1841.361) * (-1838.134) [-1834.527] (-1836.737) (-1836.306) -- 0:01:44
552000 -- (-1837.476) [-1835.891] (-1838.862) (-1840.693) * (-1835.188) (-1835.978) [-1834.037] (-1834.082) -- 0:01:43
552500 -- [-1832.002] (-1838.337) (-1838.312) (-1841.233) * (-1844.918) [-1839.062] (-1834.423) (-1837.144) -- 0:01:43
553000 -- (-1838.848) (-1837.127) (-1834.822) [-1837.211] * (-1840.612) (-1838.200) (-1831.168) [-1831.324] -- 0:01:44
553500 -- (-1837.288) (-1834.141) (-1834.972) [-1834.351] * (-1838.346) [-1838.121] (-1837.236) (-1836.775) -- 0:01:44
554000 -- (-1833.609) (-1835.017) [-1843.243] (-1830.369) * [-1842.825] (-1842.358) (-1837.496) (-1832.244) -- 0:01:43
554500 -- (-1843.964) (-1833.521) (-1841.514) [-1837.672] * (-1835.656) (-1834.073) (-1831.444) [-1831.924] -- 0:01:43
555000 -- [-1836.297] (-1841.714) (-1841.169) (-1839.531) * (-1836.297) (-1838.408) [-1833.652] (-1837.482) -- 0:01:43
Average standard deviation of split frequencies: 0.000000
555500 -- (-1846.324) [-1843.277] (-1834.985) (-1840.445) * (-1837.543) [-1841.028] (-1836.112) (-1837.107) -- 0:01:43
556000 -- (-1836.269) (-1833.722) (-1836.815) [-1835.225] * [-1839.319] (-1835.150) (-1853.605) (-1836.705) -- 0:01:43
556500 -- (-1843.691) [-1836.700] (-1835.970) (-1839.981) * [-1834.820] (-1840.021) (-1840.539) (-1834.251) -- 0:01:42
557000 -- (-1846.215) (-1833.232) [-1835.159] (-1834.801) * (-1840.271) (-1841.755) [-1836.811] (-1842.378) -- 0:01:43
557500 -- (-1835.915) (-1833.506) [-1834.551] (-1832.940) * [-1833.183] (-1836.880) (-1834.863) (-1836.875) -- 0:01:43
558000 -- (-1840.134) [-1848.260] (-1836.578) (-1840.437) * (-1837.528) [-1834.276] (-1834.218) (-1839.965) -- 0:01:42
558500 -- (-1846.386) (-1836.737) [-1831.170] (-1834.707) * (-1839.382) (-1832.164) (-1836.201) [-1833.870] -- 0:01:42
559000 -- (-1833.302) (-1839.060) [-1832.680] (-1831.810) * (-1832.985) (-1839.716) (-1834.482) [-1836.877] -- 0:01:42
559500 -- (-1835.574) [-1834.170] (-1831.410) (-1833.741) * (-1838.430) [-1837.439] (-1839.087) (-1837.255) -- 0:01:42
560000 -- (-1839.013) (-1836.149) (-1835.241) [-1833.030] * (-1839.969) (-1838.930) (-1831.479) [-1831.245] -- 0:01:42
Average standard deviation of split frequencies: 0.000000
560500 -- (-1841.524) (-1829.332) [-1830.426] (-1844.067) * [-1833.827] (-1834.051) (-1838.738) (-1831.553) -- 0:01:41
561000 -- [-1833.438] (-1840.341) (-1842.386) (-1833.720) * (-1837.716) [-1836.254] (-1839.450) (-1837.902) -- 0:01:41
561500 -- [-1831.331] (-1839.423) (-1836.195) (-1832.625) * (-1830.450) (-1836.280) [-1843.964] (-1834.963) -- 0:01:42
562000 -- (-1833.697) (-1840.206) [-1836.603] (-1833.879) * (-1840.308) [-1835.762] (-1840.526) (-1832.496) -- 0:01:42
562500 -- (-1832.999) [-1835.307] (-1835.760) (-1834.201) * [-1833.298] (-1841.952) (-1838.383) (-1833.110) -- 0:01:41
563000 -- (-1837.034) (-1837.505) [-1837.514] (-1840.702) * [-1836.348] (-1836.723) (-1837.786) (-1835.806) -- 0:01:41
563500 -- (-1838.114) (-1834.517) (-1836.829) [-1838.126] * (-1833.750) [-1834.498] (-1841.781) (-1835.929) -- 0:01:41
564000 -- (-1839.180) (-1837.469) (-1841.097) [-1839.361] * [-1831.143] (-1835.467) (-1838.435) (-1840.220) -- 0:01:41
564500 -- (-1842.952) (-1835.393) (-1840.413) [-1837.130] * (-1830.742) [-1837.606] (-1833.878) (-1832.471) -- 0:01:41
565000 -- (-1844.430) (-1836.762) (-1833.659) [-1833.706] * (-1836.460) (-1831.682) (-1841.974) [-1841.197] -- 0:01:40
Average standard deviation of split frequencies: 0.000000
565500 -- (-1837.386) [-1837.322] (-1834.899) (-1839.937) * (-1835.966) [-1834.561] (-1835.584) (-1837.263) -- 0:01:40
566000 -- (-1833.570) (-1835.151) (-1840.588) [-1834.209] * (-1836.239) (-1832.486) (-1839.676) [-1835.651] -- 0:01:41
566500 -- (-1838.581) (-1839.384) (-1837.200) [-1834.260] * [-1835.718] (-1835.678) (-1835.186) (-1837.023) -- 0:01:41
567000 -- (-1833.679) (-1837.780) [-1834.157] (-1834.024) * (-1839.553) [-1832.153] (-1844.020) (-1836.939) -- 0:01:40
567500 -- [-1830.145] (-1842.442) (-1834.562) (-1835.385) * (-1835.613) (-1832.931) (-1831.441) [-1833.847] -- 0:01:40
568000 -- (-1836.493) (-1840.740) (-1831.835) [-1831.712] * (-1832.382) [-1840.832] (-1834.762) (-1830.352) -- 0:01:40
568500 -- [-1834.787] (-1833.746) (-1832.223) (-1831.890) * (-1834.719) (-1839.499) [-1838.273] (-1836.306) -- 0:01:40
569000 -- (-1832.357) [-1833.324] (-1836.850) (-1835.127) * (-1839.889) (-1837.528) (-1837.051) [-1830.768] -- 0:01:39
569500 -- (-1835.539) [-1836.215] (-1836.925) (-1844.113) * (-1847.073) (-1836.527) [-1835.734] (-1835.006) -- 0:01:39
570000 -- (-1831.512) [-1835.398] (-1834.011) (-1839.351) * (-1843.831) (-1835.418) [-1837.322] (-1834.415) -- 0:01:40
Average standard deviation of split frequencies: 0.000000
570500 -- [-1836.036] (-1838.313) (-1840.802) (-1835.076) * [-1836.434] (-1839.099) (-1833.820) (-1838.041) -- 0:01:40
571000 -- [-1836.990] (-1846.980) (-1837.150) (-1832.557) * (-1833.123) [-1835.540] (-1834.851) (-1832.973) -- 0:01:39
571500 -- (-1833.474) (-1842.444) (-1842.433) [-1834.647] * (-1831.793) (-1837.406) [-1837.312] (-1833.842) -- 0:01:39
572000 -- [-1834.563] (-1836.039) (-1835.610) (-1838.780) * (-1836.111) (-1834.471) (-1837.379) [-1837.725] -- 0:01:39
572500 -- (-1834.401) [-1832.307] (-1834.645) (-1831.803) * (-1834.018) (-1837.325) (-1836.659) [-1838.047] -- 0:01:39
573000 -- [-1836.707] (-1840.162) (-1837.893) (-1838.172) * [-1832.202] (-1837.019) (-1834.119) (-1832.903) -- 0:01:39
573500 -- (-1838.098) (-1837.205) [-1837.188] (-1838.637) * (-1836.111) [-1837.026] (-1841.189) (-1836.792) -- 0:01:38
574000 -- [-1832.032] (-1847.798) (-1839.935) (-1835.560) * [-1831.945] (-1832.120) (-1829.913) (-1841.155) -- 0:01:38
574500 -- (-1833.792) [-1835.412] (-1838.610) (-1839.941) * [-1833.932] (-1831.659) (-1841.478) (-1841.181) -- 0:01:39
575000 -- (-1831.353) (-1838.755) (-1838.285) [-1834.075] * [-1835.456] (-1834.063) (-1839.353) (-1841.711) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
575500 -- (-1835.616) [-1840.468] (-1836.008) (-1830.427) * (-1835.285) [-1836.688] (-1833.071) (-1838.857) -- 0:01:38
576000 -- (-1837.517) (-1839.621) (-1838.931) [-1834.822] * [-1834.830] (-1838.358) (-1834.301) (-1837.796) -- 0:01:38
576500 -- (-1839.323) (-1842.531) (-1842.651) [-1834.942] * (-1833.811) (-1834.566) [-1838.360] (-1842.355) -- 0:01:38
577000 -- (-1842.976) [-1836.051] (-1843.696) (-1838.087) * (-1842.757) (-1833.738) (-1838.301) [-1838.043] -- 0:01:38
577500 -- (-1832.177) (-1836.571) (-1854.581) [-1837.501] * [-1840.622] (-1837.089) (-1835.189) (-1835.936) -- 0:01:38
578000 -- [-1836.920] (-1839.597) (-1834.070) (-1833.875) * [-1832.293] (-1834.666) (-1834.706) (-1840.389) -- 0:01:37
578500 -- (-1834.936) (-1839.789) (-1837.533) [-1831.336] * (-1840.194) [-1836.394] (-1842.454) (-1834.397) -- 0:01:38
579000 -- (-1838.896) [-1835.141] (-1836.021) (-1836.298) * [-1832.853] (-1836.919) (-1835.387) (-1837.186) -- 0:01:38
579500 -- (-1836.304) [-1831.813] (-1839.977) (-1835.976) * (-1837.985) (-1839.013) [-1832.665] (-1839.436) -- 0:01:37
580000 -- (-1842.838) (-1835.751) (-1838.468) [-1833.610] * [-1835.426] (-1835.389) (-1832.800) (-1837.885) -- 0:01:37
Average standard deviation of split frequencies: 0.000000
580500 -- (-1833.317) (-1837.710) [-1837.825] (-1829.082) * (-1837.658) [-1839.376] (-1832.022) (-1839.735) -- 0:01:37
581000 -- (-1835.331) (-1837.414) [-1840.417] (-1839.927) * (-1841.290) (-1834.976) (-1831.021) [-1834.383] -- 0:01:37
581500 -- [-1837.478] (-1835.307) (-1836.006) (-1840.644) * (-1838.254) (-1836.913) [-1832.167] (-1834.689) -- 0:01:37
582000 -- (-1835.612) (-1837.431) (-1836.567) [-1835.166] * [-1839.673] (-1828.880) (-1833.146) (-1833.317) -- 0:01:36
582500 -- (-1837.167) (-1838.084) [-1836.673] (-1833.206) * [-1837.712] (-1833.260) (-1835.615) (-1832.400) -- 0:01:36
583000 -- (-1835.009) (-1839.117) (-1834.904) [-1833.317] * (-1835.269) (-1837.079) (-1835.249) [-1835.289] -- 0:01:37
583500 -- (-1839.064) (-1835.495) (-1836.045) [-1835.591] * (-1835.871) [-1835.695] (-1834.234) (-1834.640) -- 0:01:37
584000 -- (-1837.799) (-1833.979) [-1833.851] (-1841.719) * (-1837.233) [-1832.057] (-1842.023) (-1840.221) -- 0:01:36
584500 -- (-1835.920) (-1834.616) [-1837.541] (-1835.115) * (-1836.468) (-1844.081) (-1841.095) [-1836.517] -- 0:01:36
585000 -- (-1841.031) [-1835.774] (-1834.543) (-1839.203) * (-1833.816) [-1833.707] (-1837.479) (-1838.978) -- 0:01:36
Average standard deviation of split frequencies: 0.000000
585500 -- (-1846.710) (-1830.484) (-1830.851) [-1838.767] * [-1838.112] (-1832.554) (-1836.099) (-1846.679) -- 0:01:36
586000 -- (-1843.466) [-1836.438] (-1836.736) (-1833.808) * (-1834.434) (-1842.350) [-1837.826] (-1842.638) -- 0:01:36
586500 -- (-1844.210) [-1836.717] (-1841.774) (-1841.696) * (-1834.304) (-1836.419) (-1836.685) [-1836.792] -- 0:01:35
587000 -- (-1846.248) (-1830.984) (-1835.410) [-1840.375] * [-1830.879] (-1841.357) (-1837.658) (-1834.573) -- 0:01:35
587500 -- (-1835.580) (-1831.019) (-1839.287) [-1836.116] * (-1832.702) (-1840.162) [-1833.650] (-1836.342) -- 0:01:36
588000 -- (-1840.268) (-1832.282) [-1838.564] (-1830.751) * [-1833.069] (-1833.616) (-1835.876) (-1834.348) -- 0:01:35
588500 -- (-1835.422) [-1836.817] (-1834.705) (-1839.866) * [-1836.245] (-1834.831) (-1841.892) (-1836.141) -- 0:01:35
589000 -- (-1835.286) [-1840.933] (-1839.852) (-1834.754) * [-1835.312] (-1835.622) (-1835.475) (-1836.644) -- 0:01:35
589500 -- (-1843.459) [-1834.711] (-1843.453) (-1835.627) * [-1837.983] (-1838.397) (-1831.817) (-1836.523) -- 0:01:35
590000 -- (-1838.547) (-1837.433) [-1836.619] (-1836.718) * (-1834.598) (-1835.437) [-1843.307] (-1833.625) -- 0:01:35
Average standard deviation of split frequencies: 0.000000
590500 -- (-1838.684) [-1836.932] (-1845.006) (-1835.217) * [-1833.790] (-1849.984) (-1838.571) (-1835.874) -- 0:01:35
591000 -- (-1838.041) (-1832.297) (-1840.099) [-1839.854] * (-1835.094) (-1841.880) [-1833.358] (-1833.732) -- 0:01:34
591500 -- (-1840.326) [-1840.290] (-1836.031) (-1832.595) * (-1838.508) (-1840.813) [-1829.268] (-1833.365) -- 0:01:35
592000 -- (-1838.881) (-1839.404) (-1836.189) [-1837.723] * [-1835.673] (-1844.330) (-1835.099) (-1840.142) -- 0:01:35
592500 -- (-1844.918) [-1833.402] (-1836.292) (-1836.936) * (-1840.060) (-1842.458) (-1832.705) [-1833.326] -- 0:01:34
593000 -- [-1838.679] (-1838.429) (-1850.856) (-1837.809) * (-1831.188) (-1838.345) (-1836.846) [-1837.318] -- 0:01:34
593500 -- (-1836.008) (-1845.018) (-1846.586) [-1835.295] * [-1832.662] (-1835.782) (-1833.473) (-1838.010) -- 0:01:34
594000 -- (-1829.803) [-1840.301] (-1840.463) (-1833.230) * [-1833.800] (-1837.577) (-1833.827) (-1839.121) -- 0:01:34
594500 -- (-1833.199) (-1835.644) (-1841.374) [-1834.786] * (-1837.942) (-1837.848) (-1830.015) [-1830.011] -- 0:01:34
595000 -- (-1841.824) [-1831.975] (-1847.827) (-1844.765) * [-1839.301] (-1839.360) (-1835.177) (-1834.370) -- 0:01:33
Average standard deviation of split frequencies: 0.000000
595500 -- [-1835.379] (-1836.345) (-1839.484) (-1835.427) * (-1835.959) [-1840.374] (-1832.838) (-1833.678) -- 0:01:33
596000 -- (-1834.101) (-1839.296) [-1843.169] (-1835.579) * (-1832.893) (-1837.987) [-1831.698] (-1835.024) -- 0:01:34
596500 -- (-1837.644) (-1831.669) [-1837.174] (-1836.836) * (-1834.436) (-1832.551) (-1835.570) [-1833.255] -- 0:01:34
597000 -- (-1839.654) (-1832.536) [-1835.091] (-1834.550) * (-1834.035) [-1839.584] (-1837.588) (-1837.829) -- 0:01:33
597500 -- [-1831.724] (-1835.810) (-1836.281) (-1834.591) * (-1834.215) [-1834.253] (-1834.707) (-1848.048) -- 0:01:33
598000 -- (-1831.786) [-1833.244] (-1832.877) (-1834.987) * (-1838.962) (-1836.057) [-1836.786] (-1837.831) -- 0:01:33
598500 -- [-1833.622] (-1834.863) (-1834.086) (-1843.052) * (-1838.710) (-1832.848) (-1836.518) [-1834.341] -- 0:01:33
599000 -- (-1834.925) (-1836.413) (-1836.287) [-1834.348] * [-1833.703] (-1833.652) (-1835.126) (-1843.832) -- 0:01:33
599500 -- [-1836.433] (-1837.252) (-1836.924) (-1836.328) * (-1834.907) [-1836.664] (-1831.132) (-1835.005) -- 0:01:32
600000 -- (-1840.037) (-1843.041) [-1836.434] (-1838.780) * (-1834.983) (-1831.411) (-1842.402) [-1833.095] -- 0:01:32
Average standard deviation of split frequencies: 0.000000
600500 -- (-1844.728) (-1835.134) [-1834.059] (-1844.460) * (-1839.419) (-1835.508) (-1835.866) [-1829.500] -- 0:01:33
601000 -- (-1844.491) (-1837.038) [-1835.465] (-1847.451) * (-1837.846) (-1839.969) [-1832.925] (-1834.662) -- 0:01:32
601500 -- [-1833.225] (-1839.934) (-1834.291) (-1843.892) * (-1840.813) (-1838.787) (-1836.513) [-1834.886] -- 0:01:32
602000 -- (-1837.986) (-1839.660) (-1837.906) [-1840.257] * (-1836.915) (-1832.137) [-1833.268] (-1835.113) -- 0:01:32
602500 -- [-1837.312] (-1835.635) (-1836.431) (-1840.333) * (-1844.001) (-1835.597) (-1833.237) [-1838.602] -- 0:01:32
603000 -- (-1838.067) (-1833.365) [-1845.190] (-1842.950) * (-1844.600) [-1833.799] (-1840.363) (-1839.598) -- 0:01:32
603500 -- (-1837.926) [-1833.080] (-1836.759) (-1845.676) * (-1835.112) (-1837.103) (-1835.992) [-1838.614] -- 0:01:31
604000 -- (-1840.784) (-1830.853) [-1834.351] (-1844.804) * (-1838.500) [-1835.630] (-1837.889) (-1838.939) -- 0:01:31
604500 -- (-1837.087) [-1830.880] (-1834.921) (-1839.550) * (-1839.977) (-1839.482) (-1849.305) [-1840.079] -- 0:01:32
605000 -- (-1839.363) (-1834.135) (-1849.109) [-1833.125] * (-1841.446) (-1834.823) [-1837.982] (-1837.736) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
605500 -- (-1829.834) [-1837.219] (-1840.589) (-1833.966) * (-1829.974) [-1833.483] (-1837.955) (-1839.102) -- 0:01:31
606000 -- [-1831.578] (-1834.959) (-1837.753) (-1842.711) * (-1841.543) (-1833.177) (-1831.180) [-1838.422] -- 0:01:31
606500 -- (-1834.822) [-1833.787] (-1840.751) (-1835.930) * (-1836.965) (-1840.030) [-1837.289] (-1833.946) -- 0:01:31
607000 -- [-1830.228] (-1834.425) (-1837.652) (-1835.055) * [-1835.410] (-1842.471) (-1833.067) (-1830.694) -- 0:01:31
607500 -- [-1838.245] (-1839.917) (-1838.431) (-1832.883) * (-1832.239) [-1832.548] (-1852.015) (-1835.937) -- 0:01:31
608000 -- (-1846.153) (-1836.641) (-1836.968) [-1831.410] * (-1834.598) (-1832.924) (-1837.191) [-1833.644] -- 0:01:30
608500 -- (-1833.635) (-1833.703) [-1833.883] (-1834.920) * [-1838.400] (-1836.185) (-1836.719) (-1831.800) -- 0:01:30
609000 -- (-1834.758) [-1834.831] (-1831.048) (-1835.536) * (-1830.480) (-1842.753) (-1834.855) [-1837.758] -- 0:01:31
609500 -- [-1832.329] (-1836.613) (-1832.044) (-1839.668) * (-1834.306) (-1834.162) (-1833.382) [-1828.269] -- 0:01:30
610000 -- (-1835.469) [-1833.217] (-1837.477) (-1834.182) * (-1836.607) (-1837.929) [-1834.710] (-1834.247) -- 0:01:30
Average standard deviation of split frequencies: 0.000000
610500 -- (-1830.299) (-1839.994) [-1837.347] (-1834.655) * (-1837.927) (-1831.060) [-1830.823] (-1835.045) -- 0:01:30
611000 -- (-1836.374) [-1835.990] (-1838.624) (-1837.796) * [-1840.785] (-1833.973) (-1833.890) (-1836.788) -- 0:01:30
611500 -- (-1841.660) (-1836.638) [-1838.003] (-1838.323) * (-1837.628) (-1830.651) (-1833.126) [-1841.481] -- 0:01:30
612000 -- [-1841.890] (-1838.089) (-1836.830) (-1835.808) * [-1839.857] (-1838.521) (-1832.858) (-1839.189) -- 0:01:30
612500 -- (-1838.376) [-1832.712] (-1840.308) (-1833.619) * (-1836.629) [-1835.927] (-1836.282) (-1841.302) -- 0:01:29
613000 -- (-1835.727) [-1832.853] (-1830.692) (-1839.659) * [-1832.692] (-1830.575) (-1831.092) (-1844.242) -- 0:01:29
613500 -- [-1832.264] (-1834.487) (-1838.377) (-1836.615) * (-1835.658) (-1833.237) [-1833.932] (-1832.583) -- 0:01:30
614000 -- (-1833.060) (-1832.942) (-1836.809) [-1835.619] * [-1837.550] (-1837.848) (-1833.884) (-1839.006) -- 0:01:29
614500 -- [-1831.415] (-1834.574) (-1841.142) (-1840.881) * (-1832.456) (-1832.956) [-1835.628] (-1834.629) -- 0:01:29
615000 -- (-1832.069) [-1837.743] (-1834.086) (-1832.552) * (-1833.993) (-1837.683) [-1835.175] (-1834.422) -- 0:01:29
Average standard deviation of split frequencies: 0.000000
615500 -- [-1833.810] (-1834.999) (-1831.748) (-1834.785) * (-1840.194) [-1835.615] (-1842.506) (-1845.891) -- 0:01:29
616000 -- (-1834.189) (-1843.490) [-1835.947] (-1837.764) * (-1833.246) [-1838.166] (-1833.575) (-1846.597) -- 0:01:29
616500 -- (-1836.488) (-1837.064) [-1838.923] (-1838.447) * (-1840.049) (-1836.865) [-1833.594] (-1833.639) -- 0:01:28
617000 -- (-1834.294) (-1834.214) [-1836.221] (-1832.607) * (-1836.770) [-1840.224] (-1837.678) (-1836.384) -- 0:01:28
617500 -- (-1834.221) (-1834.448) [-1835.564] (-1840.903) * (-1840.013) (-1846.362) [-1836.441] (-1835.305) -- 0:01:29
618000 -- (-1836.402) (-1839.453) [-1833.465] (-1836.504) * (-1844.082) (-1837.253) (-1839.027) [-1836.325] -- 0:01:29
618500 -- (-1832.699) [-1835.850] (-1837.072) (-1839.778) * (-1838.220) (-1834.406) (-1836.292) [-1839.842] -- 0:01:28
619000 -- (-1835.821) (-1841.164) [-1829.599] (-1837.417) * (-1842.241) [-1837.739] (-1833.863) (-1832.898) -- 0:01:28
619500 -- [-1835.636] (-1840.209) (-1836.731) (-1838.445) * [-1839.615] (-1839.288) (-1835.700) (-1835.646) -- 0:01:28
620000 -- (-1832.889) (-1842.357) [-1830.896] (-1838.764) * (-1836.294) (-1836.341) [-1835.882] (-1835.639) -- 0:01:28
Average standard deviation of split frequencies: 0.000000
620500 -- (-1836.817) (-1840.421) (-1835.548) [-1832.034] * [-1834.778] (-1833.609) (-1838.282) (-1841.316) -- 0:01:28
621000 -- (-1834.959) [-1832.570] (-1835.450) (-1833.869) * [-1835.313] (-1839.109) (-1831.866) (-1835.591) -- 0:01:27
621500 -- (-1841.560) (-1835.211) (-1835.734) [-1837.471] * (-1837.956) [-1840.720] (-1835.707) (-1839.073) -- 0:01:27
622000 -- (-1849.997) (-1832.924) (-1832.169) [-1834.144] * (-1837.220) (-1842.510) (-1836.505) [-1834.897] -- 0:01:28
622500 -- (-1837.510) (-1832.547) (-1835.080) [-1836.130] * (-1830.676) (-1836.192) (-1839.287) [-1838.842] -- 0:01:27
623000 -- [-1841.082] (-1838.581) (-1835.904) (-1840.043) * (-1837.143) [-1834.514] (-1832.328) (-1836.910) -- 0:01:27
623500 -- (-1837.398) (-1838.427) (-1835.267) [-1837.940] * (-1836.030) (-1839.375) (-1840.115) [-1837.966] -- 0:01:27
624000 -- (-1834.904) [-1839.157] (-1831.618) (-1834.540) * [-1831.303] (-1844.103) (-1838.053) (-1841.327) -- 0:01:27
624500 -- [-1833.369] (-1838.312) (-1832.428) (-1838.551) * (-1833.724) [-1836.207] (-1847.088) (-1838.117) -- 0:01:27
625000 -- [-1833.958] (-1841.869) (-1837.715) (-1840.601) * (-1835.716) [-1835.108] (-1837.372) (-1839.657) -- 0:01:27
Average standard deviation of split frequencies: 0.000000
625500 -- [-1838.532] (-1839.902) (-1833.570) (-1836.203) * (-1837.982) [-1836.677] (-1837.569) (-1834.716) -- 0:01:26
626000 -- (-1831.676) [-1840.032] (-1835.731) (-1836.270) * [-1841.791] (-1835.690) (-1835.890) (-1837.592) -- 0:01:27
626500 -- (-1834.519) [-1839.686] (-1842.865) (-1841.245) * (-1840.942) (-1838.912) [-1833.350] (-1834.953) -- 0:01:27
627000 -- [-1832.327] (-1838.467) (-1833.468) (-1837.226) * (-1831.328) (-1838.558) (-1841.593) [-1838.183] -- 0:01:26
627500 -- [-1835.217] (-1834.327) (-1838.144) (-1833.561) * [-1831.097] (-1837.860) (-1839.268) (-1840.554) -- 0:01:26
628000 -- (-1835.896) (-1834.573) (-1835.898) [-1835.256] * (-1841.704) (-1837.782) (-1835.325) [-1832.049] -- 0:01:26
628500 -- [-1834.263] (-1834.574) (-1833.854) (-1836.198) * (-1837.818) (-1834.679) (-1832.667) [-1831.918] -- 0:01:26
629000 -- [-1836.854] (-1838.225) (-1830.880) (-1837.491) * (-1839.574) (-1833.875) [-1836.244] (-1833.944) -- 0:01:26
629500 -- (-1835.489) [-1839.512] (-1843.350) (-1838.222) * (-1841.896) (-1843.592) [-1836.289] (-1842.271) -- 0:01:25
630000 -- (-1839.657) (-1836.511) [-1836.644] (-1836.944) * (-1837.954) [-1841.108] (-1837.952) (-1838.599) -- 0:01:25
Average standard deviation of split frequencies: 0.000000
630500 -- (-1839.513) (-1836.435) [-1832.095] (-1840.318) * [-1838.507] (-1834.350) (-1836.018) (-1835.190) -- 0:01:26
631000 -- [-1833.184] (-1835.076) (-1832.069) (-1834.808) * (-1837.631) (-1840.452) [-1836.262] (-1841.042) -- 0:01:25
631500 -- [-1833.184] (-1834.680) (-1838.397) (-1839.621) * (-1839.810) [-1834.916] (-1831.793) (-1837.836) -- 0:01:25
632000 -- (-1834.075) (-1835.162) (-1833.891) [-1838.735] * (-1840.290) (-1838.913) [-1834.375] (-1834.570) -- 0:01:25
632500 -- [-1833.616] (-1837.885) (-1835.664) (-1838.696) * (-1834.244) (-1841.691) (-1839.131) [-1830.891] -- 0:01:25
633000 -- [-1836.526] (-1840.143) (-1838.950) (-1836.240) * [-1835.230] (-1839.061) (-1838.726) (-1835.900) -- 0:01:25
633500 -- (-1838.996) (-1839.129) (-1835.846) [-1835.447] * (-1834.195) [-1835.505] (-1847.783) (-1838.096) -- 0:01:25
634000 -- [-1840.250] (-1835.574) (-1833.180) (-1833.804) * [-1836.380] (-1830.184) (-1845.123) (-1838.451) -- 0:01:24
634500 -- (-1839.460) (-1841.848) [-1832.646] (-1832.755) * (-1834.570) [-1836.551] (-1841.943) (-1840.721) -- 0:01:25
635000 -- (-1832.984) (-1831.614) [-1833.660] (-1833.124) * (-1835.258) (-1838.668) [-1836.050] (-1842.566) -- 0:01:25
Average standard deviation of split frequencies: 0.000000
635500 -- [-1832.894] (-1832.349) (-1837.307) (-1834.291) * (-1835.902) [-1835.699] (-1844.490) (-1836.888) -- 0:01:24
636000 -- (-1837.300) (-1837.929) (-1834.796) [-1831.550] * [-1840.373] (-1832.452) (-1844.768) (-1840.483) -- 0:01:24
636500 -- (-1841.467) (-1833.938) [-1836.583] (-1836.401) * (-1831.206) [-1835.973] (-1836.920) (-1843.938) -- 0:01:24
637000 -- (-1838.335) [-1832.241] (-1836.968) (-1833.801) * (-1838.210) (-1837.595) [-1835.590] (-1834.594) -- 0:01:24
637500 -- (-1833.004) (-1837.588) (-1836.300) [-1839.766] * [-1833.800] (-1834.072) (-1832.810) (-1839.978) -- 0:01:24
638000 -- [-1833.188] (-1835.856) (-1835.165) (-1836.094) * (-1830.556) (-1834.539) [-1837.814] (-1836.275) -- 0:01:23
638500 -- (-1843.752) (-1836.260) [-1834.430] (-1839.260) * (-1837.894) [-1832.114] (-1833.355) (-1835.203) -- 0:01:23
639000 -- (-1836.002) (-1835.307) [-1834.377] (-1836.941) * (-1836.663) [-1836.612] (-1841.285) (-1833.986) -- 0:01:24
639500 -- (-1838.208) (-1836.607) (-1843.331) [-1840.193] * [-1840.759] (-1832.284) (-1833.736) (-1829.817) -- 0:01:23
640000 -- [-1840.430] (-1839.833) (-1842.084) (-1838.629) * (-1838.169) (-1833.829) (-1837.503) [-1830.296] -- 0:01:23
Average standard deviation of split frequencies: 0.000000
640500 -- [-1836.361] (-1836.792) (-1846.192) (-1843.925) * [-1834.707] (-1831.876) (-1837.013) (-1836.286) -- 0:01:23
641000 -- [-1836.081] (-1834.026) (-1833.800) (-1834.657) * [-1832.651] (-1834.222) (-1841.124) (-1833.216) -- 0:01:23
641500 -- (-1837.348) (-1831.735) (-1840.374) [-1836.206] * [-1838.567] (-1834.532) (-1837.647) (-1833.088) -- 0:01:23
642000 -- (-1836.683) (-1837.203) [-1834.909] (-1836.917) * [-1831.603] (-1835.388) (-1836.215) (-1835.256) -- 0:01:23
642500 -- [-1836.633] (-1837.024) (-1829.717) (-1832.190) * (-1836.258) [-1830.977] (-1839.421) (-1839.125) -- 0:01:22
643000 -- (-1837.571) (-1835.219) (-1835.655) [-1833.872] * (-1835.820) (-1836.080) (-1832.198) [-1832.981] -- 0:01:23
643500 -- [-1835.530] (-1840.106) (-1832.114) (-1838.345) * (-1834.925) (-1838.373) (-1840.041) [-1838.831] -- 0:01:23
644000 -- (-1836.072) (-1835.936) [-1837.375] (-1833.242) * (-1834.310) (-1832.611) [-1837.342] (-1839.047) -- 0:01:22
644500 -- (-1834.751) (-1846.955) (-1833.117) [-1834.367] * (-1831.978) (-1841.893) [-1833.748] (-1833.908) -- 0:01:22
645000 -- (-1837.573) (-1832.009) (-1836.657) [-1834.552] * [-1836.552] (-1838.266) (-1840.193) (-1836.917) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
645500 -- (-1834.746) (-1835.561) (-1836.575) [-1839.045] * (-1840.472) (-1835.277) [-1837.602] (-1834.693) -- 0:01:22
646000 -- [-1832.161] (-1835.392) (-1835.019) (-1834.117) * (-1835.360) [-1835.284] (-1838.156) (-1834.950) -- 0:01:22
646500 -- [-1833.372] (-1844.040) (-1835.830) (-1831.692) * (-1835.746) [-1835.078] (-1840.461) (-1839.647) -- 0:01:22
647000 -- (-1833.898) (-1838.127) (-1837.040) [-1833.014] * (-1829.597) (-1834.963) [-1833.715] (-1835.759) -- 0:01:21
647500 -- (-1837.650) (-1839.610) (-1835.872) [-1834.244] * (-1841.996) (-1828.750) (-1836.027) [-1839.306] -- 0:01:22
648000 -- [-1832.871] (-1841.025) (-1840.185) (-1835.808) * (-1841.168) (-1836.961) [-1834.791] (-1841.176) -- 0:01:22
648500 -- (-1836.276) (-1837.878) (-1844.081) [-1835.114] * (-1833.916) [-1841.567] (-1833.155) (-1840.115) -- 0:01:21
649000 -- (-1835.653) (-1837.900) (-1837.936) [-1831.896] * (-1834.948) (-1841.484) [-1836.742] (-1840.968) -- 0:01:21
649500 -- (-1833.055) (-1838.879) (-1835.901) [-1835.875] * (-1834.994) [-1839.195] (-1833.111) (-1850.906) -- 0:01:21
650000 -- (-1833.868) (-1835.469) (-1842.716) [-1836.122] * (-1833.466) (-1842.952) (-1836.987) [-1839.020] -- 0:01:21
Average standard deviation of split frequencies: 0.000000
650500 -- (-1833.969) (-1832.218) [-1836.424] (-1840.766) * (-1838.792) (-1834.022) (-1837.350) [-1837.282] -- 0:01:21
651000 -- [-1837.903] (-1843.913) (-1837.971) (-1841.280) * (-1833.740) (-1836.520) [-1834.273] (-1837.399) -- 0:01:20
651500 -- [-1837.415] (-1837.035) (-1831.554) (-1836.473) * (-1836.955) (-1847.829) [-1841.615] (-1843.346) -- 0:01:20
652000 -- (-1831.802) (-1836.378) (-1835.544) [-1833.403] * (-1834.030) (-1847.343) [-1837.386] (-1834.845) -- 0:01:21
652500 -- (-1837.730) (-1838.280) (-1834.349) [-1839.382] * (-1840.279) (-1849.527) [-1837.322] (-1835.361) -- 0:01:20
653000 -- (-1836.198) (-1834.756) (-1836.182) [-1836.470] * (-1836.102) [-1838.580] (-1837.870) (-1834.941) -- 0:01:20
653500 -- (-1838.889) (-1834.880) (-1836.859) [-1834.797] * (-1833.769) (-1843.112) [-1832.273] (-1838.441) -- 0:01:20
654000 -- (-1838.370) (-1834.958) (-1831.160) [-1836.545] * (-1838.566) (-1837.448) (-1843.391) [-1833.879] -- 0:01:20
654500 -- (-1842.301) (-1833.813) [-1832.259] (-1835.846) * (-1838.960) [-1835.831] (-1837.730) (-1833.623) -- 0:01:20
655000 -- (-1839.769) (-1835.193) [-1831.905] (-1837.172) * (-1836.243) [-1835.418] (-1839.128) (-1832.448) -- 0:01:20
Average standard deviation of split frequencies: 0.000000
655500 -- (-1832.835) (-1836.686) (-1836.039) [-1834.934] * (-1834.059) [-1839.698] (-1833.242) (-1839.107) -- 0:01:19
656000 -- (-1836.299) (-1839.716) [-1837.733] (-1843.863) * (-1838.801) [-1837.903] (-1838.803) (-1840.094) -- 0:01:20
656500 -- (-1838.239) (-1835.068) (-1842.465) [-1836.273] * (-1837.776) (-1831.771) [-1832.064] (-1832.895) -- 0:01:20
657000 -- [-1840.629] (-1834.972) (-1836.856) (-1839.150) * (-1843.678) [-1833.219] (-1844.036) (-1836.214) -- 0:01:19
657500 -- (-1847.948) (-1840.603) (-1835.253) [-1837.977] * (-1838.087) (-1832.675) [-1840.975] (-1832.604) -- 0:01:19
658000 -- (-1840.960) [-1837.051] (-1836.665) (-1841.492) * (-1833.517) (-1830.965) [-1834.913] (-1836.051) -- 0:01:19
658500 -- [-1841.704] (-1845.178) (-1847.627) (-1834.860) * [-1833.898] (-1835.007) (-1836.414) (-1832.693) -- 0:01:19
659000 -- (-1836.582) [-1838.391] (-1849.437) (-1838.425) * (-1837.349) [-1834.770] (-1837.702) (-1839.062) -- 0:01:19
659500 -- [-1834.674] (-1835.557) (-1834.975) (-1847.535) * (-1838.010) (-1833.684) (-1833.587) [-1832.264] -- 0:01:18
660000 -- [-1834.026] (-1840.751) (-1845.529) (-1836.722) * (-1841.894) (-1838.964) [-1836.645] (-1834.963) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
660500 -- (-1836.516) (-1840.920) [-1835.063] (-1836.094) * (-1838.257) (-1840.467) [-1829.921] (-1840.401) -- 0:01:19
661000 -- (-1833.308) (-1837.314) (-1840.702) [-1830.517] * (-1835.866) (-1833.888) (-1838.245) [-1829.750] -- 0:01:18
661500 -- [-1838.140] (-1840.497) (-1840.644) (-1836.788) * (-1830.798) (-1839.105) [-1834.820] (-1834.741) -- 0:01:18
662000 -- (-1831.476) [-1838.860] (-1843.636) (-1833.764) * (-1840.845) (-1837.756) (-1838.107) [-1835.026] -- 0:01:18
662500 -- [-1835.768] (-1832.199) (-1839.631) (-1832.861) * (-1838.875) (-1843.485) (-1835.732) [-1831.504] -- 0:01:18
663000 -- (-1848.256) [-1834.524] (-1833.255) (-1836.518) * (-1837.410) (-1846.788) [-1837.841] (-1839.073) -- 0:01:18
663500 -- (-1844.250) (-1837.202) [-1834.788] (-1831.391) * (-1841.613) (-1839.924) [-1834.096] (-1839.496) -- 0:01:18
664000 -- (-1841.258) [-1838.215] (-1834.024) (-1836.335) * (-1838.385) [-1834.225] (-1834.988) (-1840.752) -- 0:01:17
664500 -- [-1837.115] (-1839.345) (-1843.147) (-1832.153) * (-1836.578) [-1832.508] (-1837.062) (-1842.779) -- 0:01:18
665000 -- (-1838.181) [-1840.635] (-1834.411) (-1836.191) * (-1837.768) (-1834.228) [-1831.437] (-1836.091) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
665500 -- (-1832.494) (-1837.502) (-1837.525) [-1835.920] * [-1834.803] (-1840.337) (-1834.203) (-1838.945) -- 0:01:17
666000 -- (-1836.085) [-1837.507] (-1833.902) (-1834.100) * (-1841.201) [-1839.834] (-1837.258) (-1834.468) -- 0:01:17
666500 -- (-1836.601) (-1841.507) (-1834.454) [-1835.306] * (-1834.309) [-1838.002] (-1837.451) (-1834.848) -- 0:01:17
667000 -- (-1843.460) [-1830.652] (-1839.200) (-1837.118) * [-1833.142] (-1843.647) (-1838.605) (-1838.002) -- 0:01:17
667500 -- [-1839.623] (-1834.998) (-1842.001) (-1835.102) * (-1843.827) (-1836.771) (-1832.603) [-1834.904] -- 0:01:17
668000 -- (-1840.113) [-1835.482] (-1837.487) (-1834.335) * (-1836.114) (-1836.037) (-1838.888) [-1840.352] -- 0:01:17
668500 -- (-1844.121) (-1839.265) (-1842.185) [-1842.451] * (-1836.515) (-1845.747) (-1832.947) [-1832.828] -- 0:01:16
669000 -- (-1837.853) (-1835.304) (-1837.754) [-1832.089] * (-1846.369) [-1836.368] (-1830.038) (-1841.130) -- 0:01:17
669500 -- (-1841.268) (-1835.931) (-1841.816) [-1836.250] * [-1836.263] (-1837.412) (-1842.194) (-1842.765) -- 0:01:17
670000 -- (-1840.115) [-1835.500] (-1838.231) (-1833.680) * (-1842.235) (-1834.493) (-1831.965) [-1837.106] -- 0:01:16
Average standard deviation of split frequencies: 0.000000
670500 -- [-1841.716] (-1835.068) (-1838.651) (-1837.812) * (-1838.148) (-1832.999) [-1836.808] (-1840.057) -- 0:01:16
671000 -- (-1834.736) (-1836.563) (-1835.678) [-1836.430] * (-1834.656) (-1836.638) [-1833.686] (-1833.838) -- 0:01:16
671500 -- (-1839.748) (-1841.226) (-1834.421) [-1832.197] * (-1832.717) (-1839.085) (-1841.699) [-1833.339] -- 0:01:16
672000 -- (-1839.889) (-1835.992) (-1835.799) [-1836.599] * [-1832.227] (-1832.952) (-1843.562) (-1830.146) -- 0:01:16
672500 -- (-1839.995) [-1833.611] (-1842.363) (-1836.851) * [-1834.362] (-1836.023) (-1843.004) (-1841.072) -- 0:01:15
673000 -- (-1843.266) (-1835.962) [-1836.163] (-1840.864) * (-1834.496) [-1837.475] (-1837.554) (-1839.210) -- 0:01:16
673500 -- (-1840.639) (-1834.977) [-1836.958] (-1842.078) * (-1837.052) (-1843.430) [-1833.642] (-1836.287) -- 0:01:16
674000 -- (-1837.642) (-1833.478) [-1835.275] (-1836.754) * (-1838.936) [-1833.655] (-1837.162) (-1842.285) -- 0:01:15
674500 -- (-1840.891) (-1840.407) (-1836.654) [-1835.071] * (-1844.731) [-1837.081] (-1832.297) (-1835.965) -- 0:01:15
675000 -- (-1834.924) (-1845.959) [-1835.161] (-1841.167) * [-1839.592] (-1842.897) (-1831.192) (-1839.143) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
675500 -- [-1839.837] (-1836.800) (-1833.007) (-1841.010) * (-1835.971) [-1835.521] (-1839.145) (-1832.103) -- 0:01:15
676000 -- (-1837.663) (-1834.148) [-1840.587] (-1834.520) * (-1837.459) [-1838.573] (-1845.866) (-1835.453) -- 0:01:15
676500 -- [-1835.482] (-1836.370) (-1842.413) (-1834.998) * (-1838.959) (-1836.757) [-1834.465] (-1830.581) -- 0:01:15
677000 -- (-1832.862) [-1838.053] (-1835.528) (-1831.410) * [-1836.279] (-1842.142) (-1833.576) (-1833.040) -- 0:01:14
677500 -- (-1837.610) (-1834.660) [-1833.086] (-1835.962) * (-1840.927) (-1838.033) [-1831.132] (-1834.008) -- 0:01:15
678000 -- (-1839.216) (-1834.103) (-1837.265) [-1836.856] * (-1838.380) (-1836.773) [-1838.214] (-1835.107) -- 0:01:15
678500 -- [-1837.848] (-1836.536) (-1837.163) (-1841.412) * (-1834.480) (-1834.758) [-1839.690] (-1838.842) -- 0:01:14
679000 -- (-1838.200) (-1831.932) [-1838.571] (-1848.415) * (-1837.315) (-1841.073) [-1833.637] (-1828.990) -- 0:01:14
679500 -- (-1835.338) (-1837.844) [-1832.730] (-1837.841) * (-1836.701) (-1835.867) (-1830.996) [-1831.262] -- 0:01:14
680000 -- [-1834.527] (-1834.789) (-1834.026) (-1838.099) * (-1840.226) (-1839.027) (-1838.856) [-1833.757] -- 0:01:14
Average standard deviation of split frequencies: 0.000000
680500 -- (-1835.831) (-1839.528) (-1831.438) [-1834.744] * (-1834.668) (-1830.462) [-1833.552] (-1842.690) -- 0:01:14
681000 -- (-1832.318) (-1830.152) (-1844.276) [-1830.784] * (-1837.243) (-1838.497) [-1835.432] (-1836.642) -- 0:01:14
681500 -- [-1835.565] (-1832.721) (-1837.402) (-1840.724) * (-1832.243) [-1834.629] (-1837.145) (-1839.081) -- 0:01:13
682000 -- (-1831.807) (-1834.564) (-1832.102) [-1830.057] * (-1839.919) (-1835.329) [-1838.004] (-1835.091) -- 0:01:14
682500 -- (-1835.881) [-1836.544] (-1834.545) (-1841.867) * (-1844.185) (-1833.981) [-1835.468] (-1836.584) -- 0:01:13
683000 -- (-1841.424) (-1835.985) [-1838.888] (-1840.564) * (-1839.759) (-1835.016) (-1834.921) [-1837.031] -- 0:01:13
683500 -- (-1831.892) [-1840.646] (-1836.987) (-1836.664) * (-1836.358) (-1841.490) (-1833.940) [-1832.496] -- 0:01:13
684000 -- (-1835.524) [-1834.100] (-1834.029) (-1839.291) * (-1833.922) (-1839.625) [-1835.660] (-1835.834) -- 0:01:13
684500 -- (-1835.784) [-1832.806] (-1832.557) (-1836.962) * (-1831.689) (-1832.894) [-1836.305] (-1837.406) -- 0:01:13
685000 -- [-1832.606] (-1838.043) (-1840.022) (-1836.203) * (-1831.757) (-1832.601) [-1836.931] (-1840.432) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
685500 -- (-1838.468) [-1837.756] (-1837.891) (-1846.923) * (-1835.554) (-1835.301) (-1837.435) [-1836.377] -- 0:01:12
686000 -- (-1840.751) [-1836.232] (-1834.459) (-1841.385) * (-1830.912) (-1833.310) [-1835.713] (-1834.368) -- 0:01:13
686500 -- [-1834.813] (-1837.473) (-1837.652) (-1836.331) * (-1833.084) (-1833.126) [-1838.808] (-1835.867) -- 0:01:13
687000 -- (-1834.551) (-1834.554) (-1838.372) [-1834.151] * [-1834.412] (-1834.420) (-1848.517) (-1835.941) -- 0:01:12
687500 -- (-1835.647) (-1836.470) (-1835.140) [-1838.758] * [-1833.814] (-1836.591) (-1832.784) (-1840.987) -- 0:01:12
688000 -- [-1833.936] (-1834.051) (-1834.908) (-1837.603) * (-1838.964) [-1845.923] (-1837.794) (-1834.163) -- 0:01:12
688500 -- (-1839.358) [-1831.440] (-1837.591) (-1834.359) * (-1831.273) (-1839.791) (-1841.748) [-1834.699] -- 0:01:12
689000 -- (-1831.646) [-1833.080] (-1840.386) (-1837.557) * (-1832.628) (-1833.974) [-1834.335] (-1830.368) -- 0:01:12
689500 -- [-1834.604] (-1831.467) (-1835.861) (-1838.935) * [-1835.678] (-1836.345) (-1837.322) (-1837.222) -- 0:01:12
690000 -- (-1834.104) (-1834.974) (-1839.423) [-1833.746] * (-1837.242) (-1836.506) [-1833.944] (-1836.390) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
690500 -- [-1834.552] (-1834.359) (-1837.024) (-1836.390) * (-1839.949) [-1839.917] (-1842.025) (-1843.673) -- 0:01:12
691000 -- (-1833.384) (-1842.309) [-1834.968] (-1835.092) * (-1836.086) (-1836.823) [-1835.653] (-1833.154) -- 0:01:11
691500 -- [-1835.911] (-1832.532) (-1843.841) (-1833.394) * (-1840.375) (-1829.430) (-1837.664) [-1843.454] -- 0:01:11
692000 -- (-1833.524) [-1839.842] (-1833.267) (-1835.429) * (-1830.635) (-1839.052) (-1833.844) [-1835.206] -- 0:01:11
692500 -- (-1838.304) (-1841.064) (-1843.928) [-1832.258] * (-1837.547) (-1840.375) [-1834.488] (-1838.743) -- 0:01:11
693000 -- (-1839.273) (-1839.755) [-1841.958] (-1839.294) * (-1837.570) (-1832.744) [-1834.644] (-1833.987) -- 0:01:11
693500 -- (-1837.628) (-1836.584) [-1837.230] (-1836.356) * [-1830.542] (-1837.872) (-1840.343) (-1844.320) -- 0:01:11
694000 -- [-1836.398] (-1836.625) (-1839.494) (-1839.184) * [-1833.817] (-1835.589) (-1835.423) (-1836.817) -- 0:01:10
694500 -- (-1836.303) (-1832.627) (-1838.531) [-1834.566] * (-1834.486) [-1836.234] (-1838.373) (-1833.011) -- 0:01:11
695000 -- (-1834.108) [-1833.193] (-1835.771) (-1838.023) * (-1841.230) (-1836.267) (-1839.940) [-1831.417] -- 0:01:11
Average standard deviation of split frequencies: 0.000000
695500 -- (-1833.804) [-1834.480] (-1836.624) (-1840.277) * (-1846.361) (-1835.209) (-1836.559) [-1834.312] -- 0:01:10
696000 -- [-1838.576] (-1838.093) (-1840.704) (-1833.716) * (-1842.507) (-1835.113) (-1836.726) [-1840.322] -- 0:01:10
696500 -- (-1842.361) (-1835.843) (-1837.411) [-1841.449] * (-1835.026) (-1835.992) [-1837.968] (-1840.100) -- 0:01:10
697000 -- (-1840.906) (-1831.714) [-1835.305] (-1842.235) * [-1832.052] (-1831.796) (-1838.201) (-1838.581) -- 0:01:10
697500 -- (-1839.188) (-1833.130) [-1833.529] (-1840.252) * (-1833.149) [-1831.704] (-1840.688) (-1840.278) -- 0:01:10
698000 -- (-1834.369) [-1833.683] (-1841.193) (-1837.562) * (-1836.688) [-1839.377] (-1837.482) (-1835.226) -- 0:01:10
698500 -- (-1833.369) [-1834.337] (-1836.268) (-1835.052) * (-1834.581) [-1832.659] (-1833.532) (-1843.845) -- 0:01:09
699000 -- (-1836.971) (-1831.894) [-1832.458] (-1836.033) * (-1834.476) (-1837.689) (-1835.307) [-1836.704] -- 0:01:10
699500 -- [-1833.863] (-1838.987) (-1835.653) (-1831.361) * (-1836.189) (-1830.097) (-1835.072) [-1833.887] -- 0:01:10
700000 -- (-1830.374) (-1835.561) [-1834.458] (-1834.861) * (-1833.418) (-1833.001) (-1841.136) [-1835.967] -- 0:01:09
Average standard deviation of split frequencies: 0.000000
700500 -- [-1833.841] (-1833.871) (-1841.273) (-1831.592) * (-1838.950) (-1833.212) (-1844.743) [-1836.984] -- 0:01:09
701000 -- (-1831.521) [-1833.996] (-1835.070) (-1840.652) * (-1833.373) [-1837.623] (-1850.704) (-1838.539) -- 0:01:09
701500 -- (-1836.877) (-1836.566) [-1835.264] (-1840.289) * (-1834.500) [-1836.084] (-1842.623) (-1836.422) -- 0:01:09
702000 -- [-1834.465] (-1839.195) (-1832.722) (-1842.207) * (-1833.797) (-1832.673) (-1838.817) [-1836.843] -- 0:01:09
702500 -- (-1835.984) [-1836.657] (-1840.410) (-1841.380) * (-1837.881) [-1836.677] (-1835.804) (-1837.445) -- 0:01:09
703000 -- (-1833.613) (-1839.065) (-1845.388) [-1835.278] * (-1836.177) (-1834.303) [-1837.182] (-1835.285) -- 0:01:08
703500 -- (-1835.355) [-1837.479] (-1833.660) (-1833.675) * (-1834.584) [-1834.914] (-1833.796) (-1838.320) -- 0:01:09
704000 -- (-1834.318) [-1832.901] (-1835.643) (-1841.689) * (-1838.240) (-1838.126) (-1839.144) [-1841.804] -- 0:01:08
704500 -- [-1840.204] (-1836.803) (-1836.288) (-1833.194) * (-1837.140) (-1840.826) (-1840.883) [-1835.836] -- 0:01:08
705000 -- (-1834.477) (-1842.377) [-1841.311] (-1837.785) * (-1833.223) (-1839.932) [-1844.675] (-1834.439) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
705500 -- (-1837.084) (-1832.651) [-1840.126] (-1837.925) * (-1831.606) [-1831.633] (-1837.019) (-1838.574) -- 0:01:08
706000 -- (-1833.749) [-1833.993] (-1839.418) (-1838.292) * (-1843.976) [-1832.116] (-1834.373) (-1835.534) -- 0:01:08
706500 -- [-1830.296] (-1837.761) (-1839.278) (-1834.513) * (-1834.465) (-1840.042) (-1839.049) [-1838.270] -- 0:01:08
707000 -- (-1830.262) (-1841.995) (-1842.773) [-1835.874] * [-1831.947] (-1833.681) (-1841.524) (-1840.433) -- 0:01:07
707500 -- [-1829.777] (-1837.532) (-1837.596) (-1848.837) * (-1834.614) (-1836.361) [-1838.975] (-1835.121) -- 0:01:08
708000 -- [-1839.091] (-1832.254) (-1840.389) (-1839.303) * [-1836.265] (-1832.859) (-1843.876) (-1840.578) -- 0:01:08
708500 -- (-1840.103) (-1839.953) [-1836.101] (-1835.094) * (-1837.388) [-1835.481] (-1835.963) (-1832.812) -- 0:01:07
709000 -- (-1843.506) [-1834.909] (-1843.083) (-1837.642) * [-1831.945] (-1843.477) (-1840.041) (-1836.297) -- 0:01:07
709500 -- (-1840.325) (-1835.411) (-1834.399) [-1835.402] * [-1839.329] (-1833.234) (-1838.590) (-1839.100) -- 0:01:07
710000 -- (-1833.795) (-1842.854) [-1843.037] (-1833.844) * (-1828.751) [-1831.185] (-1840.995) (-1833.332) -- 0:01:07
Average standard deviation of split frequencies: 0.000000
710500 -- (-1838.946) (-1837.206) (-1840.783) [-1833.364] * (-1833.962) [-1842.271] (-1832.403) (-1831.843) -- 0:01:07
711000 -- (-1838.693) [-1836.189] (-1836.454) (-1841.121) * [-1835.392] (-1840.010) (-1834.938) (-1831.668) -- 0:01:07
711500 -- [-1835.547] (-1836.755) (-1835.570) (-1838.448) * (-1842.865) (-1837.526) [-1829.744] (-1836.834) -- 0:01:06
712000 -- (-1831.423) (-1839.751) (-1832.167) [-1835.447] * (-1839.729) (-1836.671) [-1840.578] (-1837.861) -- 0:01:07
712500 -- (-1841.575) (-1837.888) [-1838.812] (-1836.568) * (-1835.677) (-1834.318) [-1831.974] (-1838.978) -- 0:01:06
713000 -- (-1847.830) (-1840.496) (-1832.327) [-1832.295] * (-1837.330) (-1840.659) (-1836.387) [-1833.853] -- 0:01:06
713500 -- (-1841.100) [-1838.599] (-1837.654) (-1832.295) * (-1835.620) (-1842.148) (-1836.744) [-1837.756] -- 0:01:06
714000 -- (-1845.448) (-1835.606) [-1833.512] (-1837.275) * (-1847.783) (-1834.987) [-1842.908] (-1839.499) -- 0:01:06
714500 -- (-1841.538) [-1837.694] (-1845.264) (-1834.756) * (-1840.441) [-1831.826] (-1842.308) (-1835.401) -- 0:01:06
715000 -- (-1840.938) (-1836.021) [-1834.294] (-1830.728) * [-1841.685] (-1838.039) (-1831.559) (-1837.513) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
715500 -- (-1835.111) (-1840.666) (-1834.590) [-1834.943] * (-1842.660) (-1834.659) (-1839.661) [-1834.731] -- 0:01:06
716000 -- (-1841.350) [-1832.464] (-1839.589) (-1843.542) * (-1845.802) (-1838.228) (-1835.499) [-1839.452] -- 0:01:06
716500 -- (-1831.286) [-1833.531] (-1839.031) (-1841.330) * (-1839.868) (-1838.047) (-1832.245) [-1834.630] -- 0:01:06
717000 -- (-1838.176) [-1836.069] (-1836.577) (-1839.891) * (-1836.243) (-1832.290) [-1834.706] (-1837.757) -- 0:01:05
717500 -- [-1841.239] (-1836.077) (-1835.695) (-1839.742) * (-1838.486) (-1837.412) [-1837.827] (-1837.677) -- 0:01:05
718000 -- (-1835.474) (-1837.465) (-1841.747) [-1836.091] * [-1836.463] (-1841.649) (-1833.559) (-1832.995) -- 0:01:05
718500 -- [-1836.838] (-1845.778) (-1839.689) (-1840.719) * (-1833.399) (-1838.997) (-1843.716) [-1831.032] -- 0:01:05
719000 -- [-1831.557] (-1838.969) (-1838.308) (-1834.138) * [-1833.638] (-1838.917) (-1833.051) (-1837.325) -- 0:01:05
719500 -- (-1844.305) (-1836.455) [-1835.017] (-1835.878) * (-1835.714) [-1832.747] (-1840.015) (-1841.314) -- 0:01:05
720000 -- (-1839.716) (-1836.974) [-1831.674] (-1836.975) * (-1846.301) [-1830.867] (-1835.791) (-1836.850) -- 0:01:04
Average standard deviation of split frequencies: 0.000000
720500 -- (-1837.680) [-1832.926] (-1837.860) (-1834.390) * [-1841.996] (-1831.043) (-1836.672) (-1837.529) -- 0:01:05
721000 -- [-1840.761] (-1836.242) (-1837.894) (-1837.909) * (-1835.431) (-1837.298) (-1848.797) [-1839.672] -- 0:01:05
721500 -- (-1841.087) (-1837.371) (-1835.409) [-1837.199] * (-1831.110) (-1835.414) (-1835.733) [-1835.504] -- 0:01:04
722000 -- [-1840.920] (-1832.783) (-1843.398) (-1834.089) * [-1832.951] (-1835.042) (-1839.915) (-1839.243) -- 0:01:04
722500 -- (-1835.568) [-1839.036] (-1839.054) (-1835.668) * (-1833.750) (-1830.802) [-1833.730] (-1839.774) -- 0:01:04
723000 -- (-1833.141) (-1839.724) [-1835.190] (-1842.177) * (-1837.764) (-1834.696) (-1836.571) [-1832.056] -- 0:01:04
723500 -- [-1834.437] (-1836.125) (-1833.155) (-1846.220) * (-1835.878) (-1835.968) (-1841.262) [-1836.779] -- 0:01:04
724000 -- (-1837.555) (-1834.576) [-1833.175] (-1839.729) * (-1841.412) (-1831.770) [-1836.244] (-1830.663) -- 0:01:04
724500 -- (-1837.855) [-1835.715] (-1841.992) (-1837.014) * (-1832.068) (-1846.752) (-1831.895) [-1834.710] -- 0:01:04
725000 -- (-1840.380) (-1844.721) [-1835.423] (-1831.459) * (-1834.458) (-1834.744) (-1835.548) [-1832.004] -- 0:01:04
Average standard deviation of split frequencies: 0.000000
725500 -- [-1836.387] (-1839.946) (-1839.828) (-1843.433) * (-1841.400) (-1837.249) (-1836.298) [-1836.254] -- 0:01:03
726000 -- (-1832.108) (-1840.299) [-1835.394] (-1831.773) * [-1833.081] (-1840.893) (-1838.392) (-1836.631) -- 0:01:03
726500 -- [-1831.770] (-1835.560) (-1832.985) (-1839.346) * [-1836.359] (-1835.062) (-1833.323) (-1836.612) -- 0:01:03
727000 -- (-1836.281) (-1830.343) (-1836.427) [-1837.311] * (-1836.758) (-1832.719) (-1835.899) [-1837.109] -- 0:01:03
727500 -- [-1835.411] (-1834.915) (-1842.732) (-1838.438) * (-1838.034) (-1832.799) [-1836.293] (-1835.412) -- 0:01:03
728000 -- (-1832.107) [-1842.227] (-1845.047) (-1837.270) * (-1835.859) (-1835.116) (-1844.348) [-1834.519] -- 0:01:03
728500 -- [-1839.915] (-1834.121) (-1839.317) (-1835.150) * (-1841.865) [-1833.298] (-1834.244) (-1842.375) -- 0:01:02
729000 -- (-1836.511) [-1836.116] (-1835.819) (-1833.838) * (-1838.589) [-1831.003] (-1834.562) (-1833.792) -- 0:01:03
729500 -- [-1835.674] (-1834.601) (-1844.873) (-1834.463) * [-1835.654] (-1836.940) (-1831.288) (-1844.581) -- 0:01:03
730000 -- (-1835.632) (-1841.898) [-1838.126] (-1831.807) * (-1838.897) [-1834.914] (-1837.137) (-1836.283) -- 0:01:02
Average standard deviation of split frequencies: 0.000000
730500 -- [-1835.524] (-1839.789) (-1833.378) (-1832.998) * [-1838.149] (-1840.030) (-1834.298) (-1833.775) -- 0:01:02
731000 -- (-1839.734) (-1840.507) [-1841.549] (-1836.075) * (-1835.448) (-1835.758) (-1841.995) [-1831.947] -- 0:01:02
731500 -- (-1832.037) [-1837.973] (-1838.403) (-1833.002) * (-1830.285) (-1833.997) (-1836.968) [-1833.804] -- 0:01:02
732000 -- (-1835.409) [-1837.470] (-1837.139) (-1840.784) * [-1832.105] (-1829.464) (-1837.624) (-1839.545) -- 0:01:02
732500 -- (-1837.437) (-1838.851) [-1840.466] (-1831.541) * (-1835.833) [-1834.391] (-1838.235) (-1831.362) -- 0:01:02
733000 -- (-1832.403) (-1834.557) [-1837.600] (-1839.772) * [-1834.663] (-1835.236) (-1829.793) (-1832.847) -- 0:01:01
733500 -- (-1834.226) [-1832.370] (-1836.160) (-1834.657) * [-1836.170] (-1837.041) (-1835.798) (-1838.724) -- 0:01:02
734000 -- (-1831.422) (-1835.614) [-1835.027] (-1838.964) * (-1842.771) (-1832.328) [-1837.075] (-1832.466) -- 0:01:01
734500 -- (-1835.110) (-1831.098) (-1839.860) [-1835.232] * [-1831.642] (-1833.265) (-1833.821) (-1834.221) -- 0:01:01
735000 -- (-1834.177) (-1829.937) (-1836.462) [-1839.382] * (-1833.224) [-1834.896] (-1844.271) (-1833.140) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
735500 -- (-1837.707) (-1831.534) [-1835.819] (-1841.272) * (-1836.333) (-1834.699) [-1837.632] (-1838.048) -- 0:01:01
736000 -- (-1830.685) (-1836.365) (-1836.214) [-1836.811] * (-1834.033) [-1836.391] (-1840.903) (-1835.278) -- 0:01:01
736500 -- (-1834.734) (-1836.506) [-1830.708] (-1839.146) * [-1836.995] (-1841.000) (-1830.896) (-1837.302) -- 0:01:01
737000 -- (-1838.380) (-1832.453) [-1835.690] (-1836.513) * (-1835.567) (-1837.961) [-1833.712] (-1838.852) -- 0:01:01
737500 -- [-1837.262] (-1836.174) (-1837.585) (-1843.819) * (-1839.753) [-1835.749] (-1836.411) (-1836.359) -- 0:01:01
738000 -- [-1837.133] (-1839.815) (-1833.256) (-1840.157) * [-1838.316] (-1835.456) (-1832.035) (-1831.468) -- 0:01:01
738500 -- (-1835.979) [-1841.597] (-1839.127) (-1834.689) * (-1841.934) (-1837.165) [-1832.892] (-1836.821) -- 0:01:00
739000 -- (-1835.316) [-1834.261] (-1836.347) (-1834.408) * [-1838.423] (-1834.955) (-1831.698) (-1835.058) -- 0:01:00
739500 -- (-1836.561) [-1835.198] (-1836.006) (-1842.116) * (-1839.222) (-1837.997) [-1832.559] (-1841.958) -- 0:01:00
740000 -- [-1830.243] (-1835.494) (-1832.900) (-1839.196) * [-1832.811] (-1830.994) (-1839.418) (-1836.799) -- 0:01:00
Average standard deviation of split frequencies: 0.000000
740500 -- [-1830.403] (-1840.094) (-1835.941) (-1837.179) * (-1843.245) [-1831.212] (-1832.922) (-1842.417) -- 0:01:00
741000 -- [-1833.607] (-1834.040) (-1833.606) (-1836.758) * (-1832.332) (-1835.594) (-1838.047) [-1834.753] -- 0:01:00
741500 -- (-1840.136) (-1839.317) (-1844.411) [-1831.632] * [-1835.325] (-1840.821) (-1838.198) (-1836.313) -- 0:00:59
742000 -- (-1841.030) (-1833.692) (-1840.297) [-1832.265] * [-1831.971] (-1836.161) (-1837.647) (-1836.964) -- 0:01:00
742500 -- [-1835.025] (-1841.296) (-1842.838) (-1837.639) * (-1837.558) (-1831.512) [-1838.195] (-1830.605) -- 0:00:59
743000 -- [-1835.466] (-1831.568) (-1838.318) (-1844.725) * [-1835.095] (-1837.772) (-1836.648) (-1838.863) -- 0:00:59
743500 -- (-1839.939) (-1832.882) [-1835.161] (-1837.639) * (-1840.508) (-1835.671) [-1833.873] (-1836.832) -- 0:00:59
744000 -- (-1834.282) (-1831.943) [-1836.465] (-1834.837) * [-1842.121] (-1840.408) (-1842.625) (-1834.410) -- 0:00:59
744500 -- (-1838.474) (-1830.604) (-1835.971) [-1833.726] * (-1834.908) [-1838.631] (-1836.683) (-1832.787) -- 0:00:59
745000 -- [-1833.576] (-1835.747) (-1840.890) (-1838.715) * (-1840.563) (-1835.174) [-1840.870] (-1837.213) -- 0:00:59
Average standard deviation of split frequencies: 0.000000
745500 -- (-1836.522) [-1837.601] (-1838.969) (-1837.655) * (-1831.486) (-1832.804) [-1834.704] (-1837.833) -- 0:00:59
746000 -- (-1841.950) (-1835.011) (-1839.911) [-1831.181] * [-1836.883] (-1834.260) (-1831.210) (-1836.938) -- 0:00:59
746500 -- (-1834.752) (-1832.103) (-1833.104) [-1835.622] * (-1836.183) (-1843.794) (-1840.417) [-1834.492] -- 0:00:59
747000 -- (-1838.258) (-1837.816) (-1836.649) [-1833.224] * [-1829.869] (-1838.829) (-1840.050) (-1834.206) -- 0:00:58
747500 -- (-1837.835) (-1848.157) (-1836.341) [-1831.574] * (-1835.385) (-1843.362) (-1839.729) [-1837.128] -- 0:00:58
748000 -- (-1836.683) (-1836.442) (-1837.616) [-1834.875] * (-1834.434) (-1840.136) (-1836.081) [-1834.677] -- 0:00:58
748500 -- (-1843.727) [-1829.668] (-1835.406) (-1836.439) * (-1834.449) [-1838.608] (-1843.420) (-1837.930) -- 0:00:58
749000 -- (-1832.461) (-1841.168) [-1841.798] (-1843.369) * (-1832.978) [-1840.948] (-1836.447) (-1835.821) -- 0:00:58
749500 -- (-1838.529) (-1833.737) [-1840.179] (-1833.981) * (-1834.773) (-1833.719) (-1838.567) [-1829.139] -- 0:00:58
750000 -- (-1837.065) (-1830.636) [-1832.580] (-1841.211) * (-1840.745) (-1835.414) [-1833.128] (-1832.710) -- 0:00:58
Average standard deviation of split frequencies: 0.000000
750500 -- [-1834.687] (-1837.042) (-1832.748) (-1838.414) * (-1835.973) [-1831.639] (-1833.414) (-1834.428) -- 0:00:58
751000 -- (-1835.332) (-1839.677) [-1832.001] (-1834.748) * (-1839.511) (-1830.867) [-1834.799] (-1835.846) -- 0:00:58
751500 -- (-1837.402) [-1834.112] (-1836.290) (-1845.366) * [-1836.188] (-1846.257) (-1833.094) (-1835.067) -- 0:00:57
752000 -- [-1832.238] (-1836.074) (-1831.656) (-1835.886) * (-1835.670) [-1837.453] (-1836.064) (-1839.552) -- 0:00:57
752500 -- (-1835.330) [-1837.652] (-1832.733) (-1834.096) * [-1836.934] (-1836.149) (-1840.850) (-1831.774) -- 0:00:57
753000 -- [-1836.909] (-1837.667) (-1839.674) (-1839.464) * (-1832.191) (-1834.581) [-1839.292] (-1836.705) -- 0:00:57
753500 -- (-1838.045) (-1837.968) (-1837.586) [-1838.913] * (-1830.447) (-1835.484) [-1837.747] (-1839.580) -- 0:00:57
754000 -- (-1835.639) (-1840.103) [-1841.025] (-1842.188) * (-1839.222) [-1839.229] (-1838.385) (-1834.232) -- 0:00:57
754500 -- [-1834.372] (-1841.457) (-1844.917) (-1837.112) * (-1837.031) [-1839.876] (-1840.599) (-1833.953) -- 0:00:56
755000 -- (-1840.187) [-1832.494] (-1837.900) (-1840.161) * [-1838.653] (-1835.274) (-1842.291) (-1836.490) -- 0:00:57
Average standard deviation of split frequencies: 0.000000
755500 -- (-1839.441) (-1837.705) (-1837.182) [-1836.692] * (-1839.225) (-1837.985) (-1842.111) [-1839.228] -- 0:00:56
756000 -- (-1838.218) [-1832.665] (-1838.260) (-1834.413) * (-1839.597) (-1839.961) (-1837.891) [-1833.619] -- 0:00:56
756500 -- (-1841.126) (-1840.120) (-1837.302) [-1838.214] * (-1836.931) (-1836.344) [-1835.360] (-1833.482) -- 0:00:56
757000 -- (-1838.124) (-1832.181) (-1844.387) [-1836.209] * (-1835.683) (-1831.651) (-1835.864) [-1829.429] -- 0:00:56
757500 -- (-1836.269) (-1836.645) (-1837.846) [-1832.327] * (-1832.765) [-1833.982] (-1833.395) (-1837.057) -- 0:00:56
758000 -- (-1837.335) [-1835.778] (-1835.174) (-1834.698) * (-1845.369) (-1836.854) [-1838.309] (-1842.840) -- 0:00:56
758500 -- [-1844.683] (-1836.568) (-1837.466) (-1845.292) * [-1838.803] (-1833.544) (-1836.835) (-1834.958) -- 0:00:56
759000 -- [-1838.857] (-1840.044) (-1834.296) (-1839.186) * [-1837.904] (-1833.312) (-1841.651) (-1835.833) -- 0:00:56
759500 -- (-1836.757) (-1840.607) [-1837.513] (-1832.203) * (-1843.028) (-1835.215) (-1837.097) [-1843.006] -- 0:00:56
760000 -- [-1838.815] (-1834.115) (-1836.520) (-1841.601) * (-1833.750) [-1830.282] (-1837.210) (-1831.506) -- 0:00:55
Average standard deviation of split frequencies: 0.000000
760500 -- (-1832.777) (-1838.530) [-1837.981] (-1848.595) * (-1840.981) (-1840.485) [-1836.201] (-1842.726) -- 0:00:55
761000 -- (-1836.027) (-1840.246) [-1834.618] (-1842.598) * [-1837.568] (-1842.783) (-1836.177) (-1830.652) -- 0:00:55
761500 -- (-1836.412) (-1836.982) (-1834.799) [-1836.448] * [-1833.575] (-1835.926) (-1841.008) (-1838.831) -- 0:00:55
762000 -- [-1836.203] (-1836.745) (-1834.441) (-1831.947) * [-1837.430] (-1833.029) (-1837.956) (-1837.352) -- 0:00:55
762500 -- (-1838.229) (-1847.099) (-1833.571) [-1838.112] * [-1837.195] (-1837.625) (-1832.379) (-1832.762) -- 0:00:55
763000 -- (-1836.612) (-1840.567) (-1836.457) [-1834.227] * (-1833.766) [-1835.264] (-1831.131) (-1830.432) -- 0:00:54
763500 -- [-1832.314] (-1837.334) (-1839.163) (-1833.751) * (-1838.843) (-1839.150) [-1837.041] (-1832.192) -- 0:00:55
764000 -- [-1831.571] (-1841.699) (-1843.758) (-1839.922) * (-1835.485) [-1837.594] (-1835.515) (-1839.300) -- 0:00:54
764500 -- (-1830.511) (-1840.741) [-1833.492] (-1839.278) * (-1836.953) (-1842.407) [-1836.716] (-1845.642) -- 0:00:54
765000 -- (-1842.866) [-1835.813] (-1832.291) (-1832.985) * (-1838.196) (-1834.185) (-1835.956) [-1832.974] -- 0:00:54
Average standard deviation of split frequencies: 0.000000
765500 -- (-1835.983) (-1836.011) (-1838.676) [-1836.224] * [-1836.911] (-1834.638) (-1831.840) (-1836.615) -- 0:00:54
766000 -- (-1837.460) (-1833.461) (-1846.763) [-1834.690] * (-1832.381) (-1841.408) [-1837.774] (-1838.375) -- 0:00:54
766500 -- (-1839.940) (-1837.846) [-1841.473] (-1832.460) * (-1842.405) (-1832.757) [-1833.299] (-1838.585) -- 0:00:54
767000 -- (-1834.933) (-1845.018) (-1836.409) [-1835.322] * (-1836.005) (-1835.010) (-1838.662) [-1838.184] -- 0:00:54
767500 -- (-1842.575) (-1845.499) (-1831.994) [-1838.982] * (-1837.556) [-1832.394] (-1844.163) (-1834.756) -- 0:00:54
768000 -- (-1849.639) (-1839.617) (-1838.702) [-1838.552] * [-1836.912] (-1838.113) (-1838.333) (-1835.628) -- 0:00:54
768500 -- (-1835.418) (-1834.642) [-1833.342] (-1839.099) * (-1830.082) [-1831.127] (-1833.786) (-1830.384) -- 0:00:53
769000 -- (-1832.510) (-1836.007) (-1835.399) [-1838.483] * (-1835.425) (-1833.058) [-1830.023] (-1837.131) -- 0:00:53
769500 -- [-1833.875] (-1834.840) (-1838.270) (-1837.045) * [-1832.959] (-1840.941) (-1840.250) (-1842.805) -- 0:00:53
770000 -- (-1845.925) (-1834.927) (-1839.014) [-1836.108] * [-1835.485] (-1835.888) (-1837.143) (-1842.845) -- 0:00:53
Average standard deviation of split frequencies: 0.000000
770500 -- (-1838.199) [-1838.009] (-1835.797) (-1830.643) * [-1842.434] (-1836.860) (-1835.069) (-1834.917) -- 0:00:53
771000 -- (-1848.555) [-1832.079] (-1832.467) (-1832.297) * (-1837.738) (-1835.031) [-1840.675] (-1836.429) -- 0:00:53
771500 -- (-1850.144) (-1831.480) [-1833.801] (-1832.949) * (-1830.886) (-1838.618) (-1835.290) [-1840.067] -- 0:00:53
772000 -- (-1837.691) (-1836.189) [-1840.736] (-1838.335) * (-1842.969) (-1830.531) (-1834.904) [-1833.980] -- 0:00:53
772500 -- (-1845.682) (-1835.207) [-1833.242] (-1837.413) * (-1848.724) (-1836.174) [-1837.399] (-1832.205) -- 0:00:53
773000 -- (-1834.086) (-1837.416) [-1837.236] (-1833.328) * (-1841.004) (-1835.193) [-1834.998] (-1836.542) -- 0:00:52
773500 -- (-1840.810) [-1835.442] (-1839.596) (-1841.867) * (-1840.545) (-1842.193) [-1837.429] (-1841.384) -- 0:00:52
774000 -- (-1836.591) (-1836.313) (-1831.142) [-1838.427] * [-1846.979] (-1845.625) (-1839.847) (-1840.547) -- 0:00:52
774500 -- (-1834.763) (-1837.586) [-1835.744] (-1842.286) * (-1834.920) [-1837.625] (-1835.133) (-1837.557) -- 0:00:52
775000 -- (-1836.325) (-1843.939) [-1835.639] (-1831.766) * (-1837.647) (-1839.579) (-1835.549) [-1831.506] -- 0:00:52
Average standard deviation of split frequencies: 0.000000
775500 -- (-1839.597) (-1837.141) (-1837.112) [-1834.056] * (-1837.958) (-1834.367) (-1842.268) [-1830.093] -- 0:00:52
776000 -- (-1832.764) (-1838.982) [-1840.976] (-1840.016) * (-1837.069) [-1831.867] (-1835.525) (-1835.780) -- 0:00:52
776500 -- (-1846.815) (-1838.019) (-1839.864) [-1837.216] * (-1833.801) (-1831.700) [-1842.529] (-1838.686) -- 0:00:52
777000 -- (-1836.906) (-1830.050) (-1837.095) [-1835.871] * (-1831.211) [-1835.545] (-1839.444) (-1839.684) -- 0:00:51
777500 -- (-1838.399) (-1837.949) (-1845.487) [-1830.967] * [-1831.559] (-1842.508) (-1833.215) (-1837.117) -- 0:00:51
778000 -- (-1836.487) (-1836.735) [-1839.949] (-1837.559) * (-1835.094) (-1834.305) [-1832.898] (-1834.715) -- 0:00:51
778500 -- (-1834.357) (-1839.798) (-1842.797) [-1831.946] * (-1833.514) [-1838.397] (-1843.003) (-1839.591) -- 0:00:51
779000 -- [-1832.731] (-1834.294) (-1837.135) (-1840.138) * (-1838.796) (-1843.233) (-1837.047) [-1836.489] -- 0:00:51
779500 -- (-1832.543) [-1835.976] (-1833.814) (-1841.602) * (-1838.342) (-1838.402) [-1838.677] (-1836.462) -- 0:00:51
780000 -- (-1833.799) [-1828.289] (-1837.935) (-1836.129) * [-1835.460] (-1839.099) (-1838.646) (-1836.016) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
780500 -- (-1844.819) [-1833.700] (-1835.370) (-1839.721) * [-1838.433] (-1835.245) (-1837.387) (-1834.691) -- 0:00:51
781000 -- (-1837.674) (-1833.847) (-1837.009) [-1844.426] * (-1845.435) [-1837.432] (-1833.837) (-1834.765) -- 0:00:51
781500 -- (-1837.033) (-1836.535) (-1844.045) [-1839.634] * (-1839.103) [-1834.481] (-1846.686) (-1834.019) -- 0:00:50
782000 -- [-1837.914] (-1833.060) (-1837.322) (-1840.697) * [-1834.707] (-1834.513) (-1832.722) (-1836.316) -- 0:00:50
782500 -- (-1839.451) (-1842.961) [-1836.878] (-1841.382) * (-1836.345) (-1835.346) [-1836.535] (-1839.435) -- 0:00:50
783000 -- [-1833.102] (-1836.848) (-1835.459) (-1838.985) * [-1833.367] (-1839.474) (-1840.992) (-1842.469) -- 0:00:50
783500 -- (-1846.016) (-1839.522) (-1837.612) [-1840.319] * [-1833.253] (-1840.178) (-1839.472) (-1833.586) -- 0:00:50
784000 -- (-1837.390) (-1835.411) [-1832.295] (-1837.118) * (-1836.094) [-1832.904] (-1839.353) (-1838.895) -- 0:00:50
784500 -- (-1844.633) (-1838.215) [-1834.640] (-1836.557) * (-1831.310) [-1835.065] (-1833.114) (-1833.072) -- 0:00:50
785000 -- (-1838.362) (-1835.558) (-1837.690) [-1834.367] * (-1837.952) (-1838.535) (-1831.974) [-1835.412] -- 0:00:50
Average standard deviation of split frequencies: 0.000000
785500 -- (-1838.437) (-1833.934) [-1833.721] (-1832.438) * (-1836.916) (-1837.901) (-1834.739) [-1839.864] -- 0:00:49
786000 -- (-1837.859) (-1832.731) [-1837.772] (-1835.535) * (-1839.075) (-1842.259) (-1834.088) [-1834.681] -- 0:00:49
786500 -- (-1839.115) (-1833.629) (-1837.066) [-1836.980] * (-1837.550) [-1843.010] (-1836.086) (-1833.360) -- 0:00:49
787000 -- (-1843.947) (-1840.212) (-1834.363) [-1836.200] * (-1836.629) (-1836.618) [-1834.267] (-1833.997) -- 0:00:49
787500 -- (-1836.865) (-1843.452) (-1834.909) [-1835.100] * (-1833.889) (-1840.088) (-1830.547) [-1833.634] -- 0:00:49
788000 -- (-1841.033) [-1833.091] (-1836.390) (-1836.266) * [-1832.327] (-1838.630) (-1835.613) (-1834.064) -- 0:00:49
788500 -- [-1837.483] (-1831.171) (-1836.289) (-1841.427) * (-1835.689) [-1835.666] (-1836.565) (-1835.373) -- 0:00:49
789000 -- (-1848.862) (-1838.678) [-1836.811] (-1840.613) * (-1836.401) [-1839.591] (-1841.331) (-1831.283) -- 0:00:49
789500 -- (-1836.783) (-1841.802) [-1840.277] (-1833.840) * (-1842.688) (-1838.637) [-1835.900] (-1837.638) -- 0:00:49
790000 -- [-1836.200] (-1839.781) (-1835.761) (-1837.973) * (-1844.748) (-1837.216) [-1838.938] (-1835.946) -- 0:00:48
Average standard deviation of split frequencies: 0.000000
790500 -- [-1837.267] (-1838.504) (-1833.622) (-1838.766) * (-1840.269) [-1838.894] (-1836.347) (-1833.329) -- 0:00:48
791000 -- [-1830.583] (-1837.887) (-1836.201) (-1840.506) * (-1839.137) (-1848.962) (-1836.824) [-1837.107] -- 0:00:48
791500 -- (-1836.494) (-1835.822) [-1838.929] (-1848.500) * (-1838.616) (-1835.138) [-1835.739] (-1836.720) -- 0:00:48
792000 -- (-1846.847) (-1836.038) (-1832.463) [-1831.045] * (-1836.380) [-1830.091] (-1834.635) (-1837.919) -- 0:00:48
792500 -- [-1833.079] (-1832.910) (-1831.352) (-1832.544) * (-1832.672) [-1835.813] (-1840.010) (-1841.156) -- 0:00:48
793000 -- (-1841.932) (-1834.097) (-1842.864) [-1832.154] * (-1840.406) (-1837.953) [-1832.600] (-1831.114) -- 0:00:48
793500 -- (-1838.525) [-1831.927] (-1833.923) (-1829.960) * (-1835.946) (-1832.181) [-1834.687] (-1836.082) -- 0:00:48
794000 -- (-1840.500) (-1834.378) [-1831.987] (-1829.737) * (-1837.980) [-1832.310] (-1835.133) (-1836.712) -- 0:00:47
794500 -- [-1836.302] (-1834.713) (-1833.721) (-1840.760) * [-1837.793] (-1835.278) (-1835.798) (-1830.853) -- 0:00:47
795000 -- (-1833.746) (-1838.924) [-1839.239] (-1835.575) * [-1833.689] (-1833.658) (-1833.433) (-1839.965) -- 0:00:47
Average standard deviation of split frequencies: 0.000000
795500 -- (-1833.676) (-1831.804) (-1837.073) [-1837.809] * (-1835.143) (-1833.744) (-1836.568) [-1835.023] -- 0:00:47
796000 -- [-1833.395] (-1836.529) (-1831.980) (-1839.346) * [-1835.618] (-1837.822) (-1843.493) (-1844.744) -- 0:00:47
796500 -- (-1839.242) [-1833.973] (-1831.633) (-1835.636) * (-1842.679) [-1840.519] (-1840.763) (-1844.996) -- 0:00:47
797000 -- (-1841.396) [-1834.881] (-1835.695) (-1838.348) * (-1839.078) [-1834.318] (-1834.582) (-1850.123) -- 0:00:47
797500 -- (-1843.711) [-1833.298] (-1834.366) (-1831.343) * (-1841.095) (-1836.789) (-1831.959) [-1833.971] -- 0:00:47
798000 -- (-1836.457) [-1834.305] (-1834.219) (-1835.768) * (-1836.370) (-1836.710) (-1842.976) [-1842.553] -- 0:00:47
798500 -- (-1835.605) (-1834.045) [-1833.955] (-1840.050) * (-1843.242) [-1833.028] (-1843.398) (-1836.538) -- 0:00:46
799000 -- [-1838.351] (-1832.094) (-1837.683) (-1838.942) * (-1834.578) (-1841.770) (-1845.743) [-1828.846] -- 0:00:46
799500 -- (-1835.407) (-1833.568) [-1842.359] (-1837.708) * (-1838.521) (-1835.916) (-1842.132) [-1831.483] -- 0:00:46
800000 -- (-1831.102) [-1835.058] (-1844.703) (-1841.287) * (-1837.891) [-1832.521] (-1847.932) (-1832.878) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
800500 -- (-1836.353) (-1836.734) (-1836.695) [-1833.334] * [-1834.744] (-1839.584) (-1838.146) (-1839.314) -- 0:00:46
801000 -- (-1841.517) (-1847.234) (-1837.548) [-1840.388] * (-1835.420) (-1844.231) (-1837.939) [-1831.052] -- 0:00:46
801500 -- [-1835.200] (-1840.995) (-1836.375) (-1841.129) * (-1842.181) [-1834.549] (-1833.345) (-1833.984) -- 0:00:46
802000 -- (-1836.259) (-1840.029) (-1835.675) [-1830.955] * [-1837.994] (-1838.056) (-1834.455) (-1837.430) -- 0:00:46
802500 -- [-1837.696] (-1839.434) (-1840.913) (-1835.047) * (-1831.256) (-1832.665) (-1838.251) [-1834.679] -- 0:00:46
803000 -- [-1829.337] (-1843.792) (-1834.439) (-1838.434) * [-1833.706] (-1838.139) (-1838.577) (-1835.317) -- 0:00:45
803500 -- [-1834.149] (-1836.052) (-1840.381) (-1840.364) * [-1831.062] (-1841.515) (-1835.552) (-1836.571) -- 0:00:45
804000 -- (-1833.690) (-1832.687) [-1837.275] (-1841.527) * (-1832.066) (-1843.837) [-1837.213] (-1835.041) -- 0:00:45
804500 -- (-1831.409) (-1835.167) [-1831.876] (-1840.015) * [-1833.365] (-1835.924) (-1838.430) (-1831.148) -- 0:00:45
805000 -- (-1838.693) [-1834.491] (-1842.009) (-1834.801) * (-1838.599) [-1831.275] (-1836.679) (-1837.779) -- 0:00:45
Average standard deviation of split frequencies: 0.000000
805500 -- (-1841.635) (-1844.074) [-1833.169] (-1830.346) * (-1834.986) (-1835.950) [-1842.069] (-1832.934) -- 0:00:45
806000 -- (-1836.936) (-1837.497) [-1838.373] (-1834.869) * [-1834.508] (-1831.731) (-1837.723) (-1835.569) -- 0:00:45
806500 -- (-1838.456) (-1835.413) [-1835.370] (-1833.727) * (-1836.303) (-1833.776) (-1842.972) [-1839.019] -- 0:00:45
807000 -- (-1832.203) (-1834.159) (-1835.436) [-1833.026] * [-1834.128] (-1833.912) (-1840.505) (-1846.908) -- 0:00:44
807500 -- (-1839.652) [-1832.941] (-1842.178) (-1833.822) * [-1832.534] (-1836.766) (-1837.056) (-1833.972) -- 0:00:44
808000 -- (-1833.962) (-1834.832) (-1837.292) [-1835.871] * (-1835.123) (-1833.716) [-1834.474] (-1834.850) -- 0:00:44
808500 -- (-1834.970) [-1832.197] (-1837.442) (-1837.630) * (-1832.338) (-1846.107) [-1831.591] (-1832.997) -- 0:00:44
809000 -- (-1838.710) [-1832.254] (-1837.059) (-1836.751) * [-1836.663] (-1840.247) (-1840.315) (-1834.882) -- 0:00:44
809500 -- (-1842.307) (-1838.706) [-1837.503] (-1845.091) * (-1835.951) [-1836.540] (-1838.991) (-1834.063) -- 0:00:44
810000 -- [-1836.525] (-1838.863) (-1840.561) (-1836.876) * [-1830.536] (-1834.328) (-1836.820) (-1836.794) -- 0:00:44
Average standard deviation of split frequencies: 0.000000
810500 -- (-1831.513) (-1831.518) [-1840.433] (-1837.970) * (-1836.180) (-1831.693) (-1832.683) [-1830.981] -- 0:00:44
811000 -- (-1837.580) [-1831.137] (-1837.445) (-1838.039) * [-1841.781] (-1832.159) (-1839.688) (-1837.589) -- 0:00:44
811500 -- (-1834.943) (-1833.867) (-1838.375) [-1835.382] * (-1838.142) (-1840.315) (-1838.281) [-1833.714] -- 0:00:43
812000 -- (-1837.763) (-1840.029) (-1841.375) [-1830.417] * (-1832.597) (-1838.689) [-1831.705] (-1845.825) -- 0:00:43
812500 -- (-1839.985) (-1835.427) (-1839.366) [-1832.404] * (-1835.647) [-1838.406] (-1832.843) (-1833.760) -- 0:00:43
813000 -- (-1837.961) (-1832.722) [-1841.292] (-1836.400) * (-1835.724) (-1835.959) (-1839.960) [-1830.780] -- 0:00:43
813500 -- [-1830.859] (-1835.668) (-1839.001) (-1832.829) * [-1829.152] (-1835.462) (-1834.966) (-1832.563) -- 0:00:43
814000 -- [-1839.165] (-1837.882) (-1847.649) (-1835.144) * (-1833.968) (-1839.194) (-1837.289) [-1838.549] -- 0:00:43
814500 -- (-1832.135) (-1836.469) (-1839.857) [-1832.250] * (-1843.305) (-1841.759) [-1834.111] (-1841.111) -- 0:00:43
815000 -- (-1837.534) [-1837.000] (-1840.465) (-1834.011) * (-1836.748) [-1840.667] (-1835.780) (-1834.688) -- 0:00:43
Average standard deviation of split frequencies: 0.000000
815500 -- (-1837.968) (-1835.659) [-1835.740] (-1836.476) * (-1844.010) (-1847.761) [-1831.574] (-1834.472) -- 0:00:42
816000 -- (-1838.674) (-1836.218) [-1838.040] (-1843.847) * (-1837.749) (-1839.942) (-1837.006) [-1838.711] -- 0:00:42
816500 -- [-1837.195] (-1840.633) (-1841.588) (-1837.266) * [-1835.913] (-1837.434) (-1841.155) (-1838.999) -- 0:00:42
817000 -- (-1840.852) (-1839.539) (-1836.894) [-1833.606] * [-1840.967] (-1835.409) (-1838.293) (-1834.999) -- 0:00:42
817500 -- (-1842.437) (-1837.624) (-1844.949) [-1831.775] * (-1835.342) (-1839.216) [-1834.001] (-1839.085) -- 0:00:42
818000 -- (-1830.004) [-1833.981] (-1835.723) (-1833.502) * (-1837.598) (-1832.114) (-1833.614) [-1832.006] -- 0:00:42
818500 -- [-1832.189] (-1834.166) (-1840.420) (-1836.134) * (-1839.822) [-1835.551] (-1841.167) (-1831.405) -- 0:00:42
819000 -- [-1834.776] (-1835.685) (-1836.056) (-1840.104) * (-1839.302) (-1839.435) [-1843.930] (-1843.098) -- 0:00:42
819500 -- (-1836.496) (-1830.141) [-1830.658] (-1839.478) * [-1838.988] (-1836.802) (-1845.123) (-1834.525) -- 0:00:42
820000 -- (-1833.988) (-1840.329) [-1834.278] (-1842.835) * (-1835.168) (-1833.848) [-1837.674] (-1836.388) -- 0:00:41
Average standard deviation of split frequencies: 0.000000
820500 -- (-1833.566) (-1843.748) (-1838.328) [-1833.966] * (-1843.925) (-1838.019) [-1836.434] (-1833.918) -- 0:00:41
821000 -- (-1836.649) (-1846.696) [-1832.758] (-1839.804) * (-1837.524) [-1834.133] (-1836.396) (-1831.687) -- 0:00:41
821500 -- (-1834.527) (-1845.485) (-1833.287) [-1838.286] * (-1842.136) (-1835.743) (-1830.427) [-1832.176] -- 0:00:41
822000 -- [-1835.870] (-1842.300) (-1837.225) (-1836.580) * (-1845.006) (-1835.429) (-1831.540) [-1836.859] -- 0:00:41
822500 -- [-1833.131] (-1838.842) (-1840.701) (-1841.821) * (-1846.044) (-1832.289) [-1832.889] (-1836.243) -- 0:00:41
823000 -- [-1834.226] (-1840.144) (-1836.054) (-1832.925) * (-1851.348) [-1833.544] (-1835.583) (-1832.062) -- 0:00:41
823500 -- (-1839.214) (-1836.551) (-1833.796) [-1838.778] * (-1839.715) [-1832.429] (-1839.203) (-1834.732) -- 0:00:41
824000 -- [-1841.527] (-1833.450) (-1837.961) (-1834.985) * (-1840.403) (-1834.721) [-1834.036] (-1833.879) -- 0:00:41
824500 -- [-1837.400] (-1836.012) (-1835.436) (-1835.041) * [-1834.012] (-1838.207) (-1836.466) (-1834.235) -- 0:00:40
825000 -- [-1836.518] (-1846.493) (-1837.984) (-1837.959) * (-1840.849) (-1847.742) (-1838.359) [-1838.804] -- 0:00:40
Average standard deviation of split frequencies: 0.000000
825500 -- (-1834.220) [-1835.687] (-1839.497) (-1838.432) * [-1829.705] (-1833.447) (-1837.426) (-1838.332) -- 0:00:40
826000 -- (-1835.229) (-1834.217) [-1844.708] (-1836.384) * (-1832.486) [-1836.317] (-1830.975) (-1841.863) -- 0:00:40
826500 -- [-1834.660] (-1834.588) (-1836.912) (-1843.161) * (-1836.232) (-1832.570) (-1833.161) [-1836.221] -- 0:00:40
827000 -- [-1836.064] (-1839.152) (-1843.314) (-1838.892) * (-1838.702) (-1830.211) [-1836.171] (-1834.719) -- 0:00:40
827500 -- [-1843.735] (-1836.643) (-1835.813) (-1833.732) * (-1840.927) (-1840.007) [-1836.178] (-1838.024) -- 0:00:40
828000 -- (-1833.982) (-1841.503) [-1837.657] (-1826.588) * (-1837.340) (-1842.693) (-1839.591) [-1838.812] -- 0:00:40
828500 -- (-1837.907) (-1840.129) (-1837.068) [-1832.447] * (-1833.150) (-1838.638) [-1837.482] (-1839.598) -- 0:00:39
829000 -- [-1834.625] (-1843.879) (-1837.079) (-1838.231) * (-1836.800) (-1835.030) (-1840.777) [-1832.819] -- 0:00:39
829500 -- [-1845.427] (-1843.462) (-1837.082) (-1834.389) * [-1833.182] (-1843.945) (-1839.255) (-1836.936) -- 0:00:39
830000 -- (-1846.835) (-1839.083) (-1832.764) [-1831.179] * (-1835.042) (-1840.423) (-1837.371) [-1835.975] -- 0:00:39
Average standard deviation of split frequencies: 0.000000
830500 -- (-1842.218) [-1845.099] (-1833.925) (-1830.858) * [-1833.770] (-1839.392) (-1837.251) (-1835.388) -- 0:00:39
831000 -- [-1845.647] (-1833.966) (-1830.905) (-1845.113) * [-1838.536] (-1841.094) (-1835.328) (-1836.381) -- 0:00:39
831500 -- (-1838.436) (-1833.796) (-1828.807) [-1834.947] * (-1838.962) [-1838.586] (-1831.772) (-1835.296) -- 0:00:39
832000 -- (-1839.306) [-1836.043] (-1831.022) (-1836.163) * (-1834.335) (-1839.182) [-1831.872] (-1840.525) -- 0:00:39
832500 -- (-1838.261) (-1835.748) (-1833.227) [-1833.724] * [-1835.230] (-1833.951) (-1838.151) (-1830.337) -- 0:00:39
833000 -- (-1845.432) [-1832.643] (-1838.133) (-1831.834) * (-1831.034) (-1830.131) [-1838.717] (-1834.507) -- 0:00:38
833500 -- (-1837.931) [-1832.674] (-1841.387) (-1839.833) * (-1837.023) (-1835.477) (-1836.878) [-1833.041] -- 0:00:38
834000 -- [-1840.044] (-1829.380) (-1838.387) (-1833.069) * (-1836.912) (-1836.383) (-1840.629) [-1832.584] -- 0:00:38
834500 -- (-1837.332) (-1835.472) (-1835.657) [-1833.934] * (-1844.145) (-1840.882) (-1837.577) [-1838.927] -- 0:00:38
835000 -- (-1835.002) (-1837.315) [-1834.659] (-1842.872) * (-1836.506) (-1836.979) (-1843.869) [-1836.932] -- 0:00:38
Average standard deviation of split frequencies: 0.000000
835500 -- (-1833.064) [-1841.782] (-1837.390) (-1838.922) * (-1830.122) (-1834.702) [-1836.012] (-1836.895) -- 0:00:38
836000 -- [-1840.239] (-1838.518) (-1834.782) (-1833.272) * (-1834.449) (-1838.941) [-1836.236] (-1832.731) -- 0:00:38
836500 -- (-1835.271) (-1835.577) (-1833.055) [-1831.484] * (-1839.739) (-1835.783) [-1836.593] (-1840.928) -- 0:00:38
837000 -- (-1834.798) (-1843.280) (-1834.472) [-1836.872] * (-1838.731) (-1836.740) [-1839.195] (-1847.557) -- 0:00:37
837500 -- [-1832.120] (-1836.696) (-1840.355) (-1833.073) * (-1835.990) (-1831.258) (-1834.297) [-1840.158] -- 0:00:37
838000 -- (-1833.645) (-1834.489) (-1839.070) [-1834.295] * (-1833.984) (-1832.526) (-1838.279) [-1835.962] -- 0:00:37
838500 -- (-1843.672) (-1833.673) [-1839.245] (-1833.909) * (-1831.425) (-1844.143) (-1836.136) [-1837.048] -- 0:00:37
839000 -- (-1835.404) (-1836.113) (-1839.574) [-1833.612] * (-1837.306) (-1834.124) [-1832.711] (-1831.701) -- 0:00:37
839500 -- (-1834.155) [-1832.369] (-1835.795) (-1834.819) * (-1835.349) [-1837.226] (-1837.865) (-1835.528) -- 0:00:37
840000 -- (-1836.569) [-1839.376] (-1835.820) (-1839.419) * (-1834.413) (-1830.341) [-1832.399] (-1834.298) -- 0:00:37
Average standard deviation of split frequencies: 0.000000
840500 -- (-1838.552) (-1839.065) (-1835.352) [-1842.430] * [-1839.506] (-1835.522) (-1833.528) (-1833.393) -- 0:00:37
841000 -- (-1837.974) (-1834.137) [-1844.596] (-1837.976) * (-1836.851) [-1831.870] (-1832.762) (-1838.687) -- 0:00:37
841500 -- (-1838.610) (-1831.735) [-1837.830] (-1836.750) * [-1836.036] (-1836.581) (-1837.159) (-1839.964) -- 0:00:36
842000 -- (-1840.545) [-1835.441] (-1841.958) (-1835.800) * (-1840.673) (-1834.938) [-1835.388] (-1835.867) -- 0:00:36
842500 -- (-1838.580) (-1839.403) (-1834.384) [-1835.501] * [-1833.190] (-1832.810) (-1837.390) (-1836.072) -- 0:00:36
843000 -- (-1836.510) [-1834.666] (-1836.268) (-1838.412) * (-1839.104) (-1843.941) [-1834.138] (-1837.540) -- 0:00:36
843500 -- (-1835.197) [-1835.105] (-1838.681) (-1837.881) * [-1835.683] (-1846.563) (-1836.808) (-1835.875) -- 0:00:36
844000 -- (-1838.513) (-1834.178) [-1835.633] (-1834.375) * [-1833.319] (-1835.928) (-1831.763) (-1839.120) -- 0:00:36
844500 -- (-1834.981) (-1828.892) [-1837.525] (-1833.568) * [-1833.199] (-1831.697) (-1829.975) (-1844.235) -- 0:00:36
845000 -- (-1836.425) [-1832.462] (-1835.131) (-1834.398) * (-1834.116) [-1837.586] (-1837.062) (-1837.676) -- 0:00:36
Average standard deviation of split frequencies: 0.000000
845500 -- [-1839.573] (-1830.877) (-1840.069) (-1838.268) * [-1835.527] (-1834.257) (-1840.729) (-1837.926) -- 0:00:35
846000 -- (-1842.006) (-1837.581) (-1834.900) [-1829.324] * (-1845.226) (-1831.665) [-1839.090] (-1835.970) -- 0:00:35
846500 -- (-1834.834) [-1830.969] (-1837.399) (-1832.845) * (-1836.092) [-1842.822] (-1830.548) (-1832.141) -- 0:00:35
847000 -- (-1837.903) (-1836.530) (-1840.876) [-1835.595] * (-1842.783) (-1845.178) (-1834.877) [-1838.341] -- 0:00:35
847500 -- (-1839.715) (-1837.166) [-1840.474] (-1831.919) * (-1843.649) (-1829.767) (-1840.107) [-1833.771] -- 0:00:35
848000 -- (-1838.751) (-1830.571) [-1835.822] (-1835.061) * (-1836.633) [-1828.905] (-1837.576) (-1833.017) -- 0:00:35
848500 -- [-1837.447] (-1838.736) (-1835.209) (-1842.240) * (-1840.270) [-1834.328] (-1835.624) (-1829.963) -- 0:00:35
849000 -- (-1834.822) (-1837.111) [-1837.164] (-1840.897) * (-1837.409) (-1838.114) (-1834.732) [-1837.382] -- 0:00:35
849500 -- [-1833.298] (-1835.015) (-1834.946) (-1842.280) * (-1838.548) [-1834.848] (-1839.857) (-1838.164) -- 0:00:35
850000 -- (-1834.709) (-1842.154) (-1844.004) [-1835.163] * (-1837.589) [-1834.438] (-1837.378) (-1842.046) -- 0:00:34
Average standard deviation of split frequencies: 0.000000
850500 -- (-1836.274) (-1834.964) (-1831.824) [-1837.872] * (-1840.872) [-1831.448] (-1837.372) (-1842.221) -- 0:00:34
851000 -- (-1836.350) (-1838.054) [-1837.130] (-1833.898) * (-1834.404) [-1834.784] (-1836.154) (-1838.225) -- 0:00:34
851500 -- (-1836.124) (-1835.195) (-1836.214) [-1834.235] * (-1843.004) (-1836.970) (-1838.145) [-1830.564] -- 0:00:34
852000 -- [-1832.767] (-1834.966) (-1836.957) (-1834.016) * [-1838.535] (-1831.990) (-1837.024) (-1844.514) -- 0:00:34
852500 -- (-1841.378) (-1836.549) [-1832.545] (-1833.200) * (-1843.156) [-1837.842] (-1836.282) (-1837.520) -- 0:00:34
853000 -- [-1836.015] (-1835.739) (-1832.929) (-1839.661) * (-1840.376) (-1836.459) (-1837.011) [-1833.965] -- 0:00:34
853500 -- (-1846.067) [-1834.385] (-1834.908) (-1844.758) * (-1833.911) [-1832.984] (-1832.480) (-1839.993) -- 0:00:34
854000 -- (-1832.044) (-1834.522) [-1839.815] (-1837.622) * (-1833.838) (-1840.051) (-1840.573) [-1834.471] -- 0:00:34
854500 -- (-1832.666) [-1842.491] (-1841.531) (-1847.281) * [-1832.572] (-1831.797) (-1838.286) (-1832.354) -- 0:00:33
855000 -- [-1838.049] (-1837.798) (-1842.015) (-1840.406) * [-1831.849] (-1838.324) (-1838.777) (-1838.635) -- 0:00:33
Average standard deviation of split frequencies: 0.000000
855500 -- (-1836.830) (-1842.469) [-1840.556] (-1833.113) * [-1836.101] (-1839.313) (-1839.064) (-1838.497) -- 0:00:33
856000 -- (-1840.990) (-1834.421) [-1837.602] (-1830.132) * (-1834.573) [-1838.775] (-1838.621) (-1834.581) -- 0:00:33
856500 -- (-1840.641) (-1836.376) [-1838.466] (-1834.145) * [-1835.127] (-1838.786) (-1837.419) (-1841.590) -- 0:00:33
857000 -- (-1839.985) [-1837.551] (-1830.846) (-1839.882) * (-1834.630) [-1831.482] (-1842.086) (-1836.002) -- 0:00:33
857500 -- (-1832.144) [-1834.715] (-1835.219) (-1840.758) * [-1839.315] (-1834.642) (-1832.956) (-1837.001) -- 0:00:33
858000 -- (-1834.725) (-1839.542) (-1844.729) [-1835.563] * (-1831.942) [-1833.907] (-1836.441) (-1834.899) -- 0:00:33
858500 -- (-1838.165) (-1838.871) (-1839.651) [-1837.039] * (-1839.317) (-1833.402) (-1845.997) [-1833.385] -- 0:00:32
859000 -- (-1837.210) (-1838.757) (-1835.705) [-1836.034] * (-1845.307) (-1831.198) (-1836.890) [-1834.362] -- 0:00:32
859500 -- (-1839.064) [-1832.156] (-1837.115) (-1834.801) * [-1834.438] (-1842.300) (-1839.709) (-1835.086) -- 0:00:32
860000 -- (-1834.453) (-1844.592) [-1835.520] (-1838.361) * (-1835.371) (-1836.611) (-1833.546) [-1840.514] -- 0:00:32
Average standard deviation of split frequencies: 0.000000
860500 -- (-1834.919) (-1832.882) (-1832.717) [-1841.023] * (-1845.729) (-1840.948) [-1833.854] (-1833.108) -- 0:00:32
861000 -- (-1834.462) (-1837.092) (-1837.037) [-1835.149] * (-1832.565) (-1835.313) (-1839.026) [-1833.620] -- 0:00:32
861500 -- (-1829.440) (-1833.373) (-1840.138) [-1835.801] * [-1830.107] (-1839.543) (-1835.844) (-1832.373) -- 0:00:32
862000 -- (-1834.765) (-1835.492) (-1841.821) [-1830.342] * [-1833.037] (-1843.004) (-1832.711) (-1836.449) -- 0:00:32
862500 -- [-1833.982] (-1833.217) (-1837.805) (-1836.986) * [-1837.608] (-1839.354) (-1838.641) (-1837.878) -- 0:00:32
863000 -- (-1835.197) (-1840.615) [-1834.456] (-1837.375) * [-1835.760] (-1833.929) (-1840.478) (-1839.200) -- 0:00:31
863500 -- [-1837.862] (-1835.713) (-1840.806) (-1831.103) * [-1837.533] (-1842.450) (-1839.786) (-1834.646) -- 0:00:31
864000 -- (-1834.346) (-1837.987) [-1836.960] (-1838.166) * (-1834.170) (-1837.684) [-1833.225] (-1839.045) -- 0:00:31
864500 -- (-1832.761) [-1840.064] (-1842.976) (-1842.892) * (-1838.676) (-1840.975) [-1832.451] (-1832.335) -- 0:00:31
865000 -- [-1836.874] (-1835.847) (-1843.451) (-1840.311) * (-1838.010) (-1834.816) (-1836.121) [-1832.194] -- 0:00:31
Average standard deviation of split frequencies: 0.000000
865500 -- (-1836.760) (-1833.494) [-1839.839] (-1835.360) * (-1839.841) (-1838.910) (-1841.147) [-1834.685] -- 0:00:31
866000 -- (-1841.223) (-1835.611) (-1836.784) [-1834.874] * (-1841.143) (-1838.254) [-1833.300] (-1832.773) -- 0:00:31
866500 -- (-1832.419) [-1835.285] (-1841.493) (-1832.429) * [-1841.866] (-1849.162) (-1838.691) (-1833.068) -- 0:00:31
867000 -- [-1833.107] (-1831.503) (-1836.769) (-1842.912) * (-1846.599) (-1845.511) [-1833.473] (-1835.555) -- 0:00:30
867500 -- (-1836.502) (-1844.421) (-1842.552) [-1836.120] * (-1841.282) (-1844.747) (-1833.182) [-1840.681] -- 0:00:30
868000 -- (-1836.788) (-1834.150) [-1839.427] (-1838.756) * (-1834.699) [-1847.187] (-1842.199) (-1840.152) -- 0:00:30
868500 -- (-1834.053) [-1836.399] (-1839.761) (-1833.314) * (-1835.049) (-1837.622) [-1834.862] (-1836.302) -- 0:00:30
869000 -- (-1834.311) (-1840.672) (-1829.684) [-1836.980] * (-1837.430) (-1836.534) [-1833.624] (-1837.317) -- 0:00:30
869500 -- (-1838.867) (-1836.768) [-1830.048] (-1843.262) * [-1834.816] (-1840.179) (-1839.848) (-1836.721) -- 0:00:30
870000 -- (-1832.439) (-1839.013) [-1832.307] (-1837.490) * (-1834.042) (-1841.439) (-1836.707) [-1838.964] -- 0:00:30
Average standard deviation of split frequencies: 0.000000
870500 -- [-1833.648] (-1838.182) (-1836.923) (-1833.830) * (-1841.075) (-1844.329) [-1839.609] (-1839.965) -- 0:00:30
871000 -- (-1830.616) (-1836.160) (-1836.571) [-1837.257] * (-1834.445) (-1833.099) [-1830.925] (-1851.423) -- 0:00:30
871500 -- (-1845.070) [-1841.709] (-1834.970) (-1840.539) * (-1846.206) [-1835.354] (-1833.695) (-1840.580) -- 0:00:29
872000 -- (-1835.260) (-1848.358) [-1837.825] (-1834.530) * (-1841.998) (-1838.517) (-1842.430) [-1838.614] -- 0:00:29
872500 -- (-1843.825) [-1841.728] (-1836.362) (-1834.853) * (-1847.979) [-1834.081] (-1840.273) (-1834.785) -- 0:00:29
873000 -- (-1840.928) (-1839.326) [-1833.448] (-1832.639) * (-1836.282) (-1835.358) [-1834.503] (-1840.305) -- 0:00:29
873500 -- (-1842.761) [-1836.118] (-1836.597) (-1834.476) * (-1834.519) [-1835.668] (-1839.203) (-1841.003) -- 0:00:29
874000 -- (-1840.594) (-1832.494) [-1837.459] (-1838.179) * (-1833.901) (-1842.169) [-1832.431] (-1835.708) -- 0:00:29
874500 -- (-1835.422) (-1840.407) (-1839.496) [-1834.851] * (-1832.094) [-1834.679] (-1837.355) (-1842.830) -- 0:00:29
875000 -- [-1835.467] (-1838.796) (-1835.206) (-1838.809) * [-1839.263] (-1836.343) (-1835.744) (-1845.230) -- 0:00:29
Average standard deviation of split frequencies: 0.000000
875500 -- [-1831.083] (-1837.837) (-1836.209) (-1840.019) * (-1851.888) (-1836.052) [-1833.276] (-1831.879) -- 0:00:29
876000 -- (-1831.290) [-1833.228] (-1833.641) (-1838.877) * [-1841.655] (-1832.727) (-1841.913) (-1832.199) -- 0:00:28
876500 -- (-1841.933) [-1841.031] (-1843.012) (-1839.835) * (-1839.276) (-1834.427) (-1834.544) [-1833.375] -- 0:00:28
877000 -- (-1834.498) (-1840.201) (-1833.426) [-1835.217] * (-1841.475) [-1830.916] (-1842.318) (-1836.033) -- 0:00:28
877500 -- (-1837.001) (-1836.105) [-1842.287] (-1834.167) * (-1842.616) (-1834.131) [-1835.933] (-1840.138) -- 0:00:28
878000 -- [-1839.053] (-1832.539) (-1844.252) (-1838.660) * (-1844.218) [-1832.687] (-1843.346) (-1838.507) -- 0:00:28
878500 -- (-1836.753) (-1832.553) (-1836.286) [-1836.099] * (-1835.420) (-1831.909) (-1838.640) [-1840.337] -- 0:00:28
879000 -- (-1833.491) (-1836.332) [-1835.460] (-1835.374) * (-1838.911) [-1836.207] (-1839.144) (-1836.784) -- 0:00:28
879500 -- [-1837.236] (-1834.463) (-1832.846) (-1840.577) * (-1845.138) (-1836.294) (-1834.346) [-1834.826] -- 0:00:28
880000 -- [-1832.921] (-1831.986) (-1835.316) (-1838.688) * (-1840.666) (-1836.941) (-1837.565) [-1829.688] -- 0:00:27
Average standard deviation of split frequencies: 0.000000
880500 -- (-1835.611) [-1835.612] (-1831.325) (-1841.495) * [-1832.747] (-1841.012) (-1837.377) (-1832.587) -- 0:00:27
881000 -- (-1836.197) (-1836.743) [-1833.800] (-1835.421) * (-1843.653) [-1839.093] (-1842.080) (-1836.321) -- 0:00:27
881500 -- [-1835.310] (-1838.488) (-1834.917) (-1835.771) * [-1839.204] (-1838.651) (-1833.591) (-1840.618) -- 0:00:27
882000 -- (-1843.132) [-1837.277] (-1834.421) (-1832.641) * (-1835.018) (-1837.037) [-1833.048] (-1834.180) -- 0:00:27
882500 -- (-1834.219) [-1836.970] (-1845.092) (-1837.976) * [-1834.905] (-1830.324) (-1843.140) (-1839.868) -- 0:00:27
883000 -- (-1832.782) (-1837.764) [-1831.660] (-1838.387) * [-1838.162] (-1832.885) (-1833.172) (-1841.960) -- 0:00:27
883500 -- (-1840.142) [-1836.531] (-1839.619) (-1837.293) * (-1832.953) [-1830.940] (-1832.540) (-1837.401) -- 0:00:27
884000 -- (-1835.866) [-1836.199] (-1846.477) (-1844.580) * (-1842.583) (-1832.299) [-1836.583] (-1838.714) -- 0:00:27
884500 -- (-1840.526) (-1840.853) [-1835.989] (-1836.805) * (-1845.344) (-1837.551) [-1834.358] (-1844.266) -- 0:00:26
885000 -- (-1832.882) [-1833.446] (-1830.824) (-1834.262) * (-1836.755) [-1837.792] (-1847.510) (-1846.856) -- 0:00:26
Average standard deviation of split frequencies: 0.000000
885500 -- [-1832.748] (-1841.106) (-1832.864) (-1838.327) * (-1831.842) (-1841.956) [-1841.417] (-1840.574) -- 0:00:26
886000 -- (-1837.747) (-1847.866) [-1832.667] (-1837.220) * (-1838.439) (-1838.700) (-1842.599) [-1834.849] -- 0:00:26
886500 -- [-1829.588] (-1835.667) (-1837.699) (-1841.656) * (-1839.066) (-1834.325) [-1841.528] (-1833.343) -- 0:00:26
887000 -- (-1834.901) (-1844.788) [-1842.548] (-1836.322) * (-1836.257) (-1834.225) (-1834.539) [-1834.210] -- 0:00:26
887500 -- (-1836.599) (-1842.203) [-1837.329] (-1836.297) * (-1841.945) (-1841.393) [-1838.545] (-1834.434) -- 0:00:26
888000 -- (-1842.568) [-1836.341] (-1838.967) (-1831.666) * (-1836.135) (-1838.464) (-1834.633) [-1837.252] -- 0:00:26
888500 -- [-1835.867] (-1838.069) (-1846.093) (-1839.521) * [-1836.904] (-1842.900) (-1836.391) (-1831.995) -- 0:00:25
889000 -- (-1835.314) (-1838.463) (-1838.938) [-1836.211] * (-1830.155) (-1839.187) (-1840.213) [-1837.791] -- 0:00:25
889500 -- (-1837.273) [-1834.151] (-1835.106) (-1835.536) * (-1839.598) [-1839.333] (-1836.080) (-1834.168) -- 0:00:25
890000 -- (-1836.479) [-1832.858] (-1834.194) (-1840.390) * [-1840.163] (-1832.885) (-1833.815) (-1835.571) -- 0:00:25
Average standard deviation of split frequencies: 0.000000
890500 -- (-1837.586) [-1839.722] (-1843.578) (-1839.269) * (-1838.320) [-1833.981] (-1832.630) (-1836.554) -- 0:00:25
891000 -- (-1840.893) (-1838.208) [-1837.272] (-1833.727) * (-1833.752) (-1833.502) (-1837.464) [-1840.541] -- 0:00:25
891500 -- (-1839.248) [-1846.998] (-1841.051) (-1833.882) * (-1833.104) (-1834.429) (-1842.716) [-1832.946] -- 0:00:25
892000 -- [-1832.479] (-1844.866) (-1838.352) (-1837.756) * [-1834.470] (-1838.897) (-1837.832) (-1836.924) -- 0:00:25
892500 -- (-1836.022) (-1841.032) (-1834.850) [-1842.107] * [-1833.445] (-1835.724) (-1832.016) (-1835.287) -- 0:00:25
893000 -- (-1837.115) [-1836.216] (-1832.715) (-1839.425) * (-1838.395) (-1841.830) [-1834.910] (-1834.025) -- 0:00:24
893500 -- (-1834.143) (-1835.339) [-1836.441] (-1836.032) * (-1832.054) [-1837.924] (-1837.897) (-1837.804) -- 0:00:24
894000 -- (-1832.880) (-1834.552) (-1832.087) [-1835.538] * (-1835.522) (-1838.716) (-1834.912) [-1834.564] -- 0:00:24
894500 -- (-1838.958) [-1832.045] (-1834.739) (-1835.399) * (-1840.648) [-1833.275] (-1835.986) (-1837.396) -- 0:00:24
895000 -- (-1831.613) [-1833.999] (-1833.740) (-1839.363) * [-1838.861] (-1833.805) (-1835.158) (-1836.674) -- 0:00:24
Average standard deviation of split frequencies: 0.000000
895500 -- (-1837.532) (-1843.766) (-1834.963) [-1835.212] * (-1839.441) (-1830.810) [-1837.489] (-1837.943) -- 0:00:24
896000 -- (-1839.060) (-1833.707) (-1834.368) [-1836.683] * (-1838.617) (-1832.406) [-1838.347] (-1833.338) -- 0:00:24
896500 -- (-1834.190) (-1845.479) [-1837.530] (-1842.727) * (-1834.361) (-1840.823) [-1836.713] (-1837.065) -- 0:00:24
897000 -- (-1840.607) [-1842.507] (-1841.058) (-1838.346) * [-1835.507] (-1834.143) (-1841.420) (-1833.703) -- 0:00:23
897500 -- (-1835.233) (-1834.104) (-1834.860) [-1844.212] * [-1830.021] (-1845.582) (-1841.744) (-1837.256) -- 0:00:23
898000 -- (-1834.174) (-1834.261) [-1829.421] (-1850.341) * [-1831.218] (-1839.358) (-1840.472) (-1837.367) -- 0:00:23
898500 -- [-1832.637] (-1832.946) (-1837.880) (-1836.403) * (-1840.587) (-1834.669) [-1838.962] (-1839.029) -- 0:00:23
899000 -- [-1829.805] (-1839.786) (-1840.238) (-1838.683) * (-1831.395) [-1839.624] (-1833.162) (-1836.125) -- 0:00:23
899500 -- (-1837.242) (-1836.507) [-1845.186] (-1840.355) * [-1833.076] (-1836.077) (-1835.537) (-1839.280) -- 0:00:23
900000 -- (-1839.290) (-1835.417) [-1837.374] (-1843.880) * (-1831.941) [-1829.348] (-1833.376) (-1831.435) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
900500 -- (-1833.091) (-1837.765) (-1841.424) [-1833.995] * (-1832.690) (-1834.974) [-1834.320] (-1834.959) -- 0:00:23
901000 -- (-1838.034) (-1835.166) (-1833.712) [-1833.861] * (-1845.005) [-1831.518] (-1839.172) (-1836.401) -- 0:00:23
901500 -- (-1839.108) (-1841.579) [-1836.267] (-1840.481) * (-1837.212) [-1835.436] (-1843.400) (-1834.759) -- 0:00:22
902000 -- (-1844.346) (-1836.501) [-1832.780] (-1840.340) * (-1840.521) (-1832.415) (-1843.238) [-1840.527] -- 0:00:22
902500 -- [-1839.459] (-1839.531) (-1833.905) (-1835.943) * [-1833.852] (-1833.732) (-1837.648) (-1833.191) -- 0:00:22
903000 -- [-1839.179] (-1841.000) (-1830.019) (-1837.601) * [-1837.614] (-1833.341) (-1835.225) (-1834.258) -- 0:00:22
903500 -- (-1835.652) (-1836.840) [-1836.365] (-1828.862) * (-1835.241) (-1839.891) (-1839.949) [-1836.335] -- 0:00:22
904000 -- (-1835.438) (-1841.276) (-1836.821) [-1832.708] * [-1840.234] (-1833.346) (-1839.239) (-1833.740) -- 0:00:22
904500 -- (-1835.553) [-1834.525] (-1839.425) (-1835.542) * (-1836.208) (-1838.139) [-1833.555] (-1836.986) -- 0:00:22
905000 -- (-1839.395) [-1838.783] (-1837.953) (-1838.512) * (-1836.382) (-1835.680) (-1836.165) [-1836.641] -- 0:00:22
Average standard deviation of split frequencies: 0.000000
905500 -- [-1833.941] (-1835.737) (-1838.693) (-1837.491) * (-1837.274) [-1837.511] (-1838.453) (-1837.731) -- 0:00:22
906000 -- (-1840.207) (-1840.917) (-1846.845) [-1832.959] * (-1840.558) (-1835.061) [-1834.515] (-1835.015) -- 0:00:21
906500 -- [-1831.629] (-1835.214) (-1845.544) (-1838.033) * (-1847.143) (-1830.486) [-1833.972] (-1836.524) -- 0:00:21
907000 -- [-1834.991] (-1842.065) (-1839.117) (-1836.749) * (-1844.873) [-1836.566] (-1830.412) (-1835.722) -- 0:00:21
907500 -- (-1837.522) [-1835.893] (-1846.304) (-1839.960) * [-1832.784] (-1842.043) (-1832.667) (-1839.768) -- 0:00:21
908000 -- (-1835.369) (-1836.003) (-1839.519) [-1832.964] * (-1834.274) (-1839.362) [-1838.066] (-1842.370) -- 0:00:21
908500 -- (-1837.956) (-1833.596) [-1837.565] (-1830.288) * (-1834.472) (-1838.160) [-1830.192] (-1834.214) -- 0:00:21
909000 -- [-1837.511] (-1839.287) (-1834.366) (-1833.700) * (-1836.759) [-1837.110] (-1833.969) (-1831.345) -- 0:00:21
909500 -- (-1833.805) [-1840.135] (-1834.737) (-1837.223) * (-1846.520) (-1847.431) (-1834.713) [-1838.980] -- 0:00:21
910000 -- (-1844.553) [-1838.671] (-1838.244) (-1846.731) * (-1843.490) (-1836.786) [-1832.820] (-1832.415) -- 0:00:20
Average standard deviation of split frequencies: 0.000000
910500 -- (-1842.022) [-1838.912] (-1845.095) (-1840.145) * (-1842.178) (-1835.831) (-1836.182) [-1836.967] -- 0:00:20
911000 -- (-1841.016) [-1834.096] (-1834.657) (-1839.645) * (-1844.693) (-1835.791) [-1841.142] (-1832.628) -- 0:00:20
911500 -- (-1834.186) [-1833.300] (-1840.438) (-1839.736) * [-1835.975] (-1833.187) (-1842.915) (-1832.086) -- 0:00:20
912000 -- (-1840.477) (-1836.707) [-1838.259] (-1835.763) * (-1835.747) (-1836.901) [-1842.564] (-1833.530) -- 0:00:20
912500 -- [-1836.606] (-1837.960) (-1845.366) (-1841.653) * (-1832.949) [-1835.063] (-1837.991) (-1840.758) -- 0:00:20
913000 -- (-1839.845) (-1834.700) (-1842.607) [-1836.772] * (-1835.716) (-1835.090) (-1832.781) [-1835.280] -- 0:00:20
913500 -- (-1837.297) (-1839.711) [-1835.099] (-1835.064) * (-1835.422) [-1833.244] (-1841.582) (-1837.823) -- 0:00:20
914000 -- [-1834.101] (-1838.855) (-1835.504) (-1837.178) * (-1837.681) (-1834.372) (-1834.456) [-1841.393] -- 0:00:20
914500 -- (-1839.462) [-1835.256] (-1839.020) (-1832.275) * (-1841.573) (-1842.308) (-1832.322) [-1836.060] -- 0:00:19
915000 -- (-1838.035) (-1838.010) (-1835.317) [-1840.603] * (-1840.978) [-1845.817] (-1835.707) (-1840.612) -- 0:00:19
Average standard deviation of split frequencies: 0.000000
915500 -- (-1837.549) [-1835.189] (-1841.461) (-1837.762) * (-1834.946) [-1836.427] (-1836.493) (-1839.566) -- 0:00:19
916000 -- (-1835.904) [-1834.667] (-1834.269) (-1835.826) * (-1833.288) (-1833.108) [-1832.195] (-1836.406) -- 0:00:19
916500 -- (-1836.565) [-1838.539] (-1835.512) (-1838.109) * (-1833.751) [-1834.764] (-1838.560) (-1831.623) -- 0:00:19
917000 -- (-1841.071) (-1836.864) [-1830.561] (-1838.731) * (-1838.872) (-1836.489) (-1836.620) [-1839.716] -- 0:00:19
917500 -- (-1845.208) [-1833.752] (-1834.366) (-1838.617) * (-1836.263) [-1835.162] (-1837.612) (-1843.512) -- 0:00:19
918000 -- (-1836.016) [-1836.521] (-1835.583) (-1843.661) * [-1835.080] (-1831.497) (-1838.407) (-1833.458) -- 0:00:19
918500 -- (-1833.739) [-1834.190] (-1836.166) (-1837.188) * (-1833.993) [-1835.978] (-1835.730) (-1839.029) -- 0:00:18
919000 -- (-1833.102) (-1841.590) [-1838.025] (-1840.467) * [-1837.432] (-1838.491) (-1838.370) (-1839.361) -- 0:00:18
919500 -- [-1836.675] (-1838.302) (-1837.170) (-1834.910) * (-1835.297) (-1839.423) (-1832.758) [-1842.113] -- 0:00:18
920000 -- (-1834.341) (-1842.847) [-1835.431] (-1837.826) * [-1831.413] (-1837.630) (-1833.205) (-1838.783) -- 0:00:18
Average standard deviation of split frequencies: 0.000000
920500 -- (-1837.381) (-1839.797) [-1834.169] (-1838.886) * (-1840.444) (-1840.425) [-1836.055] (-1839.765) -- 0:00:18
921000 -- (-1840.165) (-1837.388) [-1835.054] (-1840.423) * (-1837.406) [-1834.837] (-1836.133) (-1836.143) -- 0:00:18
921500 -- (-1835.486) (-1834.172) [-1834.822] (-1837.108) * (-1833.218) (-1833.039) (-1838.797) [-1831.722] -- 0:00:18
922000 -- [-1833.786] (-1836.954) (-1830.100) (-1828.499) * (-1841.836) (-1836.870) [-1835.496] (-1832.663) -- 0:00:18
922500 -- (-1844.677) [-1830.891] (-1836.059) (-1838.868) * (-1833.899) (-1838.352) (-1840.043) [-1830.136] -- 0:00:18
923000 -- (-1835.547) (-1838.378) [-1833.907] (-1833.528) * (-1836.805) (-1836.510) (-1835.794) [-1832.757] -- 0:00:17
923500 -- (-1838.100) [-1835.306] (-1832.677) (-1840.898) * [-1841.557] (-1844.241) (-1834.702) (-1834.452) -- 0:00:17
924000 -- (-1829.713) (-1835.421) (-1835.073) [-1835.718] * (-1834.053) (-1844.103) (-1836.705) [-1835.416] -- 0:00:17
924500 -- (-1841.043) (-1838.789) (-1834.088) [-1837.759] * (-1840.124) [-1839.891] (-1840.470) (-1834.988) -- 0:00:17
925000 -- [-1837.977] (-1836.813) (-1832.849) (-1833.220) * (-1833.030) [-1833.005] (-1836.826) (-1835.767) -- 0:00:17
Average standard deviation of split frequencies: 0.000000
925500 -- (-1839.832) (-1830.045) [-1829.681] (-1839.295) * (-1842.843) [-1838.457] (-1839.411) (-1842.109) -- 0:00:17
926000 -- (-1839.336) (-1830.439) [-1832.249] (-1839.862) * [-1837.860] (-1835.698) (-1838.990) (-1840.896) -- 0:00:17
926500 -- (-1832.334) (-1837.145) (-1843.600) [-1837.669] * (-1837.612) (-1834.338) (-1834.959) [-1841.221] -- 0:00:17
927000 -- (-1834.386) (-1841.156) (-1842.757) [-1837.548] * (-1833.143) (-1833.052) [-1833.533] (-1843.616) -- 0:00:17
927500 -- (-1838.031) (-1836.789) (-1837.325) [-1838.515] * [-1835.796] (-1837.254) (-1838.077) (-1841.511) -- 0:00:16
928000 -- (-1835.948) (-1834.555) (-1836.732) [-1833.144] * [-1833.180] (-1842.319) (-1839.692) (-1833.242) -- 0:00:16
928500 -- (-1839.412) (-1836.893) [-1836.596] (-1832.056) * (-1845.158) [-1835.113] (-1839.342) (-1835.223) -- 0:00:16
929000 -- (-1838.776) [-1833.268] (-1835.085) (-1834.442) * (-1839.915) [-1834.669] (-1843.477) (-1836.131) -- 0:00:16
929500 -- [-1832.925] (-1839.929) (-1834.562) (-1832.524) * (-1833.401) (-1842.144) (-1835.681) [-1836.822] -- 0:00:16
930000 -- [-1834.846] (-1841.607) (-1838.145) (-1839.432) * [-1835.357] (-1832.165) (-1834.628) (-1838.427) -- 0:00:16
Average standard deviation of split frequencies: 0.000000
930500 -- [-1842.100] (-1835.921) (-1843.452) (-1838.999) * (-1842.761) (-1831.103) (-1833.978) [-1831.053] -- 0:00:16
931000 -- (-1838.403) (-1836.897) (-1838.383) [-1834.205] * (-1833.987) [-1836.583] (-1834.812) (-1831.197) -- 0:00:16
931500 -- (-1836.087) (-1838.215) (-1835.373) [-1835.925] * [-1847.894] (-1837.354) (-1832.365) (-1835.805) -- 0:00:15
932000 -- (-1845.798) (-1831.880) [-1834.205] (-1834.033) * (-1839.215) (-1833.775) (-1833.995) [-1834.809] -- 0:00:15
932500 -- (-1838.419) (-1837.703) (-1833.083) [-1833.073] * (-1836.899) (-1831.727) [-1832.721] (-1839.733) -- 0:00:15
933000 -- (-1834.412) (-1839.759) (-1837.548) [-1835.434] * (-1839.100) (-1837.327) [-1833.432] (-1832.663) -- 0:00:15
933500 -- (-1841.119) (-1832.441) (-1838.964) [-1837.228] * (-1832.218) (-1834.068) (-1834.720) [-1832.433] -- 0:00:15
934000 -- (-1834.271) (-1835.682) [-1849.269] (-1838.753) * (-1835.777) (-1835.014) [-1836.663] (-1843.160) -- 0:00:15
934500 -- (-1839.412) (-1839.790) [-1840.170] (-1836.631) * [-1837.999] (-1839.702) (-1832.409) (-1839.698) -- 0:00:15
935000 -- (-1835.756) (-1834.980) (-1850.917) [-1831.941] * (-1838.948) [-1834.577] (-1838.456) (-1838.087) -- 0:00:15
Average standard deviation of split frequencies: 0.000000
935500 -- (-1837.416) (-1843.129) (-1847.679) [-1831.142] * (-1836.313) (-1838.606) [-1834.537] (-1838.894) -- 0:00:15
936000 -- (-1837.897) (-1840.524) (-1843.796) [-1833.932] * (-1836.122) [-1836.212] (-1837.368) (-1841.370) -- 0:00:14
936500 -- (-1835.731) (-1837.861) (-1840.504) [-1829.302] * (-1836.413) (-1836.666) [-1840.222] (-1846.457) -- 0:00:14
937000 -- (-1834.950) (-1839.288) (-1835.264) [-1829.990] * (-1836.858) [-1830.988] (-1832.560) (-1835.366) -- 0:00:14
937500 -- (-1835.581) [-1836.358] (-1836.284) (-1835.777) * [-1837.291] (-1832.508) (-1835.059) (-1834.081) -- 0:00:14
938000 -- (-1841.713) (-1837.281) [-1835.100] (-1832.233) * (-1837.372) (-1834.548) [-1841.307] (-1836.320) -- 0:00:14
938500 -- [-1839.571] (-1837.955) (-1833.790) (-1829.630) * (-1842.511) [-1835.596] (-1837.016) (-1840.742) -- 0:00:14
939000 -- (-1839.866) (-1837.545) (-1831.474) [-1835.624] * (-1839.643) (-1843.730) [-1841.643] (-1838.546) -- 0:00:14
939500 -- (-1844.161) (-1841.374) [-1833.141] (-1836.499) * (-1837.568) (-1834.448) [-1837.260] (-1834.774) -- 0:00:14
940000 -- (-1839.540) (-1836.050) [-1832.903] (-1843.188) * (-1832.329) (-1835.955) [-1835.467] (-1837.051) -- 0:00:13
Average standard deviation of split frequencies: 0.000000
940500 -- (-1835.485) [-1835.142] (-1835.612) (-1835.688) * [-1836.384] (-1839.855) (-1837.218) (-1839.932) -- 0:00:13
941000 -- [-1836.933] (-1830.746) (-1837.436) (-1835.735) * (-1841.327) (-1833.556) [-1833.376] (-1840.559) -- 0:00:13
941500 -- (-1839.938) (-1838.143) (-1837.259) [-1834.230] * (-1846.890) [-1837.573] (-1839.500) (-1835.390) -- 0:00:13
942000 -- [-1836.647] (-1836.095) (-1835.091) (-1834.199) * [-1837.279] (-1838.050) (-1838.578) (-1839.772) -- 0:00:13
942500 -- (-1841.263) (-1843.649) [-1833.460] (-1831.604) * [-1835.486] (-1832.580) (-1838.478) (-1836.165) -- 0:00:13
943000 -- (-1844.391) (-1834.227) [-1835.162] (-1847.363) * (-1836.189) [-1833.455] (-1841.993) (-1836.292) -- 0:00:13
943500 -- (-1841.787) [-1832.527] (-1834.570) (-1853.227) * [-1837.722] (-1838.308) (-1852.136) (-1837.696) -- 0:00:13
944000 -- (-1839.928) (-1836.485) [-1836.924] (-1838.084) * [-1842.658] (-1836.892) (-1837.833) (-1840.420) -- 0:00:13
944500 -- (-1840.969) (-1837.140) (-1835.868) [-1831.640] * (-1834.560) [-1831.099] (-1837.718) (-1839.045) -- 0:00:12
945000 -- [-1840.338] (-1834.227) (-1830.949) (-1834.887) * (-1841.709) (-1832.459) (-1837.579) [-1838.203] -- 0:00:12
Average standard deviation of split frequencies: 0.000000
945500 -- [-1837.357] (-1837.322) (-1834.350) (-1835.835) * (-1840.793) [-1835.831] (-1833.876) (-1841.182) -- 0:00:12
946000 -- (-1838.205) (-1844.453) (-1829.433) [-1835.478] * (-1843.564) (-1837.912) (-1835.156) [-1831.720] -- 0:00:12
946500 -- (-1842.037) (-1835.586) (-1833.634) [-1832.669] * [-1836.348] (-1840.672) (-1836.922) (-1832.180) -- 0:00:12
947000 -- (-1834.757) (-1834.447) [-1837.814] (-1833.477) * (-1839.205) (-1832.461) (-1838.175) [-1839.071] -- 0:00:12
947500 -- (-1833.729) [-1838.676] (-1839.314) (-1841.741) * (-1837.783) (-1836.881) [-1840.318] (-1831.663) -- 0:00:12
948000 -- (-1833.475) [-1839.841] (-1831.461) (-1841.313) * (-1835.809) [-1841.319] (-1839.674) (-1836.179) -- 0:00:12
948500 -- [-1842.366] (-1835.513) (-1835.233) (-1843.957) * (-1840.119) [-1830.688] (-1837.703) (-1834.679) -- 0:00:11
949000 -- [-1838.616] (-1839.161) (-1837.096) (-1839.348) * (-1838.696) (-1833.188) (-1839.055) [-1836.270] -- 0:00:11
949500 -- [-1839.680] (-1835.574) (-1832.618) (-1840.750) * (-1841.548) (-1834.116) [-1837.002] (-1841.593) -- 0:00:11
950000 -- (-1839.642) (-1831.859) (-1832.332) [-1835.120] * (-1840.841) (-1850.005) [-1835.066] (-1835.258) -- 0:00:11
Average standard deviation of split frequencies: 0.000000
950500 -- (-1842.035) [-1833.216] (-1838.999) (-1837.292) * (-1838.523) [-1838.719] (-1835.679) (-1832.686) -- 0:00:11
951000 -- [-1832.733] (-1831.664) (-1836.364) (-1837.318) * (-1835.158) (-1837.576) (-1832.635) [-1830.456] -- 0:00:11
951500 -- (-1834.630) [-1837.034] (-1835.664) (-1833.170) * [-1836.887] (-1838.934) (-1835.694) (-1835.982) -- 0:00:11
952000 -- [-1829.462] (-1842.536) (-1831.504) (-1842.551) * [-1834.783] (-1837.650) (-1842.538) (-1853.992) -- 0:00:11
952500 -- (-1830.595) (-1832.841) (-1837.300) [-1834.428] * (-1837.977) (-1831.010) [-1833.214] (-1839.917) -- 0:00:11
953000 -- (-1832.988) (-1830.806) [-1833.884] (-1840.057) * (-1836.963) (-1834.064) (-1840.547) [-1840.254] -- 0:00:10
953500 -- [-1833.142] (-1832.689) (-1836.342) (-1841.219) * [-1841.669] (-1833.122) (-1839.091) (-1841.961) -- 0:00:10
954000 -- (-1834.447) [-1838.386] (-1837.360) (-1836.266) * (-1835.737) (-1831.855) [-1843.628] (-1837.968) -- 0:00:10
954500 -- (-1834.104) (-1843.278) [-1839.008] (-1843.341) * (-1834.836) (-1843.535) (-1837.801) [-1833.806] -- 0:00:10
955000 -- (-1842.447) [-1837.261] (-1844.476) (-1842.630) * (-1841.261) (-1835.405) (-1839.415) [-1833.140] -- 0:00:10
Average standard deviation of split frequencies: 0.000000
955500 -- (-1836.111) (-1837.419) [-1834.027] (-1837.554) * [-1838.849] (-1836.834) (-1836.784) (-1832.258) -- 0:00:10
956000 -- (-1838.723) (-1834.575) (-1842.840) [-1840.790] * (-1833.140) (-1834.639) [-1831.862] (-1833.364) -- 0:00:10
956500 -- [-1843.358] (-1840.762) (-1841.355) (-1837.100) * [-1834.862] (-1843.826) (-1836.938) (-1834.373) -- 0:00:10
957000 -- (-1835.429) (-1838.289) [-1839.116] (-1834.874) * [-1832.334] (-1844.113) (-1832.533) (-1834.251) -- 0:00:10
957500 -- (-1832.865) (-1832.912) (-1837.132) [-1841.263] * [-1832.905] (-1837.744) (-1840.624) (-1843.720) -- 0:00:09
958000 -- [-1832.879] (-1831.447) (-1844.411) (-1841.568) * (-1836.986) (-1836.961) (-1838.292) [-1834.503] -- 0:00:09
958500 -- (-1832.535) (-1834.875) (-1836.169) [-1835.547] * (-1833.849) (-1846.159) (-1832.498) [-1836.674] -- 0:00:09
959000 -- (-1841.527) (-1832.671) [-1836.444] (-1830.561) * (-1831.190) (-1835.158) [-1836.976] (-1841.913) -- 0:00:09
959500 -- (-1831.434) (-1832.535) [-1833.899] (-1838.075) * [-1836.320] (-1838.477) (-1841.750) (-1835.116) -- 0:00:09
960000 -- (-1835.838) (-1834.363) (-1833.898) [-1834.787] * [-1842.605] (-1842.585) (-1839.440) (-1843.121) -- 0:00:09
Average standard deviation of split frequencies: 0.000000
960500 -- (-1832.196) [-1832.905] (-1840.957) (-1832.845) * [-1840.268] (-1834.698) (-1840.853) (-1834.012) -- 0:00:09
961000 -- (-1846.136) (-1834.436) [-1837.981] (-1833.055) * (-1835.435) (-1838.879) (-1847.350) [-1836.864] -- 0:00:09
961500 -- (-1840.258) [-1838.912] (-1838.845) (-1840.605) * (-1835.553) (-1832.647) [-1839.117] (-1837.117) -- 0:00:08
962000 -- (-1833.523) (-1839.844) [-1839.240] (-1833.171) * (-1832.276) (-1836.666) (-1837.519) [-1834.653] -- 0:00:08
962500 -- (-1836.804) (-1834.420) [-1832.121] (-1842.599) * [-1835.764] (-1845.917) (-1836.981) (-1834.205) -- 0:00:08
963000 -- [-1836.007] (-1835.405) (-1838.479) (-1834.887) * (-1842.157) (-1835.501) [-1835.342] (-1831.990) -- 0:00:08
963500 -- (-1840.997) (-1829.517) (-1838.020) [-1839.928] * (-1840.042) (-1835.754) [-1836.348] (-1838.039) -- 0:00:08
964000 -- (-1845.231) (-1840.688) [-1837.179] (-1834.170) * (-1836.696) (-1833.539) (-1836.418) [-1832.622] -- 0:00:08
964500 -- (-1834.902) (-1841.793) [-1831.868] (-1840.960) * (-1833.953) (-1834.460) [-1833.245] (-1838.734) -- 0:00:08
965000 -- (-1836.814) (-1834.538) (-1837.063) [-1835.043] * (-1839.360) [-1834.715] (-1835.083) (-1844.286) -- 0:00:08
Average standard deviation of split frequencies: 0.000000
965500 -- (-1835.768) [-1836.769] (-1840.905) (-1836.847) * (-1836.106) (-1835.307) (-1841.485) [-1837.101] -- 0:00:08
966000 -- (-1835.599) (-1836.550) (-1833.543) [-1839.587] * (-1840.075) [-1838.744] (-1837.609) (-1839.086) -- 0:00:07
966500 -- (-1834.304) [-1843.176] (-1835.155) (-1845.130) * (-1836.389) (-1847.206) [-1836.837] (-1836.671) -- 0:00:07
967000 -- [-1830.087] (-1842.080) (-1835.667) (-1840.264) * (-1838.915) [-1842.766] (-1838.329) (-1834.656) -- 0:00:07
967500 -- (-1833.016) (-1837.297) [-1832.820] (-1836.619) * (-1831.554) [-1838.955] (-1837.079) (-1835.099) -- 0:00:07
968000 -- (-1832.744) (-1840.972) [-1829.820] (-1839.287) * [-1836.335] (-1832.795) (-1839.407) (-1838.459) -- 0:00:07
968500 -- [-1831.692] (-1844.935) (-1835.022) (-1838.484) * (-1833.721) [-1833.174] (-1840.370) (-1832.180) -- 0:00:07
969000 -- [-1833.155] (-1836.906) (-1833.611) (-1845.481) * (-1836.547) (-1830.644) (-1836.929) [-1829.707] -- 0:00:07
969500 -- (-1837.796) (-1832.915) (-1835.064) [-1833.995] * [-1830.851] (-1834.555) (-1840.787) (-1841.680) -- 0:00:07
970000 -- [-1833.823] (-1838.221) (-1831.927) (-1837.210) * (-1835.836) (-1834.792) (-1836.418) [-1835.004] -- 0:00:06
Average standard deviation of split frequencies: 0.000000
970500 -- (-1840.114) (-1837.978) [-1833.135] (-1836.441) * [-1837.091] (-1832.103) (-1831.618) (-1832.315) -- 0:00:06
971000 -- (-1840.954) (-1832.722) (-1838.142) [-1836.606] * (-1836.264) (-1834.600) [-1837.656] (-1837.256) -- 0:00:06
971500 -- (-1838.359) (-1835.872) [-1835.241] (-1830.913) * [-1835.878] (-1838.198) (-1837.589) (-1834.514) -- 0:00:06
972000 -- (-1839.272) [-1837.660] (-1839.200) (-1835.459) * (-1847.073) (-1830.139) [-1833.338] (-1838.472) -- 0:00:06
972500 -- (-1837.371) (-1831.877) (-1835.845) [-1836.301] * [-1833.694] (-1845.658) (-1843.291) (-1836.655) -- 0:00:06
973000 -- [-1848.046] (-1843.544) (-1835.629) (-1830.383) * [-1840.452] (-1836.425) (-1834.053) (-1831.707) -- 0:00:06
973500 -- (-1838.775) (-1835.084) [-1834.128] (-1835.556) * (-1830.929) [-1835.007] (-1835.388) (-1853.085) -- 0:00:06
974000 -- (-1837.667) (-1845.309) [-1830.811] (-1838.231) * (-1833.294) (-1842.194) [-1836.943] (-1837.521) -- 0:00:06
974500 -- (-1840.605) [-1836.924] (-1835.431) (-1839.692) * (-1832.246) [-1834.822] (-1834.550) (-1834.782) -- 0:00:05
975000 -- (-1841.114) (-1835.610) [-1836.283] (-1843.252) * [-1830.789] (-1838.119) (-1841.237) (-1831.634) -- 0:00:05
Average standard deviation of split frequencies: 0.000000
975500 -- (-1836.885) (-1835.585) [-1836.443] (-1837.403) * [-1836.766] (-1836.723) (-1833.067) (-1833.744) -- 0:00:05
976000 -- (-1833.219) (-1834.236) (-1837.932) [-1839.176] * (-1834.670) (-1833.906) [-1837.697] (-1836.214) -- 0:00:05
976500 -- (-1841.467) [-1828.353] (-1840.687) (-1836.991) * (-1843.877) (-1834.450) [-1834.964] (-1844.550) -- 0:00:05
977000 -- (-1839.051) (-1833.318) (-1839.047) [-1837.015] * (-1840.142) (-1840.636) (-1835.036) [-1839.345] -- 0:00:05
977500 -- (-1833.235) (-1837.185) [-1833.872] (-1833.526) * (-1837.163) (-1836.185) [-1834.789] (-1838.177) -- 0:00:05
978000 -- (-1833.627) (-1843.772) [-1834.471] (-1831.702) * (-1838.984) (-1827.901) [-1837.747] (-1842.095) -- 0:00:05
978500 -- (-1834.795) (-1843.346) [-1837.529] (-1835.502) * (-1836.540) [-1834.838] (-1833.953) (-1834.307) -- 0:00:05
979000 -- (-1839.919) [-1835.265] (-1845.441) (-1839.166) * (-1844.609) (-1841.598) (-1839.566) [-1839.133] -- 0:00:04
979500 -- (-1836.018) [-1834.544] (-1837.407) (-1835.745) * (-1836.700) [-1833.828] (-1834.462) (-1836.603) -- 0:00:04
980000 -- (-1836.258) (-1837.748) [-1837.725] (-1835.390) * [-1831.484] (-1838.472) (-1839.920) (-1839.158) -- 0:00:04
Average standard deviation of split frequencies: 0.000000
980500 -- (-1834.687) (-1835.388) [-1831.329] (-1833.945) * [-1837.601] (-1834.813) (-1835.059) (-1835.215) -- 0:00:04
981000 -- (-1838.951) (-1836.234) [-1830.128] (-1833.673) * (-1840.830) (-1835.317) (-1840.661) [-1838.667] -- 0:00:04
981500 -- [-1831.747] (-1835.053) (-1840.341) (-1833.546) * [-1838.015] (-1834.661) (-1839.291) (-1838.995) -- 0:00:04
982000 -- [-1831.403] (-1841.540) (-1843.611) (-1841.968) * (-1835.683) (-1833.210) [-1836.869] (-1837.672) -- 0:00:04
982500 -- (-1831.948) (-1833.979) [-1832.325] (-1838.466) * [-1834.211] (-1832.960) (-1842.447) (-1836.580) -- 0:00:04
983000 -- (-1839.185) (-1839.552) [-1831.626] (-1833.432) * (-1841.145) (-1839.078) [-1840.333] (-1839.106) -- 0:00:03
983500 -- [-1844.201] (-1834.256) (-1839.931) (-1839.403) * (-1839.661) (-1839.029) (-1841.436) [-1837.720] -- 0:00:03
984000 -- [-1839.688] (-1834.923) (-1838.122) (-1841.840) * [-1834.949] (-1835.381) (-1835.830) (-1837.364) -- 0:00:03
984500 -- (-1836.860) [-1840.869] (-1835.434) (-1836.897) * [-1830.668] (-1840.930) (-1838.245) (-1838.280) -- 0:00:03
985000 -- (-1835.542) [-1834.500] (-1837.111) (-1835.045) * [-1837.183] (-1843.807) (-1835.057) (-1843.612) -- 0:00:03
Average standard deviation of split frequencies: 0.000000
985500 -- (-1835.749) (-1835.137) [-1834.236] (-1841.650) * (-1841.098) (-1838.517) (-1836.930) [-1832.181] -- 0:00:03
986000 -- (-1838.188) (-1837.908) [-1838.261] (-1839.772) * [-1835.163] (-1836.686) (-1835.981) (-1834.785) -- 0:00:03
986500 -- (-1841.716) (-1836.368) (-1838.396) [-1835.435] * (-1835.311) (-1838.737) [-1836.154] (-1834.450) -- 0:00:03
987000 -- (-1834.698) [-1832.804] (-1834.707) (-1834.167) * (-1842.614) (-1833.927) (-1839.207) [-1835.916] -- 0:00:03
987500 -- (-1835.284) (-1831.835) (-1831.682) [-1835.483] * [-1845.529] (-1833.760) (-1837.542) (-1833.406) -- 0:00:02
988000 -- [-1836.235] (-1835.167) (-1835.925) (-1838.875) * (-1836.467) [-1832.657] (-1829.674) (-1840.117) -- 0:00:02
988500 -- (-1835.940) (-1832.808) (-1841.726) [-1834.694] * (-1838.968) (-1831.437) [-1841.027] (-1841.533) -- 0:00:02
989000 -- (-1834.008) [-1831.605] (-1836.274) (-1837.896) * (-1836.834) [-1834.363] (-1842.901) (-1837.308) -- 0:00:02
989500 -- [-1833.958] (-1837.234) (-1837.276) (-1839.148) * (-1836.593) [-1830.419] (-1838.706) (-1837.029) -- 0:00:02
990000 -- (-1832.847) (-1834.334) (-1837.725) [-1836.794] * (-1839.691) (-1840.237) (-1829.870) [-1837.802] -- 0:00:02
Average standard deviation of split frequencies: 0.000000
990500 -- [-1829.932] (-1837.132) (-1836.511) (-1840.707) * [-1837.471] (-1839.481) (-1837.450) (-1833.151) -- 0:00:02
991000 -- (-1843.319) [-1827.687] (-1836.253) (-1834.050) * [-1831.954] (-1839.472) (-1830.876) (-1834.989) -- 0:00:02
991500 -- (-1839.810) [-1841.963] (-1834.358) (-1835.884) * (-1834.432) [-1841.062] (-1839.994) (-1838.565) -- 0:00:01
992000 -- (-1839.982) (-1844.303) [-1834.824] (-1833.679) * (-1842.303) (-1836.774) [-1834.086] (-1835.433) -- 0:00:01
992500 -- [-1832.623] (-1835.247) (-1833.319) (-1836.954) * (-1835.496) (-1839.507) [-1832.807] (-1840.941) -- 0:00:01
993000 -- [-1834.605] (-1836.690) (-1836.959) (-1839.348) * (-1833.068) (-1835.597) [-1837.155] (-1840.942) -- 0:00:01
993500 -- (-1835.602) (-1838.848) [-1838.095] (-1833.896) * (-1841.755) (-1833.335) (-1837.610) [-1835.448] -- 0:00:01
994000 -- (-1832.251) [-1833.536] (-1832.834) (-1840.688) * (-1839.108) (-1839.962) (-1832.622) [-1830.544] -- 0:00:01
994500 -- [-1833.498] (-1838.186) (-1837.619) (-1836.954) * (-1836.551) (-1834.455) [-1832.171] (-1835.075) -- 0:00:01
995000 -- [-1833.473] (-1848.349) (-1829.871) (-1840.096) * (-1835.089) (-1837.844) (-1836.560) [-1833.246] -- 0:00:01
Average standard deviation of split frequencies: 0.000000
995500 -- (-1845.033) (-1833.979) (-1834.224) [-1835.587] * (-1834.584) [-1835.361] (-1830.746) (-1837.267) -- 0:00:01
996000 -- (-1841.415) (-1841.370) [-1832.382] (-1841.906) * (-1834.310) (-1838.365) [-1833.307] (-1842.540) -- 0:00:00
996500 -- (-1837.822) (-1836.106) (-1838.263) [-1837.843] * (-1838.797) [-1833.678] (-1832.532) (-1832.597) -- 0:00:00
997000 -- (-1836.031) (-1835.116) (-1839.851) [-1834.456] * [-1840.705] (-1845.735) (-1841.090) (-1831.022) -- 0:00:00
997500 -- (-1835.545) [-1844.457] (-1836.208) (-1834.923) * (-1840.933) [-1836.341] (-1837.850) (-1837.577) -- 0:00:00
998000 -- (-1838.284) (-1837.776) (-1837.224) [-1833.909] * (-1831.428) (-1842.849) [-1842.840] (-1836.478) -- 0:00:00
998500 -- [-1834.608] (-1833.053) (-1842.137) (-1838.181) * (-1832.270) (-1844.904) [-1836.083] (-1835.150) -- 0:00:00
999000 -- (-1845.042) [-1839.565] (-1837.552) (-1833.872) * (-1835.440) [-1836.350] (-1835.456) (-1841.120) -- 0:00:00
999500 -- (-1841.203) [-1840.311] (-1832.859) (-1836.917) * (-1834.259) [-1838.579] (-1834.788) (-1836.164) -- 0:00:00
1000000 -- [-1835.479] (-1839.625) (-1837.478) (-1838.761) * (-1836.245) (-1837.094) (-1843.588) [-1832.899] -- 0:00:00
Average standard deviation of split frequencies: 0.000000
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1835.478574 -- 7.370826
Chain 1 -- -1835.478575 -- 7.370826
Chain 2 -- -1839.624956 -- 5.421969
Chain 2 -- -1839.624956 -- 5.421969
Chain 3 -- -1837.477968 -- 9.965708
Chain 3 -- -1837.477969 -- 9.965708
Chain 4 -- -1838.761119 -- 5.880432
Chain 4 -- -1838.761116 -- 5.880432
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1836.245383 -- 2.992477
Chain 1 -- -1836.245383 -- 2.992477
Chain 2 -- -1837.094129 -- 2.912599
Chain 2 -- -1837.094126 -- 2.912599
Chain 3 -- -1843.588175 -- 5.651565
Chain 3 -- -1843.588172 -- 5.651565
Chain 4 -- -1832.899476 -- 4.128084
Chain 4 -- -1832.899475 -- 4.128084
Analysis completed in 3 mins 53 seconds
Analysis used 233.00 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1825.57
Likelihood of best state for "cold" chain of run 2 was -1825.57
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
53.4 % ( 46 %) Dirichlet(Revmat{all})
67.3 % ( 62 %) Slider(Revmat{all})
26.3 % ( 27 %) Dirichlet(Pi{all})
27.9 % ( 16 %) Slider(Pi{all})
54.0 % ( 37 %) Multiplier(Alpha{1,2})
42.4 % ( 26 %) Multiplier(Alpha{3})
50.4 % ( 27 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
26.0 % ( 26 %) Multiplier(V{all})
28.6 % ( 19 %) Nodeslider(V{all})
25.7 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
52.1 % ( 40 %) Dirichlet(Revmat{all})
68.0 % ( 57 %) Slider(Revmat{all})
26.3 % ( 36 %) Dirichlet(Pi{all})
28.2 % ( 20 %) Slider(Pi{all})
54.5 % ( 21 %) Multiplier(Alpha{1,2})
42.7 % ( 29 %) Multiplier(Alpha{3})
50.2 % ( 22 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
26.1 % ( 28 %) Multiplier(V{all})
28.4 % ( 31 %) Nodeslider(V{all})
25.6 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.58
2 | 165841 0.85 0.72
3 | 166685 166517 0.86
4 | 167150 167047 166760
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166573 0.85 0.72
3 | 165801 167393 0.86
4 | 166538 166918 166777
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1834.21
| 1 2 |
| * 2 |
| 2 1 2 21 |
|2 1 1 2 * 1 2 |
| 2 1 1 2 2 1 1 2 2 1 1 11|
| 221 * 1 2 1 11 1 21 2 1 1 |
| 22 1 1 1 1 2122 2 22 *2 * 2 2 1 2 |
| 2 2 1 2 1 11 2 22 * 2 22|
| 11 1 2 2 1 1 1 2 1 |
| 1 12 2 11 2 2 11 2 12 |
| 2 1 2 1 1 1 2 |
| 2 1 2 |
|1 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1837.55
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1832.45 -1843.38
2 -1832.43 -1841.68
--------------------------------------
TOTAL -1832.44 -1842.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.846188 0.012211 0.644539 1.073575 0.842553 1170.23 1335.61 1.001
r(A<->C){all} 0.089270 0.000875 0.033256 0.148649 0.086731 756.22 844.38 1.000
r(A<->G){all} 0.264636 0.002905 0.163336 0.369801 0.261354 653.85 714.56 1.004
r(A<->T){all} 0.140183 0.001519 0.073129 0.225351 0.137559 726.63 783.95 1.000
r(C<->G){all} 0.029796 0.000267 0.000001 0.059650 0.028111 978.62 1048.21 1.000
r(C<->T){all} 0.427524 0.003930 0.316969 0.560151 0.424281 634.58 715.50 1.003
r(G<->T){all} 0.048592 0.000494 0.005419 0.090241 0.046661 873.12 924.88 1.000
pi(A){all} 0.258112 0.000240 0.230352 0.288733 0.257727 1137.41 1184.02 1.000
pi(C){all} 0.273330 0.000230 0.244286 0.304597 0.273713 1125.31 1146.07 1.000
pi(G){all} 0.248965 0.000223 0.220335 0.278235 0.248794 1122.51 1136.55 1.000
pi(T){all} 0.219593 0.000195 0.192116 0.246307 0.219441 1256.76 1338.80 1.000
alpha{1,2} 0.054787 0.000901 0.000114 0.100545 0.056775 878.98 1057.53 1.000
alpha{3} 3.191450 0.883497 1.568388 5.067614 3.052710 1267.23 1268.26 1.000
pinvar{all} 0.380973 0.003162 0.275629 0.490988 0.382214 1054.52 1223.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ..***
7 -- ..**.
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 3002 1.000000 0.000000 1.000000 1.000000 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.068288 0.000683 0.018572 0.117902 0.066004 1.000 2
length{all}[2] 0.109199 0.000968 0.054751 0.170910 0.106436 1.000 2
length{all}[3] 0.147061 0.001432 0.079023 0.222815 0.143139 1.000 2
length{all}[4] 0.074108 0.000769 0.023558 0.129955 0.071065 1.000 2
length{all}[5] 0.090723 0.001112 0.031422 0.158080 0.087300 1.001 2
length{all}[6] 0.232364 0.003553 0.129497 0.356628 0.227301 1.000 2
length{all}[7] 0.124446 0.001604 0.053622 0.204073 0.120664 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000000
Maximum standard deviation of split frequencies = 0.000000
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
+ /------------------------ C3 (3)
| /----------100----------+
| | \------------------------ C4 (4)
\----------100----------+
\------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/---------- C1 (1)
|
|---------------- C2 (2)
|
+ /--------------------- C3 (3)
| /-----------------+
| | \---------- C4 (4)
\--------------------------------+
\------------- C5 (5)
|-------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1 tree sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 696
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
9 ambiguity characters in seq. 1
9 ambiguity characters in seq. 2
9 ambiguity characters in seq. 3
9 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
4 sites are removed. 37 100 231 232
Sequences read..
Counting site patterns.. 0:00
159 patterns at 228 / 228 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
155184 bytes for conP
21624 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 181
232776 bytes for conP, adjusted
0.098482 0.156421 0.228277 0.096027 0.158330 0.143119 0.148212 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -2020.656134
Iterating by ming2
Initial: fx= 2020.656134
x= 0.09848 0.15642 0.22828 0.09603 0.15833 0.14312 0.14821 0.30000 1.30000
1 h-m-p 0.0000 0.0037 272.7683 ++++CCCCC 1930.522114 4 0.0027 26 | 0/9
2 h-m-p 0.0006 0.0031 694.4711 +YCYCYYCCC 1753.571590 8 0.0030 52 | 0/9
3 h-m-p 0.0001 0.0003 115.7490 YYCC 1753.324747 3 0.0000 68 | 0/9
4 h-m-p 0.0001 0.0058 60.9637 ++CCCCC 1750.771407 4 0.0017 90 | 0/9
5 h-m-p 0.0035 0.0198 30.3514 CYCC 1750.389245 3 0.0011 107 | 0/9
6 h-m-p 0.0043 0.0455 7.9205 CCC 1750.254946 2 0.0039 123 | 0/9
7 h-m-p 0.0071 0.0690 4.3242 YCC 1750.170238 2 0.0052 138 | 0/9
8 h-m-p 0.0126 0.1548 1.7775 +YCCC 1749.554913 3 0.0331 156 | 0/9
9 h-m-p 0.0060 0.0758 9.7366 +CYYCCC 1735.286757 5 0.0530 178 | 0/9
10 h-m-p 0.0005 0.0027 348.5968 +YYCYCCC 1717.281771 6 0.0018 200 | 0/9
11 h-m-p 0.0771 0.3853 0.9810 YCYCCC 1709.555733 5 0.2021 220 | 0/9
12 h-m-p 0.4215 2.1076 0.2944 CCCC 1703.893701 3 0.4132 247 | 0/9
13 h-m-p 1.6000 8.0000 0.0475 YCCC 1703.140781 3 1.0055 273 | 0/9
14 h-m-p 0.6944 5.2844 0.0687 CCCC 1702.568763 3 0.8595 300 | 0/9
15 h-m-p 1.6000 8.0000 0.0324 YCC 1702.483191 2 0.9820 324 | 0/9
16 h-m-p 1.6000 8.0000 0.0106 CC 1702.446286 1 1.3852 347 | 0/9
17 h-m-p 1.3723 8.0000 0.0107 CC 1702.429827 1 1.9748 370 | 0/9
18 h-m-p 1.1468 8.0000 0.0184 YC 1702.403739 1 2.1546 392 | 0/9
19 h-m-p 1.6000 8.0000 0.0179 YC 1702.391185 1 1.2081 414 | 0/9
20 h-m-p 1.6000 8.0000 0.0079 YC 1702.387054 1 1.0374 436 | 0/9
21 h-m-p 1.6000 8.0000 0.0005 YC 1702.386965 1 1.0058 458 | 0/9
22 h-m-p 1.6000 8.0000 0.0001 Y 1702.386964 0 1.2794 479 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 Y 1702.386964 0 1.2556 500 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 Y 1702.386964 0 0.4000 521 | 0/9
25 h-m-p 0.5957 8.0000 0.0000 C 1702.386964 0 0.5957 542 | 0/9
26 h-m-p 1.4855 8.0000 0.0000 Y 1702.386964 0 0.3714 563 | 0/9
27 h-m-p 0.6680 8.0000 0.0000 ---------------Y 1702.386964 0 0.0000 599
Out..
lnL = -1702.386964
600 lfun, 600 eigenQcodon, 4200 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 181
0.098482 0.156421 0.228277 0.096027 0.158330 0.143119 0.148212 1.658447 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.454316
np = 10
lnL0 = -1847.859751
Iterating by ming2
Initial: fx= 1847.859751
x= 0.09848 0.15642 0.22828 0.09603 0.15833 0.14312 0.14821 1.65845 0.57321 0.49224
1 h-m-p 0.0000 0.0042 152.7501 +++++ 1739.856181 m 0.0042 18 | 0/10
2 h-m-p -0.0000 -0.0000 164.0726
h-m-p: -1.01922873e-19 -5.09614366e-19 1.64072590e+02 1739.856181
.. | 0/10
3 h-m-p 0.0000 0.0010 655.2151 ++CYCCC 1723.523497 4 0.0001 50 | 0/10
4 h-m-p 0.0001 0.0004 427.6503 +YYCCCCC 1699.571768 6 0.0003 74 | 0/10
5 h-m-p 0.0013 0.0066 52.8835 CCC 1698.125200 2 0.0011 91 | 0/10
6 h-m-p 0.0024 0.0119 21.8394 CCC 1697.915149 2 0.0010 108 | 0/10
7 h-m-p 0.0018 0.0091 5.3707 CC 1697.907257 1 0.0006 123 | 0/10
8 h-m-p 0.0004 0.0341 8.0487 CC 1697.899453 1 0.0005 138 | 0/10
9 h-m-p 0.0022 0.1919 1.8938 YC 1697.896475 1 0.0017 152 | 0/10
10 h-m-p 0.0038 0.8711 0.8391 +CC 1697.885715 1 0.0162 168 | 0/10
11 h-m-p 0.0019 0.2322 7.3442 +CCC 1697.813145 2 0.0118 196 | 0/10
12 h-m-p 0.0334 0.1670 1.5002 -CC 1697.809647 1 0.0026 212 | 0/10
13 h-m-p 0.0109 2.0250 0.3567 ++CCC 1697.657657 2 0.1853 231 | 0/10
14 h-m-p 1.6000 8.0000 0.0061 YC 1697.654231 1 1.0282 255 | 0/10
15 h-m-p 1.6000 8.0000 0.0008 Y 1697.654099 0 1.2595 278 | 0/10
16 h-m-p 1.6000 8.0000 0.0002 C 1697.654064 0 1.8277 301 | 0/10
17 h-m-p 1.6000 8.0000 0.0002 Y 1697.654063 0 0.9475 324 | 0/10
18 h-m-p 1.6000 8.0000 0.0000 Y 1697.654063 0 1.0594 347 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 -Y 1697.654063 0 0.1000 371 | 0/10
20 h-m-p 0.1085 8.0000 0.0000 Y 1697.654063 0 0.1812 394 | 0/10
21 h-m-p 0.2227 8.0000 0.0000 ---------------.. | 0/10
22 h-m-p 0.0160 8.0000 0.0002 ------------- | 0/10
23 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1697.654063
499 lfun, 1497 eigenQcodon, 6986 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 181
initial w for M2:NSpselection reset.
0.098482 0.156421 0.228277 0.096027 0.158330 0.143119 0.148212 1.680584 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.042722
np = 12
lnL0 = -1867.125609
Iterating by ming2
Initial: fx= 1867.125609
x= 0.09848 0.15642 0.22828 0.09603 0.15833 0.14312 0.14821 1.68058 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0042 138.0506 +++++ 1778.526093 m 0.0042 32 | 1/12
2 h-m-p 0.0010 0.0260 346.6951 CYCC 1764.162233 3 0.0012 64 | 0/12
3 h-m-p 0.0001 0.0026 3289.5705 CYC 1761.678007 2 0.0000 93 | 0/12
4 h-m-p 0.0018 0.0131 63.6391 ++ 1747.425919 m 0.0131 120 | 0/12
5 h-m-p 0.0014 0.0072 70.3390 CCC 1744.597673 2 0.0021 151 | 0/12
6 h-m-p 0.0065 0.0408 22.8372 CC 1743.656807 1 0.0052 180 | 0/12
7 h-m-p 0.0067 0.0421 17.5352 CCC 1742.979326 2 0.0068 211 | 0/12
8 h-m-p 0.0087 0.0602 13.8366 YCCC 1742.124467 3 0.0146 243 | 0/12
9 h-m-p 0.0122 0.1644 16.6298 +YYC 1739.873537 2 0.0389 273 | 0/12
10 h-m-p 0.0130 0.0648 9.6257 CCC 1739.515222 2 0.0128 304 | 0/12
11 h-m-p 0.0131 2.6424 9.4385 +YCCC 1736.696444 3 0.1225 337 | 0/12
12 h-m-p 0.8275 4.1377 0.8996 +YYCCC 1718.483407 4 3.1359 371 | 0/12
13 h-m-p 0.0958 0.4792 2.6590 YCCCCC 1713.518346 5 0.2190 407 | 0/12
14 h-m-p 0.1933 1.0460 3.0123 YC 1705.397513 1 0.4340 435 | 0/12
15 h-m-p 0.4563 2.2814 2.7120 YCCCC 1702.018117 4 0.2964 469 | 0/12
16 h-m-p 0.6034 3.0171 0.7806 YCCCCC 1700.719063 5 0.6623 505 | 0/12
17 h-m-p 0.3745 1.8727 1.0263 CCCCC 1699.735481 4 0.4688 540 | 0/12
18 h-m-p 1.0355 8.0000 0.4646 CYC 1699.125960 2 1.3248 570 | 0/12
19 h-m-p 0.6535 8.0000 0.9419 CCC 1698.797880 2 0.5801 601 | 0/12
20 h-m-p 0.6071 6.2496 0.9001 CCCC 1698.459671 3 0.8750 634 | 0/12
21 h-m-p 1.0727 8.0000 0.7342 CCC 1698.120311 2 1.6055 665 | 0/12
22 h-m-p 1.6000 8.0000 0.6067 CYC 1697.950900 2 1.6676 695 | 0/12
23 h-m-p 1.4030 8.0000 0.7211 YYC 1697.886637 2 1.1182 724 | 0/12
24 h-m-p 1.3854 8.0000 0.5820 CYC 1697.825557 2 1.5172 754 | 0/12
25 h-m-p 0.9044 8.0000 0.9764 YC 1697.736289 1 1.8231 782 | 0/12
26 h-m-p 1.6000 8.0000 1.0893 YC 1697.692072 1 1.0444 810 | 0/12
27 h-m-p 1.5412 8.0000 0.7381 YC 1697.677751 1 1.0027 838 | 0/12
28 h-m-p 1.3587 8.0000 0.5448 CC 1697.670976 1 2.0494 867 | 0/12
29 h-m-p 1.6000 8.0000 0.5141 YCC 1697.663805 2 2.6834 897 | 0/12
30 h-m-p 1.2141 8.0000 1.1363 CC 1697.658251 1 1.4591 926 | 0/12
31 h-m-p 1.6000 8.0000 0.8150 C 1697.656135 0 1.6000 953 | 0/12
32 h-m-p 1.6000 8.0000 0.7654 YC 1697.655012 1 2.6068 981 | 0/12
33 h-m-p 1.6000 8.0000 0.7578 CC 1697.654432 1 2.4445 1010 | 0/12
34 h-m-p 1.6000 8.0000 0.7905 YC 1697.654217 1 2.5102 1038 | 0/12
35 h-m-p 1.6000 8.0000 0.7774 Y 1697.654125 0 2.6766 1065 | 0/12
36 h-m-p 1.6000 8.0000 0.7474 C 1697.654090 0 2.2232 1092 | 0/12
37 h-m-p 1.6000 8.0000 0.7835 C 1697.654075 0 2.5342 1119 | 0/12
38 h-m-p 1.6000 8.0000 0.7976 C 1697.654068 0 2.1259 1146 | 0/12
39 h-m-p 1.6000 8.0000 0.7877 C 1697.654065 0 2.5514 1173 | 0/12
40 h-m-p 1.6000 8.0000 0.7878 C 1697.654064 0 2.2718 1200 | 0/12
41 h-m-p 1.6000 8.0000 0.7938 Y 1697.654063 0 2.6855 1227 | 0/12
42 h-m-p 1.6000 8.0000 0.8468 C 1697.654063 0 2.3210 1254 | 0/12
43 h-m-p 1.6000 8.0000 0.9244 Y 1697.654063 0 2.6715 1281 | 0/12
44 h-m-p 1.6000 8.0000 1.2737 C 1697.654063 0 2.4148 1308 | 0/12
45 h-m-p 1.2590 8.0000 2.4429 Y 1697.654063 0 2.3966 1335 | 0/12
46 h-m-p 0.2600 7.0243 22.5198 Y 1697.654063 0 0.1104 1362 | 0/12
47 h-m-p 0.1393 8.0000 17.8535 +Y 1697.654063 0 1.1675 1390 | 0/12
48 h-m-p 0.0524 0.2619 301.1788 -C 1697.654063 0 0.0033 1418 | 0/12
49 h-m-p 0.0116 1.5987 84.9725 ++++ 1697.654063 m 1.5987 1447 | 0/12
50 h-m-p 0.0947 0.4737 451.2122 Y 1697.654063 0 0.0947 1474 | 0/12
51 h-m-p 0.0523 0.2615 653.7398 ------C 1697.654063 0 0.0000 1507 | 0/12
52 h-m-p 0.0160 8.0000 4.4147 Y 1697.654063 0 0.0160 1534 | 0/12
53 h-m-p 0.0178 8.0000 3.9788 -------------.. | 0/12
54 h-m-p 0.0160 8.0000 0.0003 -C 1697.654063 0 0.0010 1600
Out..
lnL = -1697.654063
1601 lfun, 6404 eigenQcodon, 33621 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1716.316507 S = -1667.716510 -40.364036
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 159 patterns 0:18
did 20 / 159 patterns 0:18
did 30 / 159 patterns 0:18
did 40 / 159 patterns 0:18
did 50 / 159 patterns 0:18
did 60 / 159 patterns 0:18
did 70 / 159 patterns 0:18
did 80 / 159 patterns 0:18
did 90 / 159 patterns 0:18
did 100 / 159 patterns 0:18
did 110 / 159 patterns 0:18
did 120 / 159 patterns 0:18
did 130 / 159 patterns 0:18
did 140 / 159 patterns 0:18
did 150 / 159 patterns 0:19
did 159 / 159 patterns 0:19
Time used: 0:19
Model 3: discrete
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 181
0.098482 0.156421 0.228277 0.096027 0.158330 0.143119 0.148212 1.680582 0.331355 0.382499 0.018334 0.045770 0.076637
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 17.545065
np = 13
lnL0 = -1703.396788
Iterating by ming2
Initial: fx= 1703.396788
x= 0.09848 0.15642 0.22828 0.09603 0.15833 0.14312 0.14821 1.68058 0.33136 0.38250 0.01833 0.04577 0.07664
1 h-m-p 0.0000 0.0003 90.1943 +++ 1701.676699 m 0.0003 32 | 1/13
2 h-m-p 0.0002 0.0017 117.1526 +CCC 1699.915919 2 0.0006 66 | 1/13
3 h-m-p 0.0002 0.0009 39.5451 +YC 1699.401863 1 0.0008 96 | 1/13
4 h-m-p 0.0080 0.0495 4.1135 CC 1699.386846 1 0.0018 126 | 0/13
5 h-m-p 0.0008 0.0102 9.4726 CC 1699.376610 1 0.0003 156 | 0/13
6 h-m-p 0.0011 0.0059 2.3119 CC 1699.373059 1 0.0014 187 | 0/13
7 h-m-p 0.0056 0.0603 0.5900 YC 1699.372528 1 0.0025 217 | 0/13
8 h-m-p 0.0041 0.5073 0.3649 +CC 1699.369589 1 0.0199 249 | 0/13
9 h-m-p 0.0016 0.0882 4.5356 ++YC 1699.334536 1 0.0180 281 | 0/13
10 h-m-p 0.0083 0.0671 9.7756 YC 1699.329670 1 0.0012 311 | 0/13
11 h-m-p 0.0122 0.0654 0.9383 C 1699.324628 0 0.0115 340 | 0/13
12 h-m-p 0.0020 0.4180 5.2730 ++CCC 1699.233479 2 0.0361 375 | 0/13
13 h-m-p 0.8795 8.0000 0.2163 +YCCCC 1699.018430 4 5.1103 412 | 0/13
14 h-m-p 0.4645 2.3225 0.6245 +YC 1698.853041 1 1.2147 443 | 0/13
15 h-m-p 0.0382 0.1910 0.4871 ++ 1698.811652 m 0.1910 472 | 1/13
16 h-m-p 0.3175 8.0000 0.2929 +YCC 1698.667917 2 0.9280 505 | 1/13
17 h-m-p 0.3804 8.0000 0.7145 +YCC 1698.504394 2 1.1109 537 | 1/13
18 h-m-p 1.3608 6.8038 0.5363 YCCC 1698.332121 3 0.8120 570 | 0/13
19 h-m-p 0.0162 0.1212 26.8035 CCC 1698.308192 2 0.0064 602 | 0/13
20 h-m-p 1.1607 8.0000 0.1476 CCCC 1698.040520 3 1.6694 637 | 0/13
21 h-m-p 0.7729 8.0000 0.3188 +YC 1697.890913 1 1.9967 668 | 0/13
22 h-m-p 1.6000 8.0000 0.1415 C 1697.773992 0 1.5837 697 | 0/13
23 h-m-p 1.0099 8.0000 0.2219 CCC 1697.695074 2 0.9629 730 | 0/13
24 h-m-p 1.6000 8.0000 0.0640 CCC 1697.663430 2 1.4735 763 | 0/13
25 h-m-p 0.8697 8.0000 0.1084 CC 1697.656162 1 1.0936 794 | 0/13
26 h-m-p 1.6000 8.0000 0.0297 YC 1697.652266 1 1.3060 824 | 0/13
27 h-m-p 1.6000 8.0000 0.0082 YC 1697.649140 1 3.7756 854 | 0/13
28 h-m-p 1.6000 8.0000 0.0133 YC 1697.648458 1 1.2822 884 | 0/13
29 h-m-p 1.6000 8.0000 0.0026 Y 1697.648437 0 1.1821 913 | 0/13
30 h-m-p 1.6000 8.0000 0.0009 Y 1697.648436 0 1.0507 942 | 0/13
31 h-m-p 1.6000 8.0000 0.0002 Y 1697.648436 0 0.8824 971 | 0/13
32 h-m-p 1.6000 8.0000 0.0000 Y 1697.648436 0 0.8409 1000 | 0/13
33 h-m-p 1.6000 8.0000 0.0000 Y 1697.648436 0 0.2161 1029 | 0/13
34 h-m-p 0.2574 8.0000 0.0000 C 1697.648436 0 0.0644 1058 | 0/13
35 h-m-p 0.0678 8.0000 0.0000 -Y 1697.648436 0 0.0042 1088
Out..
lnL = -1697.648436
1089 lfun, 4356 eigenQcodon, 22869 P(t)
Time used: 0:27
Model 7: beta
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 181
0.098482 0.156421 0.228277 0.096027 0.158330 0.143119 0.148212 1.682846 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.528489
np = 10
lnL0 = -1758.810386
Iterating by ming2
Initial: fx= 1758.810386
x= 0.09848 0.15642 0.22828 0.09603 0.15833 0.14312 0.14821 1.68285 0.66567 1.54913
1 h-m-p 0.0000 0.0079 105.8083 ++++CYYYCYYCCC 1719.518120 9 0.0063 42 | 0/10
2 h-m-p 0.0002 0.0008 175.9779 CYCCC 1716.633062 4 0.0004 73 | 0/10
3 h-m-p 0.0016 0.0080 27.7609 YCCCC 1715.365970 4 0.0032 103 | 0/10
4 h-m-p 0.0015 0.0107 61.2518 CCCC 1713.907480 3 0.0022 132 | 0/10
5 h-m-p 0.0017 0.0087 76.8013 CCCC 1711.745675 3 0.0029 161 | 0/10
6 h-m-p 0.0027 0.0137 80.0160 +YCYCCC 1705.563117 5 0.0076 193 | 0/10
7 h-m-p 0.0006 0.0032 373.8492 CYCCC 1701.397035 4 0.0012 223 | 0/10
8 h-m-p 0.0029 0.0144 41.8763 YYCC 1700.643580 3 0.0025 250 | 0/10
9 h-m-p 0.0066 0.0332 12.7859 CYC 1700.555499 2 0.0016 276 | 0/10
10 h-m-p 0.0070 0.7503 2.9041 ++CCCCC 1699.740219 4 0.1424 309 | 0/10
11 h-m-p 1.1030 5.5152 0.2846 YCCC 1699.034611 3 0.4223 337 | 0/10
12 h-m-p 1.6000 8.0000 0.0406 YCC 1698.949758 2 1.0647 363 | 0/10
13 h-m-p 1.6000 8.0000 0.0262 YC 1698.940889 1 0.8428 387 | 0/10
14 h-m-p 1.6000 8.0000 0.0049 YC 1698.939941 1 0.8701 411 | 0/10
15 h-m-p 1.0939 8.0000 0.0039 CC 1698.939537 1 1.4970 436 | 0/10
16 h-m-p 0.9827 8.0000 0.0060 +YC 1698.938689 1 5.6958 461 | 0/10
17 h-m-p 0.9699 8.0000 0.0350 +YC 1698.934775 1 5.7119 486 | 0/10
18 h-m-p 1.6000 8.0000 0.0571 C 1698.932730 0 1.7910 509 | 0/10
19 h-m-p 1.6000 8.0000 0.0123 YC 1698.932665 1 0.8195 533 | 0/10
20 h-m-p 1.6000 8.0000 0.0028 Y 1698.932663 0 1.0610 556 | 0/10
21 h-m-p 1.6000 8.0000 0.0001 Y 1698.932663 0 1.0320 579 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 --C 1698.932663 0 0.0250 604 | 0/10
23 h-m-p 0.2388 8.0000 0.0000 C 1698.932663 0 0.0787 627
Out..
lnL = -1698.932663
628 lfun, 6908 eigenQcodon, 43960 P(t)
Time used: 0:44
Model 8: beta&w>1
TREE # 1
(1, 2, ((3, 4), 5)); MP score: 181
initial w for M8:NSbetaw>1 reset.
0.098482 0.156421 0.228277 0.096027 0.158330 0.143119 0.148212 1.665582 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.129401
np = 12
lnL0 = -1761.762398
Iterating by ming2
Initial: fx= 1761.762398
x= 0.09848 0.15642 0.22828 0.09603 0.15833 0.14312 0.14821 1.66558 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0004 314.6780 +++ 1731.225635 m 0.0004 30 | 1/12
2 h-m-p 0.0002 0.0012 324.5409 +YYYCYYCCC 1701.036629 8 0.0009 70 | 1/12
3 h-m-p 0.0059 0.0294 12.3813 YCC 1700.823619 2 0.0028 99 | 0/12
4 h-m-p 0.0012 0.0188 28.5423 -CYC 1700.801634 2 0.0001 129 | 0/12
5 h-m-p 0.0003 0.0357 8.7438 +YC 1700.742512 1 0.0022 158 | 0/12
6 h-m-p 0.0030 0.1669 6.3769 +YC 1700.643833 1 0.0078 187 | 0/12
7 h-m-p 0.0021 0.0125 23.1546 +YC 1700.175018 1 0.0106 216 | 0/12
8 h-m-p 0.0001 0.0005 88.2471 ++ 1700.029964 m 0.0005 243 | 0/12
9 h-m-p 0.0062 0.1050 7.2695 YC 1699.987356 1 0.0040 271 | 0/12
10 h-m-p 0.0035 0.0883 8.2234 +CCCC 1699.803590 3 0.0166 305 | 0/12
11 h-m-p 0.0063 0.0315 3.0313 +YC 1699.753382 1 0.0180 334 | 0/12
12 h-m-p 0.0023 0.0113 23.9562 +CCC 1699.581179 2 0.0079 366 | 0/12
13 h-m-p 0.8729 4.3645 0.1729 CCC 1699.350959 2 0.7452 397 | 0/12
14 h-m-p 1.5487 8.0000 0.0832 ++ 1698.979947 m 8.0000 424 | 0/12
15 h-m-p 0.8478 8.0000 0.7852 YCCC 1698.609681 3 1.7471 456 | 0/12
16 h-m-p 0.5545 2.7726 0.4915 YCCCC 1698.433481 4 1.2369 490 | 0/12
17 h-m-p 0.9275 8.0000 0.6554 YC 1698.328410 1 1.6928 518 | 0/12
18 h-m-p 1.6000 8.0000 0.5512 CYC 1698.273735 2 1.8210 548 | 0/12
19 h-m-p 1.6000 8.0000 0.3256 CC 1698.258513 1 1.7118 577 | 0/12
20 h-m-p 1.6000 8.0000 0.2158 YC 1698.238974 1 2.8817 605 | 0/12
21 h-m-p 1.6000 8.0000 0.1781 +YCC 1698.188252 2 4.7058 636 | 0/12
22 h-m-p 1.6000 8.0000 0.2081 CCC 1698.146488 2 2.0674 667 | 0/12
23 h-m-p 0.9638 8.0000 0.4465 +YCCC 1698.066789 3 5.1628 700 | 0/12
24 h-m-p 0.7395 3.6973 2.1995 ++ 1697.878123 m 3.6973 727 | 0/12
25 h-m-p 1.6000 8.0000 1.2066 CYC 1697.851680 2 0.3359 757 | 0/12
26 h-m-p 0.3230 4.8460 1.2549 +CC 1697.822078 1 1.1442 787 | 0/12
27 h-m-p 1.1491 8.0000 1.2496 ++ 1697.761432 m 8.0000 814 | 0/12
28 h-m-p 1.6000 8.0000 2.5992 CCC 1697.726248 2 1.4850 845 | 0/12
29 h-m-p 1.4090 8.0000 2.7394 YC 1697.715454 1 3.0772 873 | 0/12
30 h-m-p 1.6000 8.0000 3.9781 YC 1697.705600 1 2.6486 901 | 0/12
31 h-m-p 1.6000 8.0000 4.7779 CC 1697.701210 1 2.3174 930 | 0/12
32 h-m-p 1.3966 6.9828 4.9132 YC 1697.698579 1 2.8871 958 | 0/12
33 h-m-p 0.7396 3.6981 5.4415 +YC 1697.697125 1 2.4227 987 | 0/12
34 h-m-p 0.2437 1.2185 5.6957 ++ 1697.696501 m 1.2185 1014 | 1/12
35 h-m-p 0.0528 2.2959 3.9781 --------------.. | 1/12
36 h-m-p 0.0002 0.0951 0.3587 +Y 1697.696465 0 0.0006 1080 | 1/12
37 h-m-p 0.0004 0.1888 1.6262 C 1697.696345 0 0.0005 1106 | 1/12
38 h-m-p 0.0074 3.7090 0.7060 YC 1697.694961 1 0.0153 1133 | 1/12
39 h-m-p 0.0016 0.4459 6.7462 +YC 1697.685647 1 0.0109 1161 | 1/12
40 h-m-p 0.0023 0.0902 32.5518 C 1697.676679 0 0.0022 1187 | 1/12
41 h-m-p 0.0208 0.6666 3.3712 -C 1697.676172 0 0.0013 1214 | 1/12
42 h-m-p 0.0068 0.7641 0.6211 C 1697.676064 0 0.0017 1240 | 1/12
43 h-m-p 0.0056 2.1517 0.1912 YC 1697.676026 1 0.0033 1267 | 1/12
44 h-m-p 0.0038 1.4877 0.1634 ++YC 1697.675166 1 0.1233 1296 | 1/12
45 h-m-p 0.0250 0.2657 0.8046 -C 1697.675099 0 0.0021 1323 | 1/12
46 h-m-p 0.0085 0.9268 0.1945 ++YC 1697.673629 1 0.2249 1352 | 1/12
47 h-m-p 1.6000 8.0000 0.0004 Y 1697.673616 0 1.0632 1378 | 1/12
48 h-m-p 1.6000 8.0000 0.0002 Y 1697.673616 0 0.9585 1404 | 1/12
49 h-m-p 1.6000 8.0000 0.0000 C 1697.673616 0 0.3264 1430 | 1/12
50 h-m-p 0.4790 8.0000 0.0000 C 1697.673616 0 0.1197 1456
Out..
lnL = -1697.673616
1457 lfun, 17484 eigenQcodon, 112189 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1723.133996 S = -1667.666947 -47.312331
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 159 patterns 1:28
did 20 / 159 patterns 1:29
did 30 / 159 patterns 1:29
did 40 / 159 patterns 1:29
did 50 / 159 patterns 1:29
did 60 / 159 patterns 1:29
did 70 / 159 patterns 1:30
did 80 / 159 patterns 1:30
did 90 / 159 patterns 1:30
did 100 / 159 patterns 1:30
did 110 / 159 patterns 1:30
did 120 / 159 patterns 1:31
did 130 / 159 patterns 1:31
did 140 / 159 patterns 1:31
did 150 / 159 patterns 1:31
did 159 / 159 patterns 1:31
Time used: 1:31
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=232
D_melanogaster_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAA-GGSKDISIDITLN
D_yakuba_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAA-GGSKDISIDITLN
D_biarmipes_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAP-AGSKDISIDITLN
D_suzukii_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAP-AGSKDISIDITLN
D_takahashii_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
*****************************:: **. .************
D_melanogaster_CG5780-PB VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
D_yakuba_CG5780-PB VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKN-
D_biarmipes_CG5780-PB VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
D_suzukii_CG5780-PB VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
D_takahashii_CG5780-PB VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
****:*********:*************************:********
D_melanogaster_CG5780-PB SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
D_yakuba_CG5780-PB SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
D_biarmipes_CG5780-PB SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
D_suzukii_CG5780-PB SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
D_takahashii_CG5780-PB SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
*******:*********************:***************:****
D_melanogaster_CG5780-PB SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
D_yakuba_CG5780-PB SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
D_biarmipes_CG5780-PB SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
D_suzukii_CG5780-PB SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
D_takahashii_CG5780-PB SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
*********:****************:***********.*********:*
D_melanogaster_CG5780-PB FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
D_yakuba_CG5780-PB FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
D_biarmipes_CG5780-PB FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo-
D_suzukii_CG5780-PB FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo-
D_takahashii_CG5780-PB FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS-
************.* ********:*****
>D_melanogaster_CG5780-PB ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG GAAGGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGAGGAGGATGTCC AGGCGGCT---GGGGGCTCCAAGGACATTTCCATCGACATTACGCTGAAT GTCCAGGCGGGCACCCCACCGACCACCTCGGACACGGCCACCTCGTCCAC ATACAACAATGAATTCGAGTCACATCGACCACCCATTCGTCGCATTTCAG GTGGCTGGGCGGATTCTGGACTCAAAGGATTAAAGTCCAAGAAAAAC--- TCCTTTGATGATGAGCGCTTTAAACAAACAAAGTCGGCTACAAATTCCAT ACCAACGGATGACATTCCCGTCATCCCAGACATGGATGATGTCAAGGACG AAATCATGCTCAATGAGATTGTAGAACCGCCAACTATTGGCACCTCACGA TCTGCTGTTTTGAAGGAGGCCAATTCCGATTTGCTTTCCCAGTACGCCTT TTCAGCTGTGGATGGCTTTGATCTCTCAATCCTCACCGATTGCCTGGTTC CACAGGAGAGCCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAGCTG TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATGGG CATGAAAATAGGACCCGATGTGATTCCACCCACACAATATACT--- >D_yakuba_CG5780-PB ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG GAAAGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGATGAGGATTCCC AGGCGGCC---GGTGGCTCCAAGGACATTTCCATCGACATCACTCTGAAT GTTCAGGCGGGTACCCCACCCACCACATCGGACACGGCCACCACGTCCAC ATATAACAATGAATTCGAGTCCCATCGACCACCCATTCGTCGCATTTCGG GTGGCTGGGCGGATTCCGGATTCAAGGGATTAAAGTCCAAGAAAAAC--- TCATTCGACGATGAGCGTTTTAGGCAAACAAAGTCGGCTACAAATTCCAT ACCAACGGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAGGACG AAATCATGCTCAATGAGATTGTGGAGCCGCCTACTATCGGCACCTCGCGA TCCGCCGTCTTGAAGGAGGCCAATTCCGATTTGCTCTCTCAGTACGCATT TTCGGCTGTGGATGGCTTTGATCTCTCTATTCTAACCGATTGCCTAGTTC CACAGGAGAGCCTCAACGAGAAAGATGATCTCTGGCAGTGGGACAAACTG TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATTGG CATGAAGATTGGACCCGATGTGGTTCCACCCACACAATATACT--- >D_biarmipes_CG5780-PB ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCAG GAAGGGCCGGCGCTCCAAGAGCCGCGATGTCTTGAAGGAGGACTCCTCGC AGGCGCCC---GCAGGCTCCAAGGACATTTCCATCGACATCACCCTGAAT GTCCAGGCAGGCTCTCCGCCCACAACCTCGGACACGGCCACCTCGTCCAC CTACAACAATGAATTCGAGTCGCACCGACCGCCCATCCGTCGGATTTCGG GAGGTTGGGCGGATTCGGGACTGAAGGGGTTAAAGTCCAAGAAGAACAAC TCCTTTGATGACGAGCGTTTCAGGCAAACCAAGTCTGCTACAAATTCCAT TCCTACTGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAAGATG AAATTATGCTCAATGAGATAGTGGAACCTCCTACTATGGGCACTTCTCGA TCCGCTGTCCTAAAGGAGGCCAATTCCGAGTTGCTTTCCCAGTACGCCTT TTCTGCAGTGGACGGCTTCGATCTCTCAGTCCTAACAGACTGCCTGGTTC CACAGGAGAGTCTCAGCGAGAAGGACGATCTCTGGCAGTGGGACCAGCTC TTTACCGAGGTCACGGCCGAAATCCATTCGGATAAGGCGCCCATCATAGG CATGAAGATAGGACCTGATGTCGTACCCCCGACACAATAT------ >D_suzukii_CG5780-PB ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCCG AAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGTCCTCGC AGGCGCCT---GCAGGCTCCAAGGATATTTCCATCGATATCACCCTGAAT GTCCAGGCAGGATCTCCACCCACAACCTCGGACACGGCCACCTCGTCCAC CTACAACAATGAATTCGAGTCGCATCGTCCACCCATTAGGCGGATCTCGG GAGGCTGGGCGGATTCGGGTCTAAAGGGGTTAAAGTCCAAGAAGAACAAC TCCTTTGATGACGAACGTTTTAGGCAAACCAAGTCTGCTACAAATTCTAT ACCTACTGATGACATTCCCGTCATTCCCGACATGGATGATGTTAAAGACG AAATAATGCTTAATGAGATAGTAGAACCTCCTACTATGGGCACTTCTCGA TCTGCTGTCTTAAAGGAGGCCAATTCCGATTTGCTTTCTCAGTACGCCTT TTCTGCAGTGGACGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC CGCAGGAGAGCCTCAATGAGAAGGACGACCTCTGGCAATGGGACAAACTC TTCACCGAGGTCACGGCAGAAATCCATTCGGATAAGGCACCAAACAATGG CATGAAGATAGGCCCTGATGTCGTACCCCCCACACAATAT------ >D_takahashii_CG5780-PB ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCCG GAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGGCCACGC AGGCGGCTCCTGCAGGCTCCAAGGATATTTCCATCGACATCACCCTGAAC GTCCAGGCAGGATCGCCACCCACCACTTCGGATACGGCCACCTCGTCCAC CTACAACAATGAGTTCGAGTCGCATCGTCCACCCATTCGACGAATTTCGG GAGGTTGGGCCGATTCTGGTCTAAAGGGATTGAAGTCCAAGAAGAAC--- TCATTTGACGACGAACGTTTTAGGCAGACCAAGTCGGCTACAAATTCAAT ACCGACGGATGACATTCCCGTCATCCCAGATATGGATGAAGTCAAGGATG AAATAATGCTCAATGAGATTGTGGAACCGCCTACCATGGGCACTTCACGT TCTGCTGTCTTGAAGGAGGCCAATTCCGATTTACTTTCCCAGTACGCCTT TTCCGCAGTGGATGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC CGCAGGAGAGTCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAACTC TTTACCGAGGTCACGGCTGAAATCCATTCGGATAAGGTGCCGAATATAGG CATGAAGATAGGCCCCGATGTCGTTCCGCCCACACAATATTCT---
>D_melanogaster_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAA-GGSKDISIDITLN VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN- SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYT >D_yakuba_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAA-GGSKDISIDITLN VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKN- SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYT >D_biarmipes_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAP-AGSKDISIDITLN VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL FTEVTAEIHSDKAPIIGMKIGPDVVPPTQY- >D_suzukii_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAP-AGSKDISIDITLN VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL FTEVTAEIHSDKAPNNGMKIGPDVVPPTQY- >D_takahashii_CG5780-PB MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN- SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS
#NEXUS
[ID: 0990564390]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_CG5780-PB
D_yakuba_CG5780-PB
D_biarmipes_CG5780-PB
D_suzukii_CG5780-PB
D_takahashii_CG5780-PB
;
end;
begin trees;
translate
1 D_melanogaster_CG5780-PB,
2 D_yakuba_CG5780-PB,
3 D_biarmipes_CG5780-PB,
4 D_suzukii_CG5780-PB,
5 D_takahashii_CG5780-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06600423,2:0.1064364,((3:0.1431389,4:0.07106474)1.000:0.1206636,5:0.08729972)1.000:0.2273009);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06600423,2:0.1064364,((3:0.1431389,4:0.07106474):0.1206636,5:0.08729972):0.2273009);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1832.45 -1843.38
2 -1832.43 -1841.68
--------------------------------------
TOTAL -1832.44 -1842.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.846188 0.012211 0.644539 1.073575 0.842553 1170.23 1335.61 1.001
r(A<->C){all} 0.089270 0.000875 0.033256 0.148649 0.086731 756.22 844.38 1.000
r(A<->G){all} 0.264636 0.002905 0.163336 0.369801 0.261354 653.85 714.56 1.004
r(A<->T){all} 0.140183 0.001519 0.073129 0.225351 0.137559 726.63 783.95 1.000
r(C<->G){all} 0.029796 0.000267 0.000001 0.059650 0.028111 978.62 1048.21 1.000
r(C<->T){all} 0.427524 0.003930 0.316969 0.560151 0.424281 634.58 715.50 1.003
r(G<->T){all} 0.048592 0.000494 0.005419 0.090241 0.046661 873.12 924.88 1.000
pi(A){all} 0.258112 0.000240 0.230352 0.288733 0.257727 1137.41 1184.02 1.000
pi(C){all} 0.273330 0.000230 0.244286 0.304597 0.273713 1125.31 1146.07 1.000
pi(G){all} 0.248965 0.000223 0.220335 0.278235 0.248794 1122.51 1136.55 1.000
pi(T){all} 0.219593 0.000195 0.192116 0.246307 0.219441 1256.76 1338.80 1.000
alpha{1,2} 0.054787 0.000901 0.000114 0.100545 0.056775 878.98 1057.53 1.000
alpha{3} 3.191450 0.883497 1.568388 5.067614 3.052710 1267.23 1268.26 1.000
pinvar{all} 0.380973 0.003162 0.275629 0.490988 0.382214 1054.52 1223.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/171/CG5780-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 228
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 4 3 3 3 4 | Ser TCT 2 2 4 7 2 | Tyr TAT 1 2 1 1 1 | Cys TGT 0 0 0 0 0
TTC 2 4 3 3 2 | TCC 9 11 11 8 8 | TAC 2 1 2 2 2 | TGC 1 1 1 1 1
Leu TTA 1 1 1 2 1 | TCA 5 1 1 1 4 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 2 2 2 3 | TCG 4 6 7 7 7 | TAG 0 0 0 0 0 | Trp TGG 4 4 4 4 4
----------------------------------------------------------------------------------------------------------------------
Leu CTT 1 0 1 2 1 | Pro CCT 0 1 4 5 1 | His CAT 2 2 1 2 2 | Arg CGT 1 2 2 2 3
CTC 7 6 6 5 6 | CCC 5 6 6 6 5 | CAC 0 0 1 0 0 | CGC 4 3 2 2 2
CTA 0 2 2 2 2 | CCA 7 6 2 3 3 | Gln CAA 2 2 2 3 1 | CGA 2 2 2 2 2
CTG 4 3 3 2 2 | CCG 2 1 3 1 5 | CAG 5 5 6 4 6 | CGG 1 1 2 2 2
----------------------------------------------------------------------------------------------------------------------
Ile ATT 8 9 6 5 6 | Thr ACT 1 2 3 3 2 | Asn AAT 6 6 5 7 5 | Ser AGT 1 1 1 1 2
ATC 5 5 5 4 4 | ACC 8 7 7 8 9 | AAC 3 3 2 3 4 | AGC 1 1 2 1 0
ATA 3 2 4 5 5 | ACA 4 5 4 3 2 | Lys AAA 5 5 1 2 1 | Arg AGA 1 1 1 1 1
Met ATG 6 5 6 6 6 | ACG 6 6 4 4 6 | AAG 13 12 15 15 16 | AGG 1 2 2 2 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 3 4 1 2 2 | Ala GCT 5 3 2 2 4 | Asp GAT 15 16 11 13 15 | Gly GGT 2 4 1 2 3
GTC 5 4 8 6 7 | GCC 5 6 6 5 7 | GAC 9 9 12 10 7 | GGC 6 5 6 6 5
GTA 1 0 1 2 0 | GCA 0 1 3 5 3 | Glu GAA 6 5 5 7 6 | GGA 3 3 3 2 3
GTG 3 4 2 1 3 | GCG 3 3 3 2 1 | GAG 9 9 10 8 10 | GGG 1 0 1 1 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG5780-PB
position 1: T:0.16228 C:0.18860 A:0.31579 G:0.33333
position 2: T:0.24123 C:0.28947 A:0.34211 G:0.12719
position 3: T:0.22807 C:0.31579 A:0.17544 G:0.28070
Average T:0.21053 C:0.26462 A:0.27778 G:0.24708
#2: D_yakuba_CG5780-PB
position 1: T:0.16667 C:0.18421 A:0.31579 G:0.33333
position 2: T:0.23684 C:0.29386 A:0.33772 G:0.13158
position 3: T:0.25000 C:0.31579 A:0.15789 G:0.27632
Average T:0.21784 C:0.26462 A:0.27047 G:0.24708
#3: D_biarmipes_CG5780-PB
position 1: T:0.17544 C:0.19737 A:0.29825 G:0.32895
position 2: T:0.23684 C:0.30702 A:0.32456 G:0.13158
position 3: T:0.20175 C:0.35088 A:0.14035 G:0.30702
Average T:0.20468 C:0.28509 A:0.25439 G:0.25585
#4: D_suzukii_CG5780-PB
position 1: T:0.17982 C:0.18860 A:0.30702 G:0.32456
position 2: T:0.22807 C:0.30702 A:0.33772 G:0.12719
position 3: T:0.25000 C:0.30702 A:0.17544 G:0.26754
Average T:0.21930 C:0.26754 A:0.27339 G:0.23977
#5: D_takahashii_CG5780-PB
position 1: T:0.17105 C:0.18860 A:0.30702 G:0.33333
position 2: T:0.23684 C:0.30263 A:0.33333 G:0.12719
position 3: T:0.23246 C:0.30263 A:0.14912 G:0.31579
Average T:0.21345 C:0.26462 A:0.26316 G:0.25877
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 17 | Ser S TCT 17 | Tyr Y TAT 6 | Cys C TGT 0
TTC 14 | TCC 47 | TAC 9 | TGC 5
Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 11 | TCG 31 | TAG 0 | Trp W TGG 20
------------------------------------------------------------------------------
Leu L CTT 5 | Pro P CCT 11 | His H CAT 9 | Arg R CGT 10
CTC 30 | CCC 28 | CAC 1 | CGC 13
CTA 8 | CCA 21 | Gln Q CAA 10 | CGA 10
CTG 14 | CCG 12 | CAG 26 | CGG 8
------------------------------------------------------------------------------
Ile I ATT 34 | Thr T ACT 11 | Asn N AAT 29 | Ser S AGT 6
ATC 23 | ACC 39 | AAC 15 | AGC 5
ATA 19 | ACA 18 | Lys K AAA 14 | Arg R AGA 5
Met M ATG 29 | ACG 26 | AAG 71 | AGG 8
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 16 | Asp D GAT 70 | Gly G GGT 12
GTC 30 | GCC 29 | GAC 47 | GGC 28
GTA 4 | GCA 12 | Glu E GAA 29 | GGA 14
GTG 13 | GCG 12 | GAG 46 | GGG 3
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17105 C:0.18947 A:0.30877 G:0.33070
position 2: T:0.23596 C:0.30000 A:0.33509 G:0.12895
position 3: T:0.23246 C:0.31842 A:0.15965 G:0.28947
Average T:0.21316 C:0.26930 A:0.26784 G:0.24971
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG5780-PB
D_yakuba_CG5780-PB 0.0500 (0.0155 0.3093)
D_biarmipes_CG5780-PB 0.0536 (0.0357 0.6663) 0.0402 (0.0313 0.7803)
D_suzukii_CG5780-PB 0.0376 (0.0276 0.7349) 0.0284 (0.0234 0.8234) 0.0447 (0.0165 0.3689)
D_takahashii_CG5780-PB 0.0324 (0.0198 0.6099) 0.0255 (0.0175 0.6840) 0.0397 (0.0214 0.5401) 0.0277 (0.0126 0.4545)
Model 0: one-ratio
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 181
lnL(ntime: 7 np: 9): -1702.386964 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.122673 0.145683 0.244276 0.133201 0.198089 0.112874 0.131688 1.658447 0.036668
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.08849
(1: 0.122673, 2: 0.145683, ((3: 0.198089, 4: 0.112874): 0.133201, 5: 0.131688): 0.244276);
(D_melanogaster_CG5780-PB: 0.122673, D_yakuba_CG5780-PB: 0.145683, ((D_biarmipes_CG5780-PB: 0.198089, D_suzukii_CG5780-PB: 0.112874): 0.133201, D_takahashii_CG5780-PB: 0.131688): 0.244276);
Detailed output identifying parameters
kappa (ts/tv) = 1.65845
omega (dN/dS) = 0.03667
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.123 511.0 173.0 0.0367 0.0054 0.1459 2.7 25.2
6..2 0.146 511.0 173.0 0.0367 0.0064 0.1733 3.2 30.0
6..7 0.244 511.0 173.0 0.0367 0.0107 0.2905 5.4 50.3
7..8 0.133 511.0 173.0 0.0367 0.0058 0.1584 3.0 27.4
8..3 0.198 511.0 173.0 0.0367 0.0086 0.2356 4.4 40.7
8..4 0.113 511.0 173.0 0.0367 0.0049 0.1343 2.5 23.2
7..5 0.132 511.0 173.0 0.0367 0.0057 0.1566 2.9 27.1
tree length for dN: 0.0475
tree length for dS: 1.2946
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 181
check convergence..
lnL(ntime: 7 np: 10): -1697.654063 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.113855 0.154115 0.253591 0.138096 0.199054 0.115011 0.127620 1.680584 0.983681 0.026518
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.10134
(1: 0.113855, 2: 0.154115, ((3: 0.199054, 4: 0.115011): 0.138096, 5: 0.127620): 0.253591);
(D_melanogaster_CG5780-PB: 0.113855, D_yakuba_CG5780-PB: 0.154115, ((D_biarmipes_CG5780-PB: 0.199054, D_suzukii_CG5780-PB: 0.115011): 0.138096, D_takahashii_CG5780-PB: 0.127620): 0.253591);
Detailed output identifying parameters
kappa (ts/tv) = 1.68058
dN/dS (w) for site classes (K=2)
p: 0.98368 0.01632
w: 0.02652 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.114 510.7 173.3 0.0424 0.0056 0.1332 2.9 23.1
6..2 0.154 510.7 173.3 0.0424 0.0076 0.1802 3.9 31.2
6..7 0.254 510.7 173.3 0.0424 0.0126 0.2966 6.4 51.4
7..8 0.138 510.7 173.3 0.0424 0.0068 0.1615 3.5 28.0
8..3 0.199 510.7 173.3 0.0424 0.0099 0.2328 5.0 40.3
8..4 0.115 510.7 173.3 0.0424 0.0057 0.1345 2.9 23.3
7..5 0.128 510.7 173.3 0.0424 0.0063 0.1493 3.2 25.9
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 181
lnL(ntime: 7 np: 12): -1697.654063 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.113855 0.154115 0.253591 0.138096 0.199054 0.115011 0.127619 1.680582 0.983681 0.016319 0.026518 131.322613
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.10134
(1: 0.113855, 2: 0.154115, ((3: 0.199054, 4: 0.115011): 0.138096, 5: 0.127619): 0.253591);
(D_melanogaster_CG5780-PB: 0.113855, D_yakuba_CG5780-PB: 0.154115, ((D_biarmipes_CG5780-PB: 0.199054, D_suzukii_CG5780-PB: 0.115011): 0.138096, D_takahashii_CG5780-PB: 0.127619): 0.253591);
Detailed output identifying parameters
kappa (ts/tv) = 1.68058
dN/dS (w) for site classes (K=3)
p: 0.98368 0.01632 0.00000
w: 0.02652 1.00000 131.32261
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.114 510.7 173.3 0.0424 0.0056 0.1332 2.9 23.1
6..2 0.154 510.7 173.3 0.0424 0.0076 0.1802 3.9 31.2
6..7 0.254 510.7 173.3 0.0424 0.0126 0.2966 6.4 51.4
7..8 0.138 510.7 173.3 0.0424 0.0068 0.1615 3.5 28.0
8..3 0.199 510.7 173.3 0.0424 0.0099 0.2328 5.0 40.3
8..4 0.115 510.7 173.3 0.0424 0.0057 0.1345 2.9 23.3
7..5 0.128 510.7 173.3 0.0424 0.0063 0.1493 3.2 25.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5780-PB)
Pr(w>1) post mean +- SE for w
33 V 0.579 2.405 +- 2.210
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.377 0.167 0.101 0.074 0.060 0.052 0.047 0.043 0.041 0.038
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 0:19
Model 3: discrete (3 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 181
lnL(ntime: 7 np: 13): -1697.648436 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.113396 0.154542 0.253939 0.138324 0.199136 0.115020 0.127477 1.682846 0.051238 0.933412 0.026820 0.026822 1.082602
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.10183
(1: 0.113396, 2: 0.154542, ((3: 0.199136, 4: 0.115020): 0.138324, 5: 0.127477): 0.253939);
(D_melanogaster_CG5780-PB: 0.113396, D_yakuba_CG5780-PB: 0.154542, ((D_biarmipes_CG5780-PB: 0.199136, D_suzukii_CG5780-PB: 0.115020): 0.138324, D_takahashii_CG5780-PB: 0.127477): 0.253939);
Detailed output identifying parameters
kappa (ts/tv) = 1.68285
dN/dS (w) for site classes (K=3)
p: 0.05124 0.93341 0.01535
w: 0.02682 0.02682 1.08260
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.113 510.7 173.3 0.0430 0.0057 0.1324 2.9 22.9
6..2 0.155 510.7 173.3 0.0430 0.0078 0.1804 4.0 31.3
6..7 0.254 510.7 173.3 0.0430 0.0128 0.2965 6.5 51.4
7..8 0.138 510.7 173.3 0.0430 0.0069 0.1615 3.5 28.0
8..3 0.199 510.7 173.3 0.0430 0.0100 0.2325 5.1 40.3
8..4 0.115 510.7 173.3 0.0430 0.0058 0.1343 3.0 23.3
7..5 0.127 510.7 173.3 0.0430 0.0064 0.1488 3.3 25.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5780-PB)
Pr(w>1) post mean +- SE for w
32 D 0.637 0.699
33 V 0.996** 1.078
214 M 0.865 0.940
Time used: 0:27
Model 7: beta (10 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 181
lnL(ntime: 7 np: 10): -1698.932663 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.120117 0.148245 0.248000 0.134809 0.198490 0.114151 0.130323 1.665582 0.164919 3.619536
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.09413
(1: 0.120117, 2: 0.148245, ((3: 0.198490, 4: 0.114151): 0.134809, 5: 0.130323): 0.248000);
(D_melanogaster_CG5780-PB: 0.120117, D_yakuba_CG5780-PB: 0.148245, ((D_biarmipes_CG5780-PB: 0.198490, D_suzukii_CG5780-PB: 0.114151): 0.134809, D_takahashii_CG5780-PB: 0.130323): 0.248000);
Detailed output identifying parameters
kappa (ts/tv) = 1.66558
Parameters in M7 (beta):
p = 0.16492 q = 3.61954
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00004 0.00034 0.00157 0.00534 0.01503 0.03764 0.09013 0.24125
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.120 510.9 173.1 0.0391 0.0056 0.1419 2.8 24.6
6..2 0.148 510.9 173.1 0.0391 0.0069 0.1751 3.5 30.3
6..7 0.248 510.9 173.1 0.0391 0.0115 0.2929 5.9 50.7
7..8 0.135 510.9 173.1 0.0391 0.0062 0.1592 3.2 27.6
8..3 0.198 510.9 173.1 0.0391 0.0092 0.2344 4.7 40.6
8..4 0.114 510.9 173.1 0.0391 0.0053 0.1348 2.7 23.3
7..5 0.130 510.9 173.1 0.0391 0.0060 0.1539 3.1 26.6
Time used: 0:44
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, ((3, 4), 5)); MP score: 181
lnL(ntime: 7 np: 12): -1697.673616 +0.000000
6..1 6..2 6..7 7..8 8..3 8..4 7..5
0.113411 0.154589 0.253962 0.138457 0.199216 0.114926 0.127365 1.682820 0.985867 2.836798 99.000000 1.129116
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.10193
(1: 0.113411, 2: 0.154589, ((3: 0.199216, 4: 0.114926): 0.138457, 5: 0.127365): 0.253962);
(D_melanogaster_CG5780-PB: 0.113411, D_yakuba_CG5780-PB: 0.154589, ((D_biarmipes_CG5780-PB: 0.199216, D_suzukii_CG5780-PB: 0.114926): 0.138457, D_takahashii_CG5780-PB: 0.127365): 0.253962);
Detailed output identifying parameters
kappa (ts/tv) = 1.68282
Parameters in M8 (beta&w>1):
p0 = 0.98587 p = 2.83680 q = 99.00000
(p1 = 0.01413) w = 1.12912
dN/dS (w) for site classes (K=11)
p: 0.09859 0.09859 0.09859 0.09859 0.09859 0.09859 0.09859 0.09859 0.09859 0.09859 0.01413
w: 0.00733 0.01213 0.01587 0.01938 0.02295 0.02679 0.03118 0.03658 0.04411 0.05876 1.12912
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.113 510.7 173.3 0.0431 0.0057 0.1324 2.9 22.9
6..2 0.155 510.7 173.3 0.0431 0.0078 0.1804 4.0 31.3
6..7 0.254 510.7 173.3 0.0431 0.0128 0.2964 6.5 51.4
7..8 0.138 510.7 173.3 0.0431 0.0070 0.1616 3.6 28.0
8..3 0.199 510.7 173.3 0.0431 0.0100 0.2325 5.1 40.3
8..4 0.115 510.7 173.3 0.0431 0.0058 0.1342 3.0 23.3
7..5 0.127 510.7 173.3 0.0431 0.0064 0.1487 3.3 25.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5780-PB)
Pr(w>1) post mean +- SE for w
32 D 0.548 0.637
33 V 0.991** 1.119
214 M 0.817 0.931
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5780-PB)
Pr(w>1) post mean +- SE for w
33 V 0.799 2.558 +- 2.262
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.001 0.008 0.053 0.225 0.713
ws: 0.482 0.171 0.091 0.061 0.046 0.038 0.033 0.029 0.026 0.024
Time used: 1:31
Model 1: NearlyNeutral -1697.654063 Model 2: PositiveSelection -1697.654063 Model 0: one-ratio -1702.386964 Model 3: discrete -1697.648436 Model 7: beta -1698.932663 Model 8: beta&w>1 -1697.673616 Model 0 vs 1 9.465802000000167 Model 2 vs 1 0.0 Model 8 vs 7 2.518094000000019
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
