--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 08 09:54:59 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/171/CG5780-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1832.45         -1843.38
2      -1832.43         -1841.68
--------------------------------------
TOTAL    -1832.44         -1842.85
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.846188    0.012211    0.644539    1.073575    0.842553   1170.23   1335.61    1.001
r(A<->C){all}   0.089270    0.000875    0.033256    0.148649    0.086731    756.22    844.38    1.000
r(A<->G){all}   0.264636    0.002905    0.163336    0.369801    0.261354    653.85    714.56    1.004
r(A<->T){all}   0.140183    0.001519    0.073129    0.225351    0.137559    726.63    783.95    1.000
r(C<->G){all}   0.029796    0.000267    0.000001    0.059650    0.028111    978.62   1048.21    1.000
r(C<->T){all}   0.427524    0.003930    0.316969    0.560151    0.424281    634.58    715.50    1.003
r(G<->T){all}   0.048592    0.000494    0.005419    0.090241    0.046661    873.12    924.88    1.000
pi(A){all}      0.258112    0.000240    0.230352    0.288733    0.257727   1137.41   1184.02    1.000
pi(C){all}      0.273330    0.000230    0.244286    0.304597    0.273713   1125.31   1146.07    1.000
pi(G){all}      0.248965    0.000223    0.220335    0.278235    0.248794   1122.51   1136.55    1.000
pi(T){all}      0.219593    0.000195    0.192116    0.246307    0.219441   1256.76   1338.80    1.000
alpha{1,2}      0.054787    0.000901    0.000114    0.100545    0.056775    878.98   1057.53    1.000
alpha{3}        3.191450    0.883497    1.568388    5.067614    3.052710   1267.23   1268.26    1.000
pinvar{all}     0.380973    0.003162    0.275629    0.490988    0.382214   1054.52   1223.36    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1697.654063
Model 2: PositiveSelection	-1697.654063
Model 0: one-ratio	-1702.386964
Model 3: discrete	-1697.648436
Model 7: beta	-1698.932663
Model 8: beta&w>1	-1697.673616


Model 0 vs 1	9.465802000000167

Model 2 vs 1	0.0

Model 8 vs 7	2.518094000000019
>C1
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAAGGSKDISIDITLNV
QAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNSF
DDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSRSA
VLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKLFT
EVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
>C2
MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAAGGSKDISIDITLNV
QAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKNSF
DDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSRSA
VLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKLFT
EVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
>C3
MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAPAGSKDISIDITLNV
QAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNNS
FDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSRS
AVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQLF
TEVTAEIHSDKAPIIGMKIGPDVVPPTQYo
>C4
MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAPAGSKDISIDITLNV
QAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNNS
FDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSRS
AVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKLF
TEVTAEIHSDKAPNNGMKIGPDVVPPTQYo
>C5
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNS
FDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSRS
AVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKLF
TEVTAEIHSDKVPNIGMKIGPDVVPPTQYS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=232 

C1              MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAA-GGSKDISIDITLN
C2              MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAA-GGSKDISIDITLN
C3              MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAP-AGSKDISIDITLN
C4              MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAP-AGSKDISIDITLN
C5              MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
                *****************************::  **. .************

C1              VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
C2              VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKN-
C3              VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
C4              VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
C5              VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
                ****:*********:*************************:******** 

C1              SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
C2              SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
C3              SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
C4              SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
C5              SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
                *******:*********************:***************:****

C1              SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
C2              SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
C3              SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
C4              SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
C5              SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
                *********:****************:***********.*********:*

C1              FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
C2              FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
C3              FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo-
C4              FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo-
C5              FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS-
                ************.*  ********:*****  




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  230 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  230 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4722]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [4722]--->[4716]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/171/CG5780-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.278 Mb, Max= 30.541 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAA-GGSKDISIDITLN
VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
>C2
MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAA-GGSKDISIDITLN
VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKN-
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
>C3
MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAP-AGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo-
>C4
MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAP-AGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo-
>C5
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS-

FORMAT of file /tmp/tmp4200578742652130796aln Not Supported[FATAL:T-COFFEE]
>C1
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAA-GGSKDISIDITLN
VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYTo
>C2
MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAA-GGSKDISIDITLN
VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKN-
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYTo
>C3
MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAP-AGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo-
>C4
MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAP-AGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo-
>C5
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKN-
SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS-
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:232 S:99 BS:232
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.96 C1	 C2	 96.96
TOP	    1    0	 96.96 C2	 C1	 96.96
BOT	    0    2	 92.58 C1	 C3	 92.58
TOP	    2    0	 92.58 C3	 C1	 92.58
BOT	    0    3	 95.20 C1	 C4	 95.20
TOP	    3    0	 95.20 C4	 C1	 95.20
BOT	    0    4	 95.63 C1	 C5	 95.63
TOP	    4    0	 95.63 C5	 C1	 95.63
BOT	    1    2	 93.01 C2	 C3	 93.01
TOP	    2    1	 93.01 C3	 C2	 93.01
BOT	    1    3	 95.20 C2	 C4	 95.20
TOP	    3    1	 95.20 C4	 C2	 95.20
BOT	    1    4	 95.63 C2	 C5	 95.63
TOP	    4    1	 95.63 C5	 C2	 95.63
BOT	    2    3	 96.96 C3	 C4	 96.96
TOP	    3    2	 96.96 C4	 C3	 96.96
BOT	    2    4	 94.76 C3	 C5	 94.76
TOP	    4    2	 94.76 C5	 C3	 94.76
BOT	    3    4	 96.94 C4	 C5	 96.94
TOP	    4    3	 96.94 C5	 C4	 96.94
AVG	 0	 C1	  *	 95.09
AVG	 1	 C2	  *	 95.20
AVG	 2	 C3	  *	 94.33
AVG	 3	 C4	  *	 96.07
AVG	 4	 C5	  *	 95.74
TOT	 TOT	  *	 95.29
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
C2              ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
C3              ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
C4              ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCCG
C5              ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCCG
                **************.*********************************.*

C1              GAAGGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGAGGAGGATGTCC
C2              GAAAGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGATGAGGATTCCC
C3              GAAGGGCCGGCGCTCCAAGAGCCGCGATGTCTTGAAGGAGGACTCCTCGC
C4              AAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGTCCTCGC
C5              GAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGGCCACGC
                .**.** ************** ********  ******* **  .    *

C1              AGGCGGCT---GGGGGCTCCAAGGACATTTCCATCGACATTACGCTGAAT
C2              AGGCGGCC---GGTGGCTCCAAGGACATTTCCATCGACATCACTCTGAAT
C3              AGGCGCCC---GCAGGCTCCAAGGACATTTCCATCGACATCACCCTGAAT
C4              AGGCGCCT---GCAGGCTCCAAGGATATTTCCATCGATATCACCCTGAAT
C5              AGGCGGCTCCTGCAGGCTCCAAGGATATTTCCATCGACATCACCCTGAAC
                ***** *    *  *********** *********** ** ** ***** 

C1              GTCCAGGCGGGCACCCCACCGACCACCTCGGACACGGCCACCTCGTCCAC
C2              GTTCAGGCGGGTACCCCACCCACCACATCGGACACGGCCACCACGTCCAC
C3              GTCCAGGCAGGCTCTCCGCCCACAACCTCGGACACGGCCACCTCGTCCAC
C4              GTCCAGGCAGGATCTCCACCCACAACCTCGGACACGGCCACCTCGTCCAC
C5              GTCCAGGCAGGATCGCCACCCACCACTTCGGATACGGCCACCTCGTCCAC
                ** *****.** :* **.** **.** ***** *********:*******

C1              ATACAACAATGAATTCGAGTCACATCGACCACCCATTCGTCGCATTTCAG
C2              ATATAACAATGAATTCGAGTCCCATCGACCACCCATTCGTCGCATTTCGG
C3              CTACAACAATGAATTCGAGTCGCACCGACCGCCCATCCGTCGGATTTCGG
C4              CTACAACAATGAATTCGAGTCGCATCGTCCACCCATTAGGCGGATCTCGG
C5              CTACAACAATGAGTTCGAGTCGCATCGTCCACCCATTCGACGAATTTCGG
                .** ********.******** ** **:**.***** .* ** ** **.*

C1              GTGGCTGGGCGGATTCTGGACTCAAAGGATTAAAGTCCAAGAAAAAC---
C2              GTGGCTGGGCGGATTCCGGATTCAAGGGATTAAAGTCCAAGAAAAAC---
C3              GAGGTTGGGCGGATTCGGGACTGAAGGGGTTAAAGTCCAAGAAGAACAAC
C4              GAGGCTGGGCGGATTCGGGTCTAAAGGGGTTAAAGTCCAAGAAGAACAAC
C5              GAGGTTGGGCCGATTCTGGTCTAAAGGGATTGAAGTCCAAGAAGAAC---
                *:** ***** ***** **: * **.**.**.***********.***   

C1              TCCTTTGATGATGAGCGCTTTAAACAAACAAAGTCGGCTACAAATTCCAT
C2              TCATTCGACGATGAGCGTTTTAGGCAAACAAAGTCGGCTACAAATTCCAT
C3              TCCTTTGATGACGAGCGTTTCAGGCAAACCAAGTCTGCTACAAATTCCAT
C4              TCCTTTGATGACGAACGTTTTAGGCAAACCAAGTCTGCTACAAATTCTAT
C5              TCATTTGACGACGAACGTTTTAGGCAGACCAAGTCGGCTACAAATTCAAT
                **.** ** ** **.** ** *..**.**.***** *********** **

C1              ACCAACGGATGACATTCCCGTCATCCCAGACATGGATGATGTCAAGGACG
C2              ACCAACGGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAGGACG
C3              TCCTACTGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAAGATG
C4              ACCTACTGATGACATTCCCGTCATTCCCGACATGGATGATGTTAAAGACG
C5              ACCGACGGATGACATTCCCGTCATCCCAGATATGGATGAAGTCAAGGATG
                :** ** ***************** **.** ********:** **.** *

C1              AAATCATGCTCAATGAGATTGTAGAACCGCCAACTATTGGCACCTCACGA
C2              AAATCATGCTCAATGAGATTGTGGAGCCGCCTACTATCGGCACCTCGCGA
C3              AAATTATGCTCAATGAGATAGTGGAACCTCCTACTATGGGCACTTCTCGA
C4              AAATAATGCTTAATGAGATAGTAGAACCTCCTACTATGGGCACTTCTCGA
C5              AAATAATGCTCAATGAGATTGTGGAACCGCCTACCATGGGCACTTCACGT
                **** ***** ********:**.**.** **:** ** ***** ** **:

C1              TCTGCTGTTTTGAAGGAGGCCAATTCCGATTTGCTTTCCCAGTACGCCTT
C2              TCCGCCGTCTTGAAGGAGGCCAATTCCGATTTGCTCTCTCAGTACGCATT
C3              TCCGCTGTCCTAAAGGAGGCCAATTCCGAGTTGCTTTCCCAGTACGCCTT
C4              TCTGCTGTCTTAAAGGAGGCCAATTCCGATTTGCTTTCTCAGTACGCCTT
C5              TCTGCTGTCTTGAAGGAGGCCAATTCCGATTTACTTTCCCAGTACGCCTT
                ** ** **  *.***************** **.** ** ********.**

C1              TTCAGCTGTGGATGGCTTTGATCTCTCAATCCTCACCGATTGCCTGGTTC
C2              TTCGGCTGTGGATGGCTTTGATCTCTCTATTCTAACCGATTGCCTAGTTC
C3              TTCTGCAGTGGACGGCTTCGATCTCTCAGTCCTAACAGACTGCCTGGTTC
C4              TTCTGCAGTGGACGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC
C5              TTCCGCAGTGGATGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC
                *** **:***** ***** ********:.* **.**.** *****.****

C1              CACAGGAGAGCCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAGCTG
C2              CACAGGAGAGCCTCAACGAGAAAGATGATCTCTGGCAGTGGGACAAACTG
C3              CACAGGAGAGTCTCAGCGAGAAGGACGATCTCTGGCAGTGGGACCAGCTC
C4              CGCAGGAGAGCCTCAATGAGAAGGACGACCTCTGGCAATGGGACAAACTC
C5              CGCAGGAGAGTCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAACTC
                *.******** ****. *****.** ** ********.******.*.** 

C1              TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATGGG
C2              TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATTGG
C3              TTTACCGAGGTCACGGCCGAAATCCATTCGGATAAGGCGCCCATCATAGG
C4              TTCACCGAGGTCACGGCAGAAATCCATTCGGATAAGGCACCAAACAATGG
C5              TTTACCGAGGTCACGGCTGAAATCCATTCGGATAAGGTGCCGAATATAGG
                ** ************** *****************.* .** *: *: **

C1              CATGAAAATAGGACCCGATGTGATTCCACCCACACAATATACT---
C2              CATGAAGATTGGACCCGATGTGGTTCCACCCACACAATATACT---
C3              CATGAAGATAGGACCTGATGTCGTACCCCCGACACAATAT------
C4              CATGAAGATAGGCCCTGATGTCGTACCCCCCACACAATAT------
C5              CATGAAGATAGGCCCCGATGTCGTTCCGCCCACACAATATTCT---
                ******.**:**.** ***** .*:** ** *********      



>C1
ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
GAAGGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGAGGAGGATGTCC
AGGCGGCT---GGGGGCTCCAAGGACATTTCCATCGACATTACGCTGAAT
GTCCAGGCGGGCACCCCACCGACCACCTCGGACACGGCCACCTCGTCCAC
ATACAACAATGAATTCGAGTCACATCGACCACCCATTCGTCGCATTTCAG
GTGGCTGGGCGGATTCTGGACTCAAAGGATTAAAGTCCAAGAAAAAC---
TCCTTTGATGATGAGCGCTTTAAACAAACAAAGTCGGCTACAAATTCCAT
ACCAACGGATGACATTCCCGTCATCCCAGACATGGATGATGTCAAGGACG
AAATCATGCTCAATGAGATTGTAGAACCGCCAACTATTGGCACCTCACGA
TCTGCTGTTTTGAAGGAGGCCAATTCCGATTTGCTTTCCCAGTACGCCTT
TTCAGCTGTGGATGGCTTTGATCTCTCAATCCTCACCGATTGCCTGGTTC
CACAGGAGAGCCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAGCTG
TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATGGG
CATGAAAATAGGACCCGATGTGATTCCACCCACACAATATACT---
>C2
ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
GAAAGGTCGGCGCTCCAAGAGTCGCGATGTTCTGAAGGATGAGGATTCCC
AGGCGGCC---GGTGGCTCCAAGGACATTTCCATCGACATCACTCTGAAT
GTTCAGGCGGGTACCCCACCCACCACATCGGACACGGCCACCACGTCCAC
ATATAACAATGAATTCGAGTCCCATCGACCACCCATTCGTCGCATTTCGG
GTGGCTGGGCGGATTCCGGATTCAAGGGATTAAAGTCCAAGAAAAAC---
TCATTCGACGATGAGCGTTTTAGGCAAACAAAGTCGGCTACAAATTCCAT
ACCAACGGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAGGACG
AAATCATGCTCAATGAGATTGTGGAGCCGCCTACTATCGGCACCTCGCGA
TCCGCCGTCTTGAAGGAGGCCAATTCCGATTTGCTCTCTCAGTACGCATT
TTCGGCTGTGGATGGCTTTGATCTCTCTATTCTAACCGATTGCCTAGTTC
CACAGGAGAGCCTCAACGAGAAAGATGATCTCTGGCAGTGGGACAAACTG
TTCACCGAGGTCACGGCTGAAATCCATTCGGATAAAGTGCCCAATATTGG
CATGAAGATTGGACCCGATGTGGTTCCACCCACACAATATACT---
>C3
ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCAG
GAAGGGCCGGCGCTCCAAGAGCCGCGATGTCTTGAAGGAGGACTCCTCGC
AGGCGCCC---GCAGGCTCCAAGGACATTTCCATCGACATCACCCTGAAT
GTCCAGGCAGGCTCTCCGCCCACAACCTCGGACACGGCCACCTCGTCCAC
CTACAACAATGAATTCGAGTCGCACCGACCGCCCATCCGTCGGATTTCGG
GAGGTTGGGCGGATTCGGGACTGAAGGGGTTAAAGTCCAAGAAGAACAAC
TCCTTTGATGACGAGCGTTTCAGGCAAACCAAGTCTGCTACAAATTCCAT
TCCTACTGATGACATTCCCGTCATTCCAGACATGGATGATGTCAAAGATG
AAATTATGCTCAATGAGATAGTGGAACCTCCTACTATGGGCACTTCTCGA
TCCGCTGTCCTAAAGGAGGCCAATTCCGAGTTGCTTTCCCAGTACGCCTT
TTCTGCAGTGGACGGCTTCGATCTCTCAGTCCTAACAGACTGCCTGGTTC
CACAGGAGAGTCTCAGCGAGAAGGACGATCTCTGGCAGTGGGACCAGCTC
TTTACCGAGGTCACGGCCGAAATCCATTCGGATAAGGCGCCCATCATAGG
CATGAAGATAGGACCTGATGTCGTACCCCCGACACAATAT------
>C4
ATGGACTGGGCCGAAGAACTCAAGATGACCATAAGAAAGACGACGGCCCG
AAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGTCCTCGC
AGGCGCCT---GCAGGCTCCAAGGATATTTCCATCGATATCACCCTGAAT
GTCCAGGCAGGATCTCCACCCACAACCTCGGACACGGCCACCTCGTCCAC
CTACAACAATGAATTCGAGTCGCATCGTCCACCCATTAGGCGGATCTCGG
GAGGCTGGGCGGATTCGGGTCTAAAGGGGTTAAAGTCCAAGAAGAACAAC
TCCTTTGATGACGAACGTTTTAGGCAAACCAAGTCTGCTACAAATTCTAT
ACCTACTGATGACATTCCCGTCATTCCCGACATGGATGATGTTAAAGACG
AAATAATGCTTAATGAGATAGTAGAACCTCCTACTATGGGCACTTCTCGA
TCTGCTGTCTTAAAGGAGGCCAATTCCGATTTGCTTTCTCAGTACGCCTT
TTCTGCAGTGGACGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC
CGCAGGAGAGCCTCAATGAGAAGGACGACCTCTGGCAATGGGACAAACTC
TTCACCGAGGTCACGGCAGAAATCCATTCGGATAAGGCACCAAACAATGG
CATGAAGATAGGCCCTGATGTCGTACCCCCCACACAATAT------
>C5
ATGGACTGGGCCGAGGAACTCAAGATGACCATAAGAAAGACGACGGCCCG
GAAGGGTCGGCGCTCCAAGAGTCGCGATGTCTTGAAGGAGGAGGCCACGC
AGGCGGCTCCTGCAGGCTCCAAGGATATTTCCATCGACATCACCCTGAAC
GTCCAGGCAGGATCGCCACCCACCACTTCGGATACGGCCACCTCGTCCAC
CTACAACAATGAGTTCGAGTCGCATCGTCCACCCATTCGACGAATTTCGG
GAGGTTGGGCCGATTCTGGTCTAAAGGGATTGAAGTCCAAGAAGAAC---
TCATTTGACGACGAACGTTTTAGGCAGACCAAGTCGGCTACAAATTCAAT
ACCGACGGATGACATTCCCGTCATCCCAGATATGGATGAAGTCAAGGATG
AAATAATGCTCAATGAGATTGTGGAACCGCCTACCATGGGCACTTCACGT
TCTGCTGTCTTGAAGGAGGCCAATTCCGATTTACTTTCCCAGTACGCCTT
TTCCGCAGTGGATGGCTTCGATCTCTCAATTCTAACCGATTGCCTGGTTC
CGCAGGAGAGTCTCAACGAGAAGGACGATCTCTGGCAGTGGGACAAACTC
TTTACCGAGGTCACGGCTGAAATCCATTCGGATAAGGTGCCGAATATAGG
CATGAAGATAGGCCCCGATGTCGTTCCGCCCACACAATATTCT---
>C1
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEDVQAAoGGSKDISIDITLN
VQAGTPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNo
SFDDERFKQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNMGMKIGPDVIPPTQYT
>C2
MDWAEELKMTIRKTTARKGRRSKSRDVLKDEDSQAAoGGSKDISIDITLN
VQAGTPPTTSDTATTSTYNNEFESHRPPIRRISGGWADSGFKGLKSKKNo
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTIGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYT
>C3
MDWAEELKMTIRKTTARKGRRSKSRDVLKEDSSQAPoAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSELLSQYAFSAVDGFDLSVLTDCLVPQESLSEKDDLWQWDQL
FTEVTAEIHSDKAPIIGMKIGPDVVPPTQYo
>C4
MDWAEELKMTIRKTTARKGRRSKSRDVLKEESSQAPoAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNN
SFDDERFRQTKSATNSIPTDDIPVIPDMDDVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKAPNNGMKIGPDVVPPTQYo
>C5
MDWAEELKMTIRKTTARKGRRSKSRDVLKEEATQAAPAGSKDISIDITLN
VQAGSPPTTSDTATSSTYNNEFESHRPPIRRISGGWADSGLKGLKSKKNo
SFDDERFRQTKSATNSIPTDDIPVIPDMDEVKDEIMLNEIVEPPTMGTSR
SAVLKEANSDLLSQYAFSAVDGFDLSILTDCLVPQESLNEKDDLWQWDKL
FTEVTAEIHSDKVPNIGMKIGPDVVPPTQYS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 696 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478598574
      Setting output file names to "/opt/ADOPS/171/CG5780-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1101435072
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0990564390
      Seed = 1849756579
      Swapseed = 1478598574
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 21 unique site patterns
      Division 2 has 16 unique site patterns
      Division 3 has 89 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2160.549775 -- -25.624409
         Chain 2 -- -2060.629841 -- -25.624409
         Chain 3 -- -2099.847526 -- -25.624409
         Chain 4 -- -2153.901963 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2150.212845 -- -25.624409
         Chain 2 -- -2071.951140 -- -25.624409
         Chain 3 -- -2157.862171 -- -25.624409
         Chain 4 -- -2164.991905 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2160.550] (-2060.630) (-2099.848) (-2153.902) * [-2150.213] (-2071.951) (-2157.862) (-2164.992) 
        500 -- [-1934.122] (-1926.281) (-1932.142) (-1923.955) * (-1921.988) [-1919.800] (-1940.317) (-1929.118) -- 0:33:19
       1000 -- (-1908.171) [-1910.120] (-1910.194) (-1911.889) * (-1923.412) [-1905.597] (-1926.474) (-1916.742) -- 0:16:39
       1500 -- [-1870.326] (-1909.972) (-1882.627) (-1897.986) * [-1903.884] (-1897.823) (-1896.501) (-1902.139) -- 0:11:05
       2000 -- [-1834.761] (-1877.865) (-1846.674) (-1866.002) * (-1857.672) [-1863.772] (-1869.626) (-1872.145) -- 0:08:19
       2500 -- [-1832.686] (-1848.969) (-1840.574) (-1850.466) * (-1845.397) [-1842.439] (-1838.414) (-1849.458) -- 0:06:39
       3000 -- [-1828.419] (-1839.268) (-1839.649) (-1835.433) * (-1846.475) [-1838.614] (-1840.511) (-1845.389) -- 0:05:32
       3500 -- [-1839.555] (-1834.610) (-1842.376) (-1836.817) * (-1857.849) [-1836.887] (-1841.029) (-1841.686) -- 0:04:44
       4000 -- (-1836.335) (-1834.925) (-1836.028) [-1834.901] * (-1843.119) (-1836.631) (-1843.919) [-1837.536] -- 0:04:09
       4500 -- (-1839.009) [-1834.578] (-1838.263) (-1842.710) * [-1830.118] (-1836.009) (-1838.574) (-1839.717) -- 0:03:41
       5000 -- (-1836.139) (-1831.900) [-1843.453] (-1843.811) * (-1836.374) [-1833.945] (-1836.208) (-1840.800) -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-1831.683] (-1836.391) (-1840.181) (-1834.703) * (-1835.670) (-1839.514) (-1833.606) [-1835.289] -- 0:06:01
       6000 -- [-1831.387] (-1836.228) (-1836.953) (-1835.657) * (-1829.180) (-1833.955) (-1838.861) [-1833.491] -- 0:05:31
       6500 -- (-1838.050) (-1842.433) (-1836.897) [-1833.285] * (-1833.034) [-1839.933] (-1836.897) (-1836.663) -- 0:05:05
       7000 -- [-1832.573] (-1843.795) (-1833.454) (-1837.468) * (-1839.900) [-1830.566] (-1840.216) (-1836.919) -- 0:04:43
       7500 -- (-1833.156) [-1839.216] (-1838.171) (-1834.292) * (-1834.770) (-1833.451) [-1838.052] (-1833.305) -- 0:04:24
       8000 -- (-1836.400) [-1831.793] (-1832.291) (-1835.149) * (-1834.030) [-1828.076] (-1841.241) (-1837.388) -- 0:04:08
       8500 -- (-1833.492) [-1834.518] (-1845.093) (-1831.947) * (-1843.130) [-1832.954] (-1838.174) (-1833.341) -- 0:03:53
       9000 -- (-1834.143) (-1830.409) (-1845.444) [-1832.772] * [-1840.170] (-1832.526) (-1836.612) (-1834.235) -- 0:05:30
       9500 -- [-1842.707] (-1841.591) (-1834.215) (-1832.958) * (-1834.896) [-1836.263] (-1838.664) (-1832.471) -- 0:05:12
      10000 -- (-1838.254) (-1839.022) (-1837.616) [-1834.690] * (-1835.950) (-1835.122) (-1838.312) [-1833.933] -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-1836.226) [-1832.034] (-1836.538) (-1843.665) * (-1832.745) [-1831.218] (-1833.619) (-1838.918) -- 0:04:42
      11000 -- (-1836.867) [-1830.378] (-1836.339) (-1836.617) * (-1835.090) (-1831.167) [-1834.370] (-1837.385) -- 0:04:29
      11500 -- (-1833.709) (-1837.187) [-1835.568] (-1835.751) * (-1838.465) (-1831.839) (-1835.926) [-1833.949] -- 0:04:17
      12000 -- (-1835.909) (-1839.630) [-1835.613] (-1835.224) * (-1837.213) [-1828.465] (-1831.982) (-1844.108) -- 0:04:07
      12500 -- (-1839.520) [-1832.029] (-1836.819) (-1837.538) * [-1842.931] (-1828.623) (-1834.177) (-1840.643) -- 0:03:57
      13000 -- (-1842.900) (-1837.497) [-1838.316] (-1839.287) * (-1832.377) [-1830.554] (-1833.910) (-1838.631) -- 0:03:47
      13500 -- (-1834.213) (-1841.347) [-1842.050] (-1844.617) * (-1842.273) (-1832.321) (-1836.282) [-1839.546] -- 0:04:52
      14000 -- [-1834.261] (-1835.014) (-1835.759) (-1836.191) * (-1843.874) [-1832.874] (-1837.962) (-1835.004) -- 0:04:41
      14500 -- (-1837.116) (-1837.198) (-1841.002) [-1836.441] * (-1844.340) (-1833.211) [-1835.643] (-1831.171) -- 0:04:31
      15000 -- (-1837.375) [-1834.167] (-1838.579) (-1833.593) * (-1840.770) [-1836.890] (-1834.773) (-1838.812) -- 0:04:22

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-1836.957) (-1831.264) [-1835.432] (-1836.017) * (-1841.591) (-1839.761) (-1838.414) [-1837.920] -- 0:04:14
      16000 -- (-1832.012) (-1842.092) (-1839.321) [-1839.578] * (-1834.220) (-1837.992) [-1836.688] (-1832.305) -- 0:04:06
      16500 -- (-1839.092) (-1837.803) (-1836.010) [-1836.053] * (-1840.825) (-1837.292) (-1842.056) [-1838.388] -- 0:03:58
      17000 -- (-1843.859) [-1840.067] (-1835.824) (-1842.552) * (-1837.614) (-1832.214) (-1837.567) [-1834.171] -- 0:03:51
      17500 -- (-1833.258) [-1830.448] (-1837.072) (-1839.485) * (-1832.108) (-1833.640) (-1837.456) [-1833.939] -- 0:03:44
      18000 -- [-1834.717] (-1833.189) (-1838.335) (-1839.072) * (-1832.801) [-1829.593] (-1833.502) (-1837.952) -- 0:04:32
      18500 -- (-1835.964) (-1833.110) (-1837.695) [-1841.426] * (-1832.205) (-1831.672) [-1837.458] (-1834.515) -- 0:04:25
      19000 -- (-1840.879) (-1833.276) (-1837.297) [-1836.514] * (-1832.070) (-1833.281) [-1842.116] (-1830.752) -- 0:04:18
      19500 -- (-1841.585) (-1836.508) (-1841.849) [-1839.004] * (-1832.812) [-1835.253] (-1837.565) (-1837.421) -- 0:04:11
      20000 -- [-1837.320] (-1844.223) (-1842.941) (-1840.181) * (-1836.429) (-1836.669) [-1835.599] (-1841.668) -- 0:04:05

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-1836.102) [-1837.198] (-1844.515) (-1836.686) * (-1843.354) (-1832.943) [-1833.416] (-1843.605) -- 0:03:58
      21000 -- (-1833.512) [-1839.236] (-1838.539) (-1836.310) * (-1837.421) [-1838.202] (-1836.945) (-1840.482) -- 0:03:53
      21500 -- (-1836.888) (-1838.599) (-1841.018) [-1832.382] * [-1831.174] (-1833.311) (-1837.695) (-1838.688) -- 0:03:47
      22000 -- (-1831.554) [-1837.447] (-1836.780) (-1836.913) * (-1838.214) (-1837.192) (-1836.416) [-1836.985] -- 0:04:26
      22500 -- (-1833.890) (-1833.544) (-1840.112) [-1834.292] * (-1835.503) [-1833.493] (-1832.760) (-1831.685) -- 0:04:20
      23000 -- [-1833.473] (-1832.195) (-1837.776) (-1841.120) * (-1833.692) (-1836.630) [-1836.129] (-1842.285) -- 0:04:14
      23500 -- (-1838.302) [-1834.311] (-1831.514) (-1834.563) * [-1835.777] (-1840.714) (-1839.634) (-1834.715) -- 0:04:09
      24000 -- (-1839.907) [-1831.338] (-1838.511) (-1832.307) * (-1835.239) (-1837.545) [-1838.882] (-1830.794) -- 0:04:04
      24500 -- (-1833.759) [-1833.789] (-1835.736) (-1835.455) * (-1840.188) (-1840.381) (-1831.847) [-1835.639] -- 0:03:58
      25000 -- [-1835.645] (-1838.150) (-1837.411) (-1834.404) * (-1834.667) (-1831.071) (-1837.927) [-1837.113] -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      25500 -- [-1843.225] (-1837.250) (-1840.119) (-1835.296) * [-1833.223] (-1833.315) (-1834.849) (-1837.793) -- 0:03:49
      26000 -- (-1840.946) (-1839.769) (-1839.019) [-1837.235] * [-1831.620] (-1837.041) (-1830.755) (-1836.464) -- 0:03:44
      26500 -- (-1836.370) (-1834.323) [-1834.594] (-1839.736) * [-1835.103] (-1833.427) (-1834.148) (-1834.321) -- 0:04:17
      27000 -- (-1841.363) [-1833.118] (-1835.765) (-1835.925) * [-1836.474] (-1839.409) (-1835.009) (-1831.852) -- 0:04:12
      27500 -- (-1836.456) [-1834.965] (-1831.607) (-1839.597) * (-1834.287) (-1834.654) [-1832.990] (-1835.714) -- 0:04:07
      28000 -- (-1842.462) [-1832.506] (-1843.596) (-1838.919) * (-1833.751) (-1832.903) (-1838.780) [-1834.068] -- 0:04:03
      28500 -- (-1834.401) [-1835.613] (-1836.331) (-1839.910) * [-1837.632] (-1838.946) (-1833.712) (-1829.052) -- 0:03:58
      29000 -- (-1832.355) (-1836.060) [-1842.167] (-1840.661) * (-1839.200) (-1844.663) (-1837.193) [-1836.147] -- 0:03:54
      29500 -- (-1836.766) (-1833.389) [-1839.673] (-1837.121) * (-1837.682) (-1834.846) [-1834.410] (-1839.103) -- 0:03:50
      30000 -- [-1835.867] (-1830.806) (-1837.418) (-1843.449) * (-1837.721) (-1842.735) [-1841.173] (-1836.755) -- 0:03:46

      Average standard deviation of split frequencies: 0.000000

      30500 -- [-1830.093] (-1838.486) (-1831.561) (-1834.468) * (-1830.735) (-1835.049) [-1838.257] (-1836.284) -- 0:03:42
      31000 -- (-1839.394) [-1835.356] (-1834.141) (-1836.316) * (-1833.637) (-1833.021) (-1839.277) [-1837.636] -- 0:04:10
      31500 -- (-1835.635) (-1841.485) (-1832.353) [-1834.526] * (-1832.933) (-1837.426) (-1833.795) [-1832.692] -- 0:04:05
      32000 -- (-1838.578) (-1834.799) (-1837.120) [-1840.695] * [-1836.402] (-1841.118) (-1834.726) (-1830.205) -- 0:04:02
      32500 -- (-1836.123) (-1842.225) [-1832.075] (-1832.791) * (-1834.821) [-1834.589] (-1838.027) (-1833.331) -- 0:03:58
      33000 -- [-1832.605] (-1831.360) (-1835.181) (-1845.371) * [-1834.775] (-1832.947) (-1833.116) (-1837.194) -- 0:03:54
      33500 -- (-1831.287) (-1834.784) (-1833.504) [-1837.121] * (-1836.697) (-1834.796) (-1832.001) [-1831.629] -- 0:03:50
      34000 -- (-1835.552) (-1836.718) (-1834.559) [-1832.186] * (-1836.160) (-1837.974) (-1834.515) [-1831.509] -- 0:03:47
      34500 -- (-1834.606) (-1837.433) (-1839.344) [-1836.936] * (-1838.526) [-1837.964] (-1836.189) (-1833.140) -- 0:03:43
      35000 -- (-1833.445) [-1836.909] (-1843.349) (-1839.746) * (-1838.434) [-1833.379] (-1834.936) (-1831.596) -- 0:03:40

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-1831.619) [-1834.379] (-1831.417) (-1838.744) * (-1844.835) [-1832.199] (-1843.105) (-1834.333) -- 0:04:04
      36000 -- (-1838.625) (-1832.189) (-1841.779) [-1839.916] * (-1841.774) (-1830.194) [-1835.641] (-1834.541) -- 0:04:01
      36500 -- [-1834.770] (-1844.705) (-1837.564) (-1839.477) * [-1830.769] (-1832.798) (-1835.268) (-1838.124) -- 0:03:57
      37000 -- (-1841.877) [-1835.138] (-1833.447) (-1830.728) * (-1835.137) (-1835.182) (-1835.668) [-1838.348] -- 0:03:54
      37500 -- (-1836.093) (-1839.600) (-1841.920) [-1835.562] * (-1834.142) (-1835.590) [-1834.205] (-1835.283) -- 0:03:51
      38000 -- (-1838.720) (-1836.181) (-1837.589) [-1836.540] * [-1843.100] (-1834.575) (-1841.396) (-1837.434) -- 0:03:47
      38500 -- (-1833.142) (-1834.591) [-1836.558] (-1834.765) * [-1830.129] (-1836.339) (-1837.191) (-1835.465) -- 0:03:44
      39000 -- (-1838.231) [-1831.722] (-1831.336) (-1835.522) * [-1837.097] (-1831.240) (-1835.034) (-1838.113) -- 0:03:41
      39500 -- (-1831.855) (-1832.495) [-1832.472] (-1836.019) * [-1829.181] (-1835.661) (-1841.604) (-1846.259) -- 0:04:03
      40000 -- (-1834.647) (-1836.082) (-1834.675) [-1836.079] * (-1833.910) (-1831.841) (-1839.634) [-1832.572] -- 0:04:00

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-1844.818) [-1835.314] (-1836.476) (-1834.694) * (-1834.570) (-1835.371) (-1838.844) [-1833.412] -- 0:03:56
      41000 -- (-1842.414) (-1835.579) [-1835.295] (-1832.922) * (-1832.958) (-1837.678) [-1837.252] (-1834.466) -- 0:03:53
      41500 -- (-1832.489) [-1836.411] (-1836.527) (-1844.586) * (-1834.746) [-1834.977] (-1842.971) (-1835.128) -- 0:03:50
      42000 -- (-1836.968) (-1834.544) (-1838.900) [-1836.060] * (-1839.398) [-1835.575] (-1842.606) (-1835.051) -- 0:03:48
      42500 -- (-1839.235) (-1832.684) (-1834.863) [-1832.993] * (-1840.888) [-1830.381] (-1839.874) (-1838.733) -- 0:03:45
      43000 -- (-1839.347) (-1835.621) [-1835.385] (-1838.926) * (-1840.566) (-1837.613) (-1839.524) [-1831.537] -- 0:03:42
      43500 -- (-1838.516) [-1838.930] (-1843.064) (-1838.830) * (-1834.720) (-1834.862) [-1834.582] (-1839.278) -- 0:03:39
      44000 -- (-1841.454) [-1838.210] (-1839.922) (-1837.227) * (-1839.009) [-1831.630] (-1837.442) (-1838.214) -- 0:03:59
      44500 -- (-1841.644) [-1832.166] (-1833.105) (-1838.865) * [-1839.156] (-1831.967) (-1840.866) (-1840.656) -- 0:03:56
      45000 -- (-1838.472) [-1834.282] (-1836.996) (-1839.727) * (-1835.125) [-1832.391] (-1835.088) (-1835.577) -- 0:03:53

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-1844.874) [-1833.564] (-1834.786) (-1834.718) * (-1839.707) (-1837.707) [-1837.635] (-1839.921) -- 0:03:50
      46000 -- (-1836.523) [-1832.994] (-1835.605) (-1839.621) * (-1834.279) [-1832.163] (-1838.103) (-1835.760) -- 0:03:48
      46500 -- (-1835.047) (-1845.525) (-1839.764) [-1834.575] * [-1834.316] (-1834.647) (-1842.037) (-1842.968) -- 0:03:45
      47000 -- (-1839.452) (-1836.163) [-1836.606] (-1835.033) * (-1836.689) [-1832.383] (-1840.358) (-1831.876) -- 0:03:43
      47500 -- (-1840.787) [-1835.740] (-1834.220) (-1836.378) * [-1838.656] (-1834.872) (-1835.056) (-1839.095) -- 0:03:40
      48000 -- (-1837.447) [-1834.319] (-1838.036) (-1835.716) * (-1830.859) (-1839.589) (-1840.598) [-1837.953] -- 0:03:38
      48500 -- (-1834.741) [-1832.438] (-1831.656) (-1834.414) * (-1839.075) (-1832.573) (-1841.937) [-1833.171] -- 0:03:55
      49000 -- (-1838.914) [-1839.431] (-1842.393) (-1831.539) * [-1838.611] (-1832.738) (-1839.353) (-1830.505) -- 0:03:52
      49500 -- [-1828.277] (-1836.368) (-1842.730) (-1835.736) * (-1840.377) [-1835.411] (-1834.461) (-1836.467) -- 0:03:50
      50000 -- [-1837.140] (-1844.578) (-1834.098) (-1845.464) * (-1839.690) [-1841.746] (-1841.537) (-1839.047) -- 0:03:48

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-1834.614) (-1834.177) [-1834.873] (-1835.049) * (-1841.809) [-1839.685] (-1837.183) (-1841.398) -- 0:03:45
      51000 -- [-1834.677] (-1836.583) (-1837.051) (-1837.690) * (-1842.301) [-1841.185] (-1834.514) (-1833.007) -- 0:03:43
      51500 -- (-1840.571) (-1831.982) (-1836.373) [-1839.730] * (-1837.476) (-1837.341) (-1839.546) [-1835.141] -- 0:03:41
      52000 -- [-1840.500] (-1837.217) (-1834.869) (-1840.768) * (-1843.337) (-1834.853) (-1834.903) [-1839.036] -- 0:03:38
      52500 -- [-1845.606] (-1835.642) (-1834.486) (-1840.872) * (-1838.200) (-1836.705) [-1834.415] (-1835.911) -- 0:03:54
      53000 -- (-1833.608) [-1837.336] (-1837.172) (-1842.860) * (-1844.260) [-1836.217] (-1832.210) (-1836.725) -- 0:03:52
      53500 -- (-1832.672) (-1831.103) [-1842.127] (-1840.060) * [-1844.417] (-1837.212) (-1834.029) (-1838.704) -- 0:03:49
      54000 -- (-1830.489) (-1832.774) (-1840.097) [-1839.952] * (-1846.969) (-1834.047) (-1844.995) [-1835.308] -- 0:03:47
      54500 -- (-1832.393) [-1834.470] (-1835.459) (-1839.041) * (-1838.859) [-1828.822] (-1839.479) (-1831.995) -- 0:03:45
      55000 -- [-1834.913] (-1836.325) (-1835.311) (-1840.976) * [-1843.141] (-1836.129) (-1843.513) (-1835.289) -- 0:03:43

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-1843.232) (-1830.725) (-1834.405) [-1848.138] * (-1833.576) [-1837.699] (-1837.522) (-1835.879) -- 0:03:41
      56000 -- (-1841.350) [-1834.663] (-1832.190) (-1844.030) * (-1833.547) [-1832.691] (-1850.529) (-1841.169) -- 0:03:39
      56500 -- (-1841.398) (-1832.477) (-1838.919) [-1843.110] * (-1837.043) (-1833.695) (-1844.573) [-1839.810] -- 0:03:37
      57000 -- (-1841.123) (-1835.943) (-1836.190) [-1829.439] * (-1839.320) (-1834.905) (-1839.670) [-1835.473] -- 0:03:51
      57500 -- (-1839.412) [-1839.922] (-1849.343) (-1834.570) * (-1833.728) [-1833.576] (-1842.552) (-1835.632) -- 0:03:49
      58000 -- (-1837.131) [-1836.083] (-1846.733) (-1833.871) * [-1835.762] (-1836.216) (-1840.488) (-1834.348) -- 0:03:47
      58500 -- (-1837.682) (-1838.677) (-1839.896) [-1832.672] * (-1836.958) [-1833.215] (-1840.028) (-1831.535) -- 0:03:45
      59000 -- (-1841.526) (-1838.424) (-1843.814) [-1838.433] * [-1831.690] (-1832.342) (-1835.332) (-1835.571) -- 0:03:43
      59500 -- [-1835.287] (-1837.027) (-1842.248) (-1836.627) * [-1837.384] (-1833.141) (-1835.828) (-1833.930) -- 0:03:41
      60000 -- [-1837.624] (-1835.168) (-1846.769) (-1845.189) * (-1836.755) [-1834.856] (-1835.560) (-1837.193) -- 0:03:39

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-1833.139) [-1836.353] (-1835.428) (-1837.530) * [-1833.981] (-1833.750) (-1840.461) (-1836.315) -- 0:03:37
      61000 -- (-1831.239) (-1840.669) (-1829.482) [-1833.302] * (-1835.631) [-1835.339] (-1839.051) (-1837.779) -- 0:03:50
      61500 -- (-1848.307) [-1832.582] (-1832.352) (-1837.140) * (-1838.394) (-1838.293) [-1839.508] (-1840.280) -- 0:03:48
      62000 -- (-1841.311) (-1838.123) [-1836.058] (-1832.123) * [-1837.049] (-1840.828) (-1838.461) (-1838.750) -- 0:03:46
      62500 -- (-1837.508) [-1836.740] (-1842.292) (-1830.390) * [-1837.066] (-1841.516) (-1848.162) (-1837.192) -- 0:03:45
      63000 -- (-1842.388) (-1842.328) [-1840.162] (-1838.106) * [-1836.230] (-1842.439) (-1843.553) (-1835.787) -- 0:03:43
      63500 -- (-1835.716) (-1846.602) [-1835.962] (-1837.919) * (-1836.574) (-1832.964) (-1832.491) [-1836.224] -- 0:03:41
      64000 -- [-1833.623] (-1843.112) (-1834.577) (-1838.090) * (-1831.170) (-1831.077) [-1840.934] (-1832.644) -- 0:03:39
      64500 -- [-1834.125] (-1848.494) (-1834.766) (-1833.558) * (-1834.152) (-1832.510) (-1836.062) [-1831.560] -- 0:03:37
      65000 -- [-1838.741] (-1835.967) (-1835.181) (-1837.204) * (-1835.125) (-1836.471) (-1832.851) [-1839.543] -- 0:03:35

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-1839.729) (-1832.890) (-1836.943) [-1840.808] * (-1835.390) [-1834.547] (-1839.793) (-1837.473) -- 0:03:48
      66000 -- (-1836.381) (-1838.200) [-1836.490] (-1841.769) * (-1842.744) (-1833.827) (-1834.169) [-1835.582] -- 0:03:46
      66500 -- (-1836.415) [-1829.946] (-1845.384) (-1837.672) * (-1834.191) (-1836.402) [-1835.505] (-1837.183) -- 0:03:44
      67000 -- (-1840.115) [-1831.360] (-1841.044) (-1837.066) * (-1831.828) (-1836.124) (-1834.080) [-1835.316] -- 0:03:42
      67500 -- [-1839.118] (-1834.629) (-1832.403) (-1837.696) * (-1836.586) [-1837.519] (-1832.531) (-1836.291) -- 0:03:41
      68000 -- [-1840.255] (-1834.475) (-1844.462) (-1835.325) * (-1834.346) (-1849.791) (-1836.383) [-1839.122] -- 0:03:39
      68500 -- (-1838.134) [-1832.633] (-1836.947) (-1836.756) * (-1833.945) (-1843.721) (-1837.979) [-1843.465] -- 0:03:37
      69000 -- [-1835.378] (-1833.069) (-1836.081) (-1834.123) * (-1835.017) (-1837.822) [-1833.763] (-1854.622) -- 0:03:35
      69500 -- (-1840.907) [-1841.320] (-1835.797) (-1831.405) * [-1831.831] (-1839.405) (-1836.588) (-1848.272) -- 0:03:34
      70000 -- (-1832.432) (-1835.621) (-1840.733) [-1841.947] * (-1832.635) (-1836.208) [-1833.778] (-1844.487) -- 0:03:45

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-1829.371) [-1837.327] (-1836.079) (-1833.822) * (-1836.205) (-1836.027) [-1834.231] (-1840.610) -- 0:03:44
      71000 -- (-1834.564) (-1830.861) [-1844.637] (-1836.511) * (-1832.189) (-1838.649) (-1833.484) [-1836.455] -- 0:03:42
      71500 -- (-1829.764) [-1836.335] (-1833.596) (-1837.488) * [-1833.352] (-1841.158) (-1839.595) (-1831.670) -- 0:03:40
      72000 -- (-1832.156) [-1839.315] (-1837.208) (-1841.308) * [-1835.919] (-1839.449) (-1839.442) (-1829.203) -- 0:03:39
      72500 -- (-1840.990) (-1838.786) (-1833.609) [-1834.752] * (-1837.082) [-1835.429] (-1840.536) (-1841.566) -- 0:03:37
      73000 -- [-1838.017] (-1838.000) (-1838.893) (-1833.993) * [-1835.570] (-1838.293) (-1837.850) (-1834.369) -- 0:03:35
      73500 -- [-1836.122] (-1832.650) (-1831.196) (-1838.878) * (-1835.632) [-1832.913] (-1841.213) (-1833.352) -- 0:03:34
      74000 -- [-1839.111] (-1839.803) (-1833.162) (-1831.283) * (-1833.882) (-1833.742) (-1840.787) [-1832.067] -- 0:03:45
      74500 -- (-1837.564) [-1838.858] (-1839.665) (-1835.372) * (-1833.374) (-1834.861) (-1831.958) [-1834.200] -- 0:03:43
      75000 -- (-1839.426) [-1836.601] (-1834.314) (-1836.342) * (-1841.523) [-1838.136] (-1841.170) (-1837.443) -- 0:03:42

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-1840.778) [-1832.675] (-1835.720) (-1831.917) * (-1838.112) (-1838.109) (-1841.011) [-1836.133] -- 0:03:40
      76000 -- (-1840.048) (-1835.382) [-1838.636] (-1841.614) * (-1835.240) [-1832.538] (-1840.736) (-1833.675) -- 0:03:38
      76500 -- (-1836.975) [-1831.089] (-1840.538) (-1838.307) * (-1837.581) (-1835.429) [-1833.682] (-1838.188) -- 0:03:37
      77000 -- (-1837.493) (-1840.949) (-1833.186) [-1833.804] * (-1837.889) [-1834.251] (-1837.298) (-1835.112) -- 0:03:35
      77500 -- (-1843.412) (-1841.669) (-1834.482) [-1838.284] * (-1839.446) [-1836.390] (-1837.536) (-1832.759) -- 0:03:34
      78000 -- (-1840.156) (-1836.222) (-1845.423) [-1835.552] * [-1833.739] (-1838.241) (-1834.469) (-1832.120) -- 0:03:32
      78500 -- (-1840.066) [-1837.749] (-1839.610) (-1832.531) * (-1838.049) (-1835.585) (-1838.580) [-1832.800] -- 0:03:43
      79000 -- [-1834.144] (-1848.558) (-1843.188) (-1836.973) * (-1836.946) [-1831.954] (-1833.979) (-1839.021) -- 0:03:41
      79500 -- (-1835.712) [-1837.774] (-1839.320) (-1838.446) * (-1833.285) [-1836.944] (-1839.237) (-1837.336) -- 0:03:39
      80000 -- (-1837.465) (-1835.233) [-1846.076] (-1840.340) * (-1842.185) (-1834.396) [-1834.644] (-1837.304) -- 0:03:38

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-1841.056) (-1840.338) (-1843.861) [-1841.583] * (-1838.905) (-1839.684) [-1836.302] (-1838.279) -- 0:03:37
      81000 -- [-1831.304] (-1834.021) (-1849.592) (-1836.742) * (-1843.568) (-1836.213) [-1829.834] (-1834.872) -- 0:03:35
      81500 -- (-1838.207) (-1832.551) (-1832.381) [-1836.619] * (-1834.188) (-1833.210) [-1833.718] (-1833.564) -- 0:03:34
      82000 -- (-1848.850) (-1835.541) (-1836.891) [-1841.139] * (-1841.224) (-1837.600) (-1839.792) [-1832.978] -- 0:03:32
      82500 -- (-1835.788) (-1842.837) (-1840.914) [-1836.977] * (-1836.764) (-1841.695) (-1838.161) [-1836.958] -- 0:03:42
      83000 -- (-1838.156) (-1836.866) (-1834.150) [-1836.750] * (-1833.458) (-1840.221) [-1837.024] (-1838.358) -- 0:03:40
      83500 -- [-1835.824] (-1837.198) (-1836.761) (-1845.920) * (-1836.506) (-1836.490) (-1834.147) [-1835.007] -- 0:03:39
      84000 -- [-1836.536] (-1833.036) (-1831.792) (-1840.749) * (-1842.167) [-1834.319] (-1832.354) (-1840.746) -- 0:03:38
      84500 -- (-1834.586) [-1831.551] (-1839.589) (-1839.547) * (-1836.245) [-1837.704] (-1835.773) (-1831.804) -- 0:03:36
      85000 -- [-1833.412] (-1833.483) (-1841.070) (-1839.069) * (-1837.940) (-1846.519) (-1838.333) [-1830.057] -- 0:03:35

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-1834.130) [-1839.799] (-1838.526) (-1838.179) * (-1831.937) [-1834.264] (-1839.451) (-1832.953) -- 0:03:33
      86000 -- [-1835.550] (-1834.789) (-1833.756) (-1835.984) * (-1828.877) [-1835.521] (-1839.000) (-1835.562) -- 0:03:32
      86500 -- (-1834.532) (-1835.863) [-1836.738] (-1836.383) * (-1830.315) [-1832.696] (-1840.711) (-1832.986) -- 0:03:31
      87000 -- (-1834.873) (-1840.199) (-1836.946) [-1835.707] * (-1833.473) (-1838.789) (-1836.782) [-1832.864] -- 0:03:40
      87500 -- [-1834.999] (-1832.525) (-1837.339) (-1838.480) * (-1842.403) (-1840.266) (-1835.369) [-1835.637] -- 0:03:39
      88000 -- (-1834.951) (-1835.640) [-1844.284] (-1835.275) * (-1841.656) [-1837.863] (-1839.994) (-1833.568) -- 0:03:37
      88500 -- (-1833.456) (-1839.272) [-1834.513] (-1838.891) * [-1839.797] (-1840.185) (-1833.405) (-1839.925) -- 0:03:36
      89000 -- (-1842.222) (-1833.997) [-1833.337] (-1842.721) * (-1841.852) (-1835.477) (-1836.616) [-1837.768] -- 0:03:34
      89500 -- (-1839.151) (-1839.439) [-1835.618] (-1841.959) * [-1837.238] (-1845.531) (-1830.617) (-1834.738) -- 0:03:33
      90000 -- (-1832.753) (-1840.180) (-1837.199) [-1837.653] * (-1841.714) (-1840.068) (-1837.146) [-1833.793] -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-1842.872) (-1834.238) [-1842.692] (-1835.025) * [-1834.702] (-1844.940) (-1845.811) (-1833.916) -- 0:03:31
      91000 -- [-1843.535] (-1834.064) (-1835.006) (-1844.183) * (-1836.141) (-1842.452) [-1834.619] (-1833.656) -- 0:03:29
      91500 -- (-1839.887) (-1838.365) [-1834.045] (-1836.809) * (-1835.886) [-1838.216] (-1839.505) (-1832.797) -- 0:03:38
      92000 -- (-1834.199) (-1836.864) [-1839.825] (-1837.190) * [-1833.348] (-1837.394) (-1842.909) (-1832.942) -- 0:03:37
      92500 -- (-1842.811) (-1834.393) [-1839.109] (-1836.530) * [-1834.496] (-1836.921) (-1835.366) (-1839.471) -- 0:03:35
      93000 -- (-1837.883) (-1834.603) [-1836.933] (-1839.168) * (-1835.438) [-1831.608] (-1837.899) (-1841.131) -- 0:03:34
      93500 -- (-1838.401) [-1837.083] (-1838.543) (-1834.480) * (-1834.000) (-1835.920) (-1836.893) [-1833.918] -- 0:03:33
      94000 -- (-1837.041) (-1836.213) [-1837.177] (-1836.644) * (-1839.633) (-1835.855) (-1834.829) [-1836.853] -- 0:03:32
      94500 -- (-1836.227) (-1838.025) (-1830.352) [-1841.670] * (-1838.170) (-1834.316) (-1843.348) [-1834.214] -- 0:03:30
      95000 -- [-1837.478] (-1837.983) (-1844.367) (-1835.887) * (-1834.615) (-1840.315) (-1840.972) [-1837.816] -- 0:03:29

      Average standard deviation of split frequencies: 0.000000

      95500 -- [-1832.282] (-1835.027) (-1837.759) (-1834.430) * (-1843.723) (-1839.374) [-1832.365] (-1838.114) -- 0:03:37
      96000 -- (-1839.223) (-1838.038) [-1833.117] (-1843.760) * (-1835.782) (-1834.065) (-1838.057) [-1837.169] -- 0:03:36
      96500 -- [-1840.931] (-1839.728) (-1836.746) (-1836.765) * (-1837.775) [-1836.450] (-1832.594) (-1830.278) -- 0:03:35
      97000 -- (-1836.153) [-1838.411] (-1834.384) (-1837.647) * (-1835.603) [-1840.900] (-1832.068) (-1838.072) -- 0:03:34
      97500 -- (-1831.679) [-1841.417] (-1837.536) (-1836.815) * [-1834.657] (-1833.501) (-1836.058) (-1836.199) -- 0:03:32
      98000 -- [-1834.536] (-1839.803) (-1838.653) (-1837.330) * (-1842.356) [-1837.108] (-1834.753) (-1838.228) -- 0:03:31
      98500 -- (-1840.843) (-1837.850) [-1839.330] (-1836.649) * (-1837.396) [-1831.337] (-1834.302) (-1834.605) -- 0:03:30
      99000 -- [-1831.743] (-1832.418) (-1836.382) (-1835.051) * (-1833.656) (-1840.625) [-1835.204] (-1836.172) -- 0:03:29
      99500 -- [-1833.360] (-1832.110) (-1831.245) (-1830.338) * [-1834.869] (-1833.407) (-1841.332) (-1838.800) -- 0:03:28
      100000 -- (-1829.632) (-1828.838) (-1833.627) [-1833.496] * (-1833.177) [-1829.998] (-1835.405) (-1832.611) -- 0:03:36

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-1830.193) [-1836.021] (-1835.163) (-1840.916) * (-1836.905) [-1836.743] (-1837.393) (-1839.151) -- 0:03:34
      101000 -- (-1837.932) (-1837.551) (-1835.780) [-1834.353] * (-1833.723) (-1836.578) [-1833.109] (-1836.396) -- 0:03:33
      101500 -- (-1835.022) [-1833.380] (-1836.396) (-1833.331) * (-1837.793) (-1833.893) (-1835.065) [-1839.946] -- 0:03:32
      102000 -- (-1838.525) [-1829.315] (-1833.714) (-1833.224) * [-1839.530] (-1832.038) (-1832.302) (-1847.278) -- 0:03:31
      102500 -- [-1836.794] (-1838.898) (-1839.161) (-1837.468) * (-1836.042) (-1837.381) (-1841.961) [-1834.201] -- 0:03:30
      103000 -- [-1833.282] (-1843.486) (-1842.113) (-1828.931) * (-1835.745) (-1836.022) (-1839.254) [-1836.097] -- 0:03:29
      103500 -- (-1838.720) (-1830.059) (-1839.129) [-1834.039] * (-1835.010) (-1835.201) (-1835.625) [-1836.689] -- 0:03:27
      104000 -- (-1837.725) (-1836.188) (-1835.971) [-1835.986] * [-1833.824] (-1832.317) (-1837.754) (-1833.067) -- 0:03:35
      104500 -- (-1840.860) (-1836.351) (-1834.526) [-1833.987] * (-1835.706) (-1837.565) [-1834.844] (-1835.726) -- 0:03:34
      105000 -- (-1834.687) (-1836.850) [-1833.488] (-1832.596) * (-1845.794) (-1837.671) (-1833.969) [-1831.772] -- 0:03:33

      Average standard deviation of split frequencies: 0.000000

      105500 -- [-1836.102] (-1831.154) (-1832.620) (-1841.837) * (-1833.966) [-1833.461] (-1839.233) (-1833.115) -- 0:03:31
      106000 -- (-1836.044) [-1838.325] (-1837.222) (-1835.725) * [-1837.314] (-1836.437) (-1835.814) (-1834.380) -- 0:03:30
      106500 -- (-1837.559) (-1838.564) (-1839.748) [-1838.157] * (-1832.709) [-1832.968] (-1832.801) (-1839.627) -- 0:03:29
      107000 -- (-1841.817) [-1839.168] (-1836.534) (-1835.170) * (-1832.115) (-1841.694) (-1842.464) [-1836.522] -- 0:03:28
      107500 -- [-1840.368] (-1835.964) (-1835.896) (-1838.403) * (-1836.793) (-1835.302) (-1839.665) [-1840.943] -- 0:03:27
      108000 -- (-1836.698) (-1837.789) (-1841.328) [-1838.455] * (-1835.912) (-1837.887) (-1837.731) [-1833.490] -- 0:03:26
      108500 -- (-1835.394) [-1831.479] (-1834.111) (-1832.680) * (-1842.951) [-1835.555] (-1845.726) (-1838.385) -- 0:03:33
      109000 -- (-1830.845) [-1840.849] (-1832.076) (-1839.572) * (-1832.455) (-1841.982) (-1838.229) [-1836.112] -- 0:03:32
      109500 -- (-1841.594) [-1837.688] (-1834.291) (-1833.741) * (-1842.594) (-1838.378) (-1834.744) [-1833.520] -- 0:03:31
      110000 -- (-1840.081) (-1839.939) (-1835.013) [-1836.978] * (-1843.750) (-1840.516) (-1836.145) [-1836.653] -- 0:03:30

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-1835.546) (-1843.235) (-1839.728) [-1836.195] * [-1839.574] (-1839.023) (-1837.643) (-1830.734) -- 0:03:29
      111000 -- (-1834.162) (-1834.984) [-1832.151] (-1842.129) * [-1836.952] (-1837.305) (-1833.568) (-1836.266) -- 0:03:28
      111500 -- [-1836.613] (-1837.098) (-1833.260) (-1839.512) * (-1835.149) [-1831.119] (-1833.221) (-1834.207) -- 0:03:27
      112000 -- (-1831.327) (-1836.442) (-1833.081) [-1837.809] * (-1840.490) (-1836.474) [-1834.427] (-1832.306) -- 0:03:26
      112500 -- (-1833.023) [-1835.473] (-1844.388) (-1835.004) * (-1832.763) (-1840.105) [-1843.164] (-1835.121) -- 0:03:33
      113000 -- (-1837.245) (-1841.120) (-1839.016) [-1837.129] * (-1835.714) (-1841.570) [-1833.669] (-1830.023) -- 0:03:31
      113500 -- (-1836.069) [-1835.434] (-1839.162) (-1834.117) * (-1836.616) [-1836.731] (-1833.661) (-1837.753) -- 0:03:30
      114000 -- (-1833.138) [-1836.166] (-1836.121) (-1842.562) * (-1840.126) (-1834.461) [-1833.318] (-1838.580) -- 0:03:29
      114500 -- (-1833.946) (-1834.273) [-1834.584] (-1849.033) * (-1840.775) (-1842.813) (-1835.156) [-1835.497] -- 0:03:28
      115000 -- (-1832.203) (-1834.761) [-1838.441] (-1841.114) * (-1847.060) (-1844.109) [-1834.821] (-1832.485) -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-1834.679) (-1838.179) [-1840.719] (-1840.660) * (-1837.958) [-1835.709] (-1839.599) (-1832.431) -- 0:03:26
      116000 -- [-1842.013] (-1839.463) (-1837.852) (-1843.969) * (-1838.639) [-1837.154] (-1838.479) (-1833.304) -- 0:03:25
      116500 -- (-1835.440) [-1834.399] (-1839.761) (-1835.752) * (-1845.633) (-1838.873) (-1833.789) [-1833.573] -- 0:03:24
      117000 -- (-1835.498) (-1837.256) [-1833.995] (-1838.938) * [-1830.777] (-1837.932) (-1839.507) (-1845.356) -- 0:03:31
      117500 -- (-1835.444) [-1837.725] (-1832.735) (-1833.885) * (-1841.978) [-1830.103] (-1835.283) (-1841.633) -- 0:03:30
      118000 -- [-1831.989] (-1847.413) (-1834.912) (-1847.446) * (-1840.826) (-1835.792) [-1832.221] (-1843.216) -- 0:03:29
      118500 -- [-1840.139] (-1842.810) (-1835.266) (-1842.652) * (-1841.661) [-1837.639] (-1836.152) (-1837.216) -- 0:03:28
      119000 -- (-1835.045) [-1833.948] (-1835.888) (-1842.823) * [-1838.572] (-1833.540) (-1835.326) (-1839.622) -- 0:03:27
      119500 -- (-1835.906) [-1834.800] (-1839.800) (-1839.980) * (-1834.024) (-1832.574) (-1835.479) [-1835.483] -- 0:03:26
      120000 -- (-1833.555) (-1833.761) (-1839.359) [-1840.690] * (-1838.523) (-1836.798) [-1837.210] (-1836.338) -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-1833.605) (-1832.758) [-1834.501] (-1838.987) * [-1833.909] (-1842.564) (-1831.607) (-1840.321) -- 0:03:24
      121000 -- [-1839.219] (-1833.078) (-1836.214) (-1838.486) * [-1835.704] (-1834.881) (-1837.255) (-1844.757) -- 0:03:30
      121500 -- [-1839.321] (-1833.099) (-1831.967) (-1834.428) * (-1836.215) (-1837.154) (-1834.824) [-1835.802] -- 0:03:29
      122000 -- (-1841.370) (-1836.509) [-1832.736] (-1837.168) * (-1838.704) (-1838.090) (-1833.862) [-1836.227] -- 0:03:28
      122500 -- (-1838.300) [-1832.931] (-1832.017) (-1837.439) * (-1831.967) [-1832.010] (-1832.054) (-1837.710) -- 0:03:27
      123000 -- (-1842.317) [-1835.073] (-1836.988) (-1841.394) * (-1829.828) [-1835.387] (-1838.215) (-1840.723) -- 0:03:26
      123500 -- [-1829.858] (-1834.168) (-1839.170) (-1834.129) * (-1833.837) [-1835.197] (-1839.840) (-1831.564) -- 0:03:25
      124000 -- (-1834.023) [-1838.273] (-1840.781) (-1842.112) * (-1831.971) (-1830.120) (-1838.360) [-1831.299] -- 0:03:24
      124500 -- (-1836.683) (-1833.005) (-1840.871) [-1831.390] * (-1832.170) (-1833.329) (-1834.570) [-1840.025] -- 0:03:23
      125000 -- [-1839.346] (-1833.262) (-1833.474) (-1832.041) * (-1837.717) (-1840.741) [-1839.897] (-1836.661) -- 0:03:23

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-1835.662) [-1831.330] (-1835.057) (-1831.385) * (-1843.489) (-1841.359) (-1837.493) [-1835.781] -- 0:03:29
      126000 -- (-1832.539) (-1835.165) [-1838.280] (-1839.920) * (-1845.646) (-1838.400) (-1836.441) [-1833.935] -- 0:03:28
      126500 -- (-1840.496) (-1840.201) (-1836.108) [-1837.374] * (-1837.417) [-1831.803] (-1836.960) (-1834.301) -- 0:03:27
      127000 -- (-1831.130) (-1832.004) (-1835.239) [-1837.738] * [-1834.533] (-1834.776) (-1833.401) (-1834.283) -- 0:03:26
      127500 -- (-1830.622) (-1837.922) (-1835.550) [-1836.721] * [-1839.296] (-1833.491) (-1840.627) (-1832.552) -- 0:03:25
      128000 -- (-1837.945) [-1832.817] (-1835.188) (-1834.002) * (-1841.544) (-1834.553) (-1840.629) [-1835.232] -- 0:03:24
      128500 -- (-1836.826) (-1838.762) [-1836.849] (-1836.397) * [-1840.208] (-1835.737) (-1839.158) (-1837.270) -- 0:03:23
      129000 -- (-1833.425) [-1833.831] (-1835.016) (-1839.843) * (-1837.209) (-1839.286) [-1830.946] (-1839.298) -- 0:03:22
      129500 -- (-1832.805) [-1843.331] (-1838.564) (-1839.722) * (-1839.737) (-1842.617) [-1828.952] (-1831.859) -- 0:03:28
      130000 -- (-1835.927) (-1831.103) (-1837.400) [-1836.655] * [-1836.828] (-1845.145) (-1841.473) (-1836.298) -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      130500 -- [-1832.659] (-1843.230) (-1833.414) (-1831.930) * [-1837.338] (-1833.762) (-1838.404) (-1842.977) -- 0:03:26
      131000 -- (-1838.323) (-1837.703) (-1837.132) [-1831.170] * (-1839.351) [-1836.583] (-1833.765) (-1838.298) -- 0:03:25
      131500 -- (-1833.708) [-1836.020] (-1834.544) (-1833.678) * (-1846.010) [-1832.511] (-1833.352) (-1841.669) -- 0:03:24
      132000 -- (-1837.523) [-1836.078] (-1833.301) (-1837.399) * (-1836.124) [-1836.817] (-1833.607) (-1835.531) -- 0:03:23
      132500 -- (-1836.615) (-1834.739) [-1832.930] (-1842.808) * [-1834.207] (-1835.130) (-1845.896) (-1834.631) -- 0:03:22
      133000 -- (-1842.847) (-1835.155) (-1844.545) [-1837.503] * (-1837.648) [-1838.927] (-1829.457) (-1834.266) -- 0:03:22
      133500 -- (-1841.856) [-1833.075] (-1834.773) (-1840.038) * (-1852.335) [-1845.725] (-1834.732) (-1837.106) -- 0:03:21
      134000 -- (-1837.809) (-1831.684) (-1839.500) [-1831.935] * (-1842.392) (-1832.390) [-1834.955] (-1835.416) -- 0:03:26
      134500 -- (-1837.551) (-1837.920) [-1835.873] (-1835.573) * (-1849.991) (-1835.375) (-1834.673) [-1837.296] -- 0:03:25
      135000 -- (-1833.521) (-1836.804) [-1837.683] (-1840.810) * (-1844.381) (-1836.749) (-1835.224) [-1833.835] -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      135500 -- [-1835.560] (-1840.345) (-1835.357) (-1837.910) * (-1841.735) [-1832.789] (-1837.405) (-1833.632) -- 0:03:24
      136000 -- (-1835.563) (-1836.486) (-1836.037) [-1836.080] * (-1843.991) [-1837.070] (-1835.543) (-1830.266) -- 0:03:23
      136500 -- (-1833.102) (-1839.032) (-1836.108) [-1831.343] * (-1849.094) (-1846.429) (-1841.536) [-1834.221] -- 0:03:22
      137000 -- (-1832.420) [-1835.716] (-1831.066) (-1831.823) * (-1851.877) (-1835.299) [-1838.364] (-1835.766) -- 0:03:21
      137500 -- (-1833.303) (-1841.089) (-1837.446) [-1832.785] * (-1841.642) [-1835.188] (-1838.329) (-1839.687) -- 0:03:20
      138000 -- (-1838.667) (-1831.681) (-1835.511) [-1834.398] * (-1839.330) (-1834.386) [-1838.447] (-1838.692) -- 0:03:19
      138500 -- (-1836.736) (-1841.084) [-1834.299] (-1832.434) * (-1836.366) [-1836.803] (-1842.611) (-1833.560) -- 0:03:25
      139000 -- (-1835.084) (-1838.448) [-1832.986] (-1834.242) * (-1834.558) [-1832.585] (-1834.747) (-1844.007) -- 0:03:24
      139500 -- (-1834.624) (-1840.162) (-1841.919) [-1834.855] * [-1834.742] (-1841.763) (-1832.468) (-1836.414) -- 0:03:23
      140000 -- (-1838.031) (-1844.825) (-1842.591) [-1831.381] * [-1834.100] (-1833.197) (-1837.751) (-1840.114) -- 0:03:22

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-1837.463) (-1834.449) (-1839.258) [-1835.391] * (-1834.721) (-1834.883) (-1838.240) [-1839.589] -- 0:03:21
      141000 -- (-1837.649) (-1832.375) (-1837.308) [-1832.144] * (-1834.530) [-1835.094] (-1837.873) (-1835.353) -- 0:03:21
      141500 -- (-1835.280) [-1833.804] (-1839.519) (-1836.032) * (-1835.259) [-1834.004] (-1837.765) (-1835.107) -- 0:03:20
      142000 -- [-1834.603] (-1833.991) (-1833.215) (-1840.487) * (-1833.871) (-1832.419) [-1839.337] (-1842.468) -- 0:03:19
      142500 -- (-1834.322) [-1832.951] (-1840.154) (-1845.753) * (-1834.661) (-1834.676) (-1832.836) [-1842.072] -- 0:03:18
      143000 -- [-1834.987] (-1844.052) (-1830.796) (-1841.035) * (-1834.064) (-1842.265) [-1831.854] (-1847.800) -- 0:03:23
      143500 -- (-1835.919) [-1837.393] (-1836.990) (-1842.463) * [-1836.382] (-1837.788) (-1837.886) (-1842.700) -- 0:03:22
      144000 -- (-1832.756) (-1837.177) [-1841.231] (-1839.319) * (-1835.516) (-1831.022) [-1834.297] (-1842.289) -- 0:03:22
      144500 -- [-1838.130] (-1833.194) (-1838.334) (-1840.976) * (-1835.027) (-1837.073) [-1831.907] (-1833.366) -- 0:03:21
      145000 -- (-1843.620) [-1831.801] (-1835.808) (-1838.880) * [-1837.586] (-1835.933) (-1839.776) (-1834.199) -- 0:03:20

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-1836.990) [-1836.034] (-1833.286) (-1835.697) * (-1839.118) [-1836.891] (-1834.138) (-1839.337) -- 0:03:19
      146000 -- (-1836.964) (-1847.452) (-1834.673) [-1834.839] * [-1841.433] (-1834.688) (-1834.636) (-1836.238) -- 0:03:18
      146500 -- (-1838.410) [-1837.720] (-1831.132) (-1838.408) * (-1833.761) (-1838.073) (-1839.925) [-1836.568] -- 0:03:18
      147000 -- (-1838.498) [-1834.581] (-1837.017) (-1837.077) * (-1833.839) (-1835.027) (-1837.402) [-1834.390] -- 0:03:23
      147500 -- (-1848.167) (-1838.060) (-1831.409) [-1838.987] * (-1838.665) (-1833.422) (-1833.718) [-1830.751] -- 0:03:22
      148000 -- (-1841.895) (-1836.243) (-1832.959) [-1835.567] * (-1833.257) (-1832.007) (-1838.851) [-1835.803] -- 0:03:21
      148500 -- (-1846.734) [-1832.084] (-1832.158) (-1840.061) * (-1837.363) [-1838.517] (-1836.116) (-1831.653) -- 0:03:20
      149000 -- (-1838.977) (-1832.975) [-1836.520] (-1840.007) * (-1838.289) (-1838.657) [-1834.221] (-1831.198) -- 0:03:19
      149500 -- (-1841.348) [-1835.002] (-1833.631) (-1834.584) * [-1832.129] (-1837.293) (-1832.435) (-1836.626) -- 0:03:19
      150000 -- [-1840.804] (-1831.675) (-1834.665) (-1835.203) * (-1841.788) (-1833.088) (-1835.855) [-1832.389] -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      150500 -- [-1832.069] (-1838.382) (-1837.555) (-1833.095) * (-1835.062) [-1834.608] (-1837.789) (-1841.700) -- 0:03:17
      151000 -- (-1834.787) [-1831.449] (-1834.199) (-1835.394) * (-1833.335) (-1836.064) [-1838.140] (-1837.769) -- 0:03:16
      151500 -- (-1830.774) (-1833.180) (-1832.803) [-1839.415] * (-1830.772) (-1833.580) [-1836.979] (-1839.905) -- 0:03:21
      152000 -- (-1831.470) (-1840.245) [-1832.060] (-1842.357) * (-1839.281) (-1830.790) (-1838.848) [-1839.455] -- 0:03:20
      152500 -- (-1838.120) (-1834.277) (-1846.020) [-1847.113] * (-1835.834) (-1837.131) [-1835.779] (-1834.033) -- 0:03:20
      153000 -- (-1839.938) (-1840.185) [-1837.708] (-1842.845) * (-1836.116) (-1837.848) (-1829.865) [-1837.851] -- 0:03:19
      153500 -- (-1835.218) [-1835.650] (-1835.577) (-1840.696) * (-1838.107) (-1837.496) (-1835.175) [-1833.477] -- 0:03:18
      154000 -- [-1839.948] (-1839.235) (-1831.913) (-1841.612) * (-1833.285) (-1835.840) [-1836.187] (-1835.488) -- 0:03:17
      154500 -- (-1832.837) (-1838.402) [-1839.923] (-1838.031) * [-1835.943] (-1833.982) (-1831.265) (-1840.554) -- 0:03:17
      155000 -- (-1837.048) [-1832.810] (-1835.168) (-1836.735) * [-1838.508] (-1841.844) (-1833.585) (-1834.867) -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      155500 -- [-1834.791] (-1832.874) (-1841.889) (-1838.543) * (-1841.673) (-1835.346) (-1833.222) [-1838.390] -- 0:03:15
      156000 -- [-1831.929] (-1836.604) (-1835.164) (-1845.771) * (-1840.945) (-1840.455) (-1834.422) [-1831.785] -- 0:03:20
      156500 -- (-1832.252) (-1832.382) (-1838.749) [-1837.890] * (-1837.685) [-1830.497] (-1837.878) (-1834.299) -- 0:03:19
      157000 -- (-1838.491) [-1833.510] (-1835.501) (-1843.969) * (-1837.169) [-1838.618] (-1838.572) (-1836.120) -- 0:03:18
      157500 -- (-1838.882) [-1839.943] (-1833.385) (-1839.164) * (-1837.462) (-1835.247) (-1842.315) [-1833.759] -- 0:03:17
      158000 -- (-1837.717) (-1851.606) [-1838.117] (-1837.002) * (-1834.252) [-1839.804] (-1843.636) (-1834.718) -- 0:03:17
      158500 -- [-1835.089] (-1838.698) (-1833.610) (-1843.483) * (-1834.338) (-1840.121) (-1833.312) [-1832.908] -- 0:03:16
      159000 -- (-1830.662) (-1838.473) (-1830.001) [-1836.913] * (-1832.591) (-1840.862) (-1839.658) [-1837.133] -- 0:03:15
      159500 -- (-1829.040) (-1831.261) [-1839.480] (-1840.439) * (-1834.798) [-1842.226] (-1842.256) (-1840.090) -- 0:03:14
      160000 -- [-1835.303] (-1834.852) (-1835.483) (-1847.455) * [-1837.225] (-1838.232) (-1842.861) (-1833.887) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-1835.286) [-1834.777] (-1835.165) (-1840.820) * (-1840.376) (-1834.552) [-1833.312] (-1838.286) -- 0:03:18
      161000 -- [-1837.431] (-1832.750) (-1844.477) (-1835.375) * [-1833.117] (-1837.521) (-1830.321) (-1836.063) -- 0:03:18
      161500 -- (-1836.522) (-1838.718) (-1838.273) [-1837.302] * (-1838.160) (-1842.262) (-1837.254) [-1831.775] -- 0:03:17
      162000 -- [-1837.081] (-1840.532) (-1830.810) (-1838.244) * [-1839.625] (-1841.082) (-1838.570) (-1836.197) -- 0:03:16
      162500 -- (-1841.566) (-1838.986) (-1833.519) [-1838.291] * (-1830.591) (-1837.881) (-1846.415) [-1831.476] -- 0:03:15
      163000 -- (-1840.639) (-1833.680) [-1831.662] (-1836.064) * (-1846.408) (-1835.934) [-1833.980] (-1835.109) -- 0:03:15
      163500 -- (-1833.649) (-1832.611) (-1830.835) [-1837.392] * (-1839.967) (-1837.910) (-1833.146) [-1837.660] -- 0:03:14
      164000 -- (-1840.939) (-1835.045) [-1834.282] (-1837.063) * (-1836.693) (-1838.167) [-1833.827] (-1836.356) -- 0:03:13
      164500 -- (-1839.491) [-1833.135] (-1834.266) (-1835.641) * (-1838.692) (-1834.884) (-1831.377) [-1842.230] -- 0:03:18
      165000 -- (-1833.978) (-1830.531) (-1835.105) [-1833.048] * (-1832.995) (-1833.489) [-1831.540] (-1840.315) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      165500 -- [-1830.920] (-1836.897) (-1841.890) (-1831.901) * (-1838.395) [-1842.433] (-1834.449) (-1831.547) -- 0:03:16
      166000 -- [-1834.884] (-1835.237) (-1836.508) (-1833.459) * [-1839.242] (-1835.705) (-1831.927) (-1836.514) -- 0:03:15
      166500 -- [-1833.978] (-1837.097) (-1834.698) (-1835.176) * [-1834.498] (-1836.005) (-1840.871) (-1839.043) -- 0:03:15
      167000 -- [-1836.399] (-1838.412) (-1833.297) (-1835.331) * (-1838.299) (-1845.280) [-1837.466] (-1838.732) -- 0:03:14
      167500 -- (-1835.466) (-1838.809) (-1837.032) [-1838.840] * (-1839.110) [-1838.354] (-1837.158) (-1841.081) -- 0:03:13
      168000 -- (-1835.438) [-1837.176] (-1836.430) (-1839.309) * [-1837.153] (-1841.793) (-1836.147) (-1842.358) -- 0:03:13
      168500 -- (-1832.137) (-1837.706) [-1840.533] (-1835.729) * (-1834.148) (-1837.966) [-1836.691] (-1837.958) -- 0:03:17
      169000 -- (-1831.873) (-1841.383) (-1832.656) [-1835.522] * (-1836.736) (-1837.424) (-1833.451) [-1839.173] -- 0:03:16
      169500 -- [-1838.562] (-1838.133) (-1834.854) (-1837.108) * (-1837.474) [-1840.580] (-1833.486) (-1838.742) -- 0:03:15
      170000 -- (-1832.887) (-1836.516) [-1834.266] (-1839.195) * [-1833.830] (-1838.085) (-1837.741) (-1834.416) -- 0:03:15

      Average standard deviation of split frequencies: 0.000000

      170500 -- (-1835.053) (-1840.800) (-1832.182) [-1835.316] * [-1830.878] (-1837.324) (-1836.656) (-1837.632) -- 0:03:14
      171000 -- (-1835.981) (-1839.451) (-1832.261) [-1836.260] * (-1841.554) [-1838.410] (-1841.320) (-1836.256) -- 0:03:13
      171500 -- (-1835.492) (-1843.916) [-1832.558] (-1835.930) * (-1832.495) (-1836.596) [-1830.505] (-1829.820) -- 0:03:13
      172000 -- [-1834.808] (-1837.536) (-1834.688) (-1839.355) * (-1838.830) (-1834.933) (-1834.677) [-1837.101] -- 0:03:12
      172500 -- [-1833.997] (-1832.027) (-1832.649) (-1833.919) * (-1831.413) [-1839.434] (-1839.867) (-1834.899) -- 0:03:11
      173000 -- (-1840.990) (-1837.456) [-1836.879] (-1837.189) * (-1839.674) [-1844.155] (-1840.968) (-1831.394) -- 0:03:15
      173500 -- (-1832.299) [-1838.347] (-1841.474) (-1838.428) * [-1835.915] (-1835.546) (-1834.458) (-1834.892) -- 0:03:15
      174000 -- (-1837.084) (-1834.361) (-1834.897) [-1837.247] * (-1833.050) (-1834.319) [-1832.475] (-1836.825) -- 0:03:14
      174500 -- [-1835.543] (-1831.947) (-1834.390) (-1838.140) * [-1847.476] (-1838.153) (-1833.882) (-1835.384) -- 0:03:13
      175000 -- (-1836.330) [-1837.745] (-1833.786) (-1842.658) * (-1842.426) [-1836.060] (-1841.115) (-1841.919) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-1841.697) (-1841.632) [-1833.300] (-1839.521) * (-1839.450) (-1838.862) [-1832.734] (-1838.244) -- 0:03:12
      176000 -- (-1840.139) [-1834.931] (-1838.597) (-1845.494) * (-1836.117) [-1834.404] (-1837.936) (-1843.471) -- 0:03:11
      176500 -- (-1840.366) (-1837.215) [-1840.267] (-1836.734) * (-1835.833) (-1843.399) [-1833.121] (-1838.297) -- 0:03:11
      177000 -- (-1843.752) [-1835.498] (-1836.602) (-1838.998) * (-1834.663) (-1839.671) [-1833.873] (-1840.044) -- 0:03:10
      177500 -- (-1832.370) [-1836.025] (-1837.239) (-1834.154) * (-1834.912) [-1837.751] (-1834.255) (-1832.392) -- 0:03:14
      178000 -- (-1841.565) (-1835.839) (-1835.894) [-1838.364] * (-1836.427) (-1843.839) (-1835.493) [-1840.224] -- 0:03:13
      178500 -- (-1835.920) (-1839.884) (-1837.291) [-1838.274] * [-1837.528] (-1845.516) (-1837.971) (-1838.398) -- 0:03:13
      179000 -- (-1830.124) (-1837.785) (-1844.009) [-1843.449] * (-1835.353) (-1837.701) (-1844.259) [-1833.776] -- 0:03:12
      179500 -- (-1834.690) (-1838.842) [-1832.169] (-1839.695) * [-1833.804] (-1838.043) (-1834.419) (-1837.612) -- 0:03:11
      180000 -- [-1834.158] (-1835.947) (-1841.543) (-1839.661) * (-1836.684) [-1833.896] (-1836.506) (-1836.051) -- 0:03:11

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-1831.340) [-1841.688] (-1835.573) (-1838.284) * [-1833.097] (-1835.290) (-1840.119) (-1836.058) -- 0:03:10
      181000 -- (-1835.720) (-1839.380) [-1832.535] (-1844.263) * [-1840.266] (-1837.052) (-1830.595) (-1837.843) -- 0:03:10
      181500 -- (-1840.400) (-1846.426) (-1837.717) [-1837.850] * [-1836.067] (-1835.280) (-1835.478) (-1835.689) -- 0:03:13
      182000 -- (-1843.622) (-1840.985) [-1832.015] (-1834.497) * [-1837.453] (-1840.978) (-1843.719) (-1832.767) -- 0:03:13
      182500 -- [-1838.569] (-1845.784) (-1833.987) (-1832.026) * (-1847.629) (-1836.114) [-1830.894] (-1834.669) -- 0:03:12
      183000 -- (-1838.805) (-1843.128) (-1840.161) [-1834.574] * [-1834.489] (-1834.092) (-1834.940) (-1845.529) -- 0:03:11
      183500 -- (-1838.310) (-1842.465) [-1832.742] (-1834.301) * (-1839.914) [-1838.825] (-1846.504) (-1838.334) -- 0:03:11
      184000 -- (-1833.724) (-1842.464) [-1833.748] (-1833.390) * [-1835.129] (-1835.444) (-1839.958) (-1839.596) -- 0:03:10
      184500 -- [-1836.310] (-1835.627) (-1837.929) (-1833.714) * (-1839.167) (-1837.149) [-1843.733] (-1840.248) -- 0:03:10
      185000 -- (-1831.784) [-1833.992] (-1834.275) (-1851.675) * [-1839.365] (-1834.013) (-1837.820) (-1836.500) -- 0:03:09

      Average standard deviation of split frequencies: 0.000000

      185500 -- (-1837.661) (-1835.110) (-1834.826) [-1837.107] * (-1835.351) [-1844.218] (-1840.543) (-1836.909) -- 0:03:08
      186000 -- (-1835.501) (-1831.644) (-1836.050) [-1835.173] * (-1835.320) (-1839.208) (-1833.224) [-1834.448] -- 0:03:12
      186500 -- (-1834.610) [-1835.814] (-1840.983) (-1836.452) * (-1833.188) [-1834.974] (-1838.123) (-1841.727) -- 0:03:11
      187000 -- [-1833.633] (-1838.165) (-1834.781) (-1832.323) * (-1834.277) [-1832.165] (-1837.886) (-1837.306) -- 0:03:11
      187500 -- (-1832.838) (-1837.303) [-1833.935] (-1840.563) * [-1833.997] (-1831.094) (-1836.851) (-1838.013) -- 0:03:10
      188000 -- [-1833.818] (-1833.776) (-1835.648) (-1841.256) * (-1836.481) (-1836.726) [-1838.250] (-1840.337) -- 0:03:10
      188500 -- (-1836.493) [-1830.194] (-1834.067) (-1833.207) * [-1840.699] (-1841.699) (-1839.188) (-1839.719) -- 0:03:09
      189000 -- (-1837.332) [-1838.104] (-1837.141) (-1833.202) * (-1835.753) (-1842.589) [-1838.879] (-1831.315) -- 0:03:08
      189500 -- (-1837.564) (-1835.473) [-1831.309] (-1837.845) * [-1835.791] (-1853.749) (-1839.530) (-1832.364) -- 0:03:08
      190000 -- (-1849.956) (-1843.228) [-1834.177] (-1832.956) * (-1840.518) (-1844.048) [-1836.912] (-1839.981) -- 0:03:07

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-1835.764) [-1835.585] (-1834.090) (-1843.686) * (-1833.319) (-1845.491) [-1838.808] (-1831.059) -- 0:03:11
      191000 -- (-1842.360) [-1836.047] (-1832.511) (-1838.956) * [-1836.379] (-1848.517) (-1844.855) (-1841.676) -- 0:03:10
      191500 -- (-1836.219) (-1841.650) (-1839.911) [-1837.304] * (-1835.596) (-1838.916) [-1834.180] (-1839.424) -- 0:03:09
      192000 -- (-1838.141) (-1836.549) (-1835.150) [-1837.100] * (-1836.517) (-1836.727) (-1838.137) [-1838.270] -- 0:03:09
      192500 -- (-1841.466) (-1837.713) (-1838.580) [-1839.381] * (-1836.670) [-1832.911] (-1838.659) (-1835.150) -- 0:03:08
      193000 -- (-1830.082) (-1836.469) (-1834.428) [-1835.292] * (-1837.597) (-1841.865) (-1835.722) [-1830.976] -- 0:03:08
      193500 -- (-1837.032) [-1835.693] (-1833.209) (-1836.270) * (-1835.070) (-1836.184) [-1832.611] (-1837.033) -- 0:03:07
      194000 -- [-1832.860] (-1835.128) (-1843.300) (-1830.827) * (-1833.245) [-1833.671] (-1834.888) (-1841.646) -- 0:03:06
      194500 -- (-1834.812) [-1833.157] (-1838.470) (-1833.195) * (-1837.532) [-1833.323] (-1834.499) (-1838.090) -- 0:03:10
      195000 -- [-1831.566] (-1840.989) (-1840.395) (-1835.338) * (-1839.022) (-1837.259) (-1835.975) [-1834.734] -- 0:03:09

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-1832.138) (-1836.400) [-1840.254] (-1833.585) * (-1836.387) (-1837.695) (-1833.698) [-1840.892] -- 0:03:09
      196000 -- [-1835.778] (-1836.705) (-1837.773) (-1830.194) * (-1840.493) (-1835.657) (-1839.312) [-1840.470] -- 0:03:08
      196500 -- (-1833.781) (-1841.190) [-1835.355] (-1839.581) * (-1836.260) (-1838.732) (-1842.392) [-1837.825] -- 0:03:08
      197000 -- [-1836.129] (-1831.997) (-1844.629) (-1833.871) * (-1837.224) [-1834.883] (-1832.975) (-1844.419) -- 0:03:07
      197500 -- (-1839.844) [-1839.854] (-1838.038) (-1837.045) * [-1841.456] (-1839.151) (-1837.528) (-1836.138) -- 0:03:06
      198000 -- (-1833.037) [-1838.627] (-1843.047) (-1836.056) * (-1841.147) [-1831.975] (-1841.669) (-1838.620) -- 0:03:06
      198500 -- (-1839.745) (-1848.118) (-1836.799) [-1832.816] * (-1842.206) (-1832.658) (-1837.234) [-1834.116] -- 0:03:05
      199000 -- (-1832.617) (-1837.112) (-1832.954) [-1834.944] * (-1837.673) [-1837.132] (-1844.326) (-1833.943) -- 0:03:09
      199500 -- (-1836.391) (-1839.833) [-1833.566] (-1834.857) * (-1840.218) (-1840.310) [-1844.760] (-1836.417) -- 0:03:08
      200000 -- [-1834.132] (-1839.481) (-1835.787) (-1836.047) * (-1839.677) (-1837.008) (-1836.986) [-1834.981] -- 0:03:08

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-1833.859) (-1838.581) [-1834.225] (-1832.343) * (-1837.073) [-1832.363] (-1839.766) (-1841.833) -- 0:03:07
      201000 -- (-1835.869) (-1834.781) [-1835.972] (-1836.746) * (-1839.606) (-1835.246) (-1836.224) [-1839.097] -- 0:03:06
      201500 -- [-1833.240] (-1836.335) (-1843.219) (-1835.470) * (-1838.552) [-1835.795] (-1835.591) (-1840.340) -- 0:03:06
      202000 -- (-1840.710) (-1837.043) (-1833.086) [-1835.320] * [-1836.703] (-1837.201) (-1835.603) (-1840.556) -- 0:03:05
      202500 -- (-1835.844) (-1834.727) [-1832.170] (-1839.431) * (-1834.402) (-1834.150) (-1837.311) [-1837.033] -- 0:03:05
      203000 -- (-1844.987) (-1835.476) (-1837.706) [-1835.861] * [-1836.061] (-1839.500) (-1833.938) (-1838.632) -- 0:03:08
      203500 -- (-1843.687) [-1836.545] (-1835.041) (-1845.864) * (-1834.982) (-1833.854) (-1838.115) [-1836.743] -- 0:03:07
      204000 -- [-1840.223] (-1839.879) (-1840.629) (-1833.108) * [-1835.250] (-1836.758) (-1842.215) (-1842.667) -- 0:03:07
      204500 -- (-1833.518) (-1833.073) [-1837.372] (-1833.026) * (-1833.769) (-1836.117) (-1836.942) [-1833.443] -- 0:03:06
      205000 -- (-1835.388) (-1832.864) (-1837.962) [-1836.522] * (-1830.167) (-1839.169) (-1838.190) [-1838.569] -- 0:03:06

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-1836.771) (-1842.726) (-1846.765) [-1833.788] * [-1836.319] (-1842.739) (-1840.550) (-1839.782) -- 0:03:05
      206000 -- (-1834.603) [-1839.269] (-1834.617) (-1834.761) * [-1834.238] (-1838.067) (-1833.631) (-1834.355) -- 0:03:05
      206500 -- (-1845.442) [-1833.705] (-1835.086) (-1833.151) * [-1842.741] (-1833.320) (-1841.939) (-1841.341) -- 0:03:04
      207000 -- (-1836.024) (-1834.665) (-1834.258) [-1833.071] * (-1835.609) [-1834.692] (-1834.414) (-1834.932) -- 0:03:03
      207500 -- (-1841.070) (-1830.927) [-1837.832] (-1832.505) * (-1838.553) (-1838.241) [-1837.392] (-1836.896) -- 0:03:07
      208000 -- (-1835.735) [-1833.804] (-1835.316) (-1831.626) * (-1842.079) [-1837.794] (-1835.134) (-1835.605) -- 0:03:06
      208500 -- (-1836.261) (-1837.425) [-1837.912] (-1835.395) * (-1834.392) (-1834.342) [-1839.094] (-1836.920) -- 0:03:06
      209000 -- (-1837.186) (-1837.030) (-1834.697) [-1835.015] * (-1845.276) [-1834.486] (-1833.674) (-1836.439) -- 0:03:05
      209500 -- (-1840.807) (-1832.330) (-1832.397) [-1841.244] * [-1835.010] (-1838.530) (-1835.742) (-1838.722) -- 0:03:04
      210000 -- (-1834.073) (-1839.697) (-1833.709) [-1835.738] * (-1837.599) [-1833.806] (-1839.435) (-1836.578) -- 0:03:04

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-1841.607) [-1838.926] (-1838.439) (-1835.070) * (-1837.599) (-1835.701) [-1843.627] (-1833.820) -- 0:03:03
      211000 -- [-1834.690] (-1835.883) (-1834.073) (-1843.342) * [-1840.069] (-1835.558) (-1845.529) (-1835.655) -- 0:03:03
      211500 -- (-1831.691) [-1841.078] (-1835.297) (-1842.616) * (-1836.220) (-1834.828) (-1841.413) [-1832.850] -- 0:03:02
      212000 -- [-1840.127] (-1833.024) (-1834.634) (-1839.047) * (-1839.943) [-1836.991] (-1835.058) (-1839.472) -- 0:03:05
      212500 -- [-1831.330] (-1837.637) (-1834.794) (-1841.587) * (-1831.353) [-1834.844] (-1835.589) (-1845.689) -- 0:03:05
      213000 -- [-1833.174] (-1843.900) (-1838.365) (-1833.226) * [-1838.400] (-1840.345) (-1837.694) (-1843.296) -- 0:03:04
      213500 -- (-1838.568) (-1837.158) [-1832.694] (-1845.983) * [-1835.395] (-1843.833) (-1834.743) (-1831.964) -- 0:03:04
      214000 -- (-1838.322) (-1843.405) (-1832.967) [-1834.122] * [-1834.808] (-1856.259) (-1838.312) (-1834.548) -- 0:03:03
      214500 -- (-1845.315) (-1836.606) (-1835.391) [-1834.803] * (-1832.401) (-1843.506) [-1833.349] (-1839.230) -- 0:03:03
      215000 -- (-1836.932) (-1833.477) [-1845.803] (-1832.291) * (-1833.602) (-1834.801) (-1834.876) [-1837.528] -- 0:03:02

      Average standard deviation of split frequencies: 0.000000

      215500 -- [-1838.994] (-1848.259) (-1834.999) (-1833.341) * (-1836.622) (-1832.520) [-1834.003] (-1839.535) -- 0:03:02
      216000 -- (-1834.946) (-1835.569) [-1834.422] (-1837.323) * (-1840.243) (-1841.140) (-1835.691) [-1829.811] -- 0:03:05
      216500 -- (-1835.741) (-1834.299) (-1834.337) [-1835.399] * (-1838.521) [-1834.298] (-1840.041) (-1836.715) -- 0:03:04
      217000 -- (-1842.378) [-1840.326] (-1838.212) (-1848.411) * [-1835.123] (-1832.435) (-1834.589) (-1835.022) -- 0:03:04
      217500 -- (-1835.147) (-1836.072) [-1841.959] (-1846.051) * (-1833.838) (-1836.947) (-1831.378) [-1839.729] -- 0:03:03
      218000 -- [-1835.345] (-1840.557) (-1843.655) (-1836.385) * (-1838.810) (-1838.710) [-1835.064] (-1838.468) -- 0:03:02
      218500 -- (-1838.629) (-1839.228) (-1845.807) [-1831.341] * [-1836.455] (-1833.428) (-1836.414) (-1840.325) -- 0:03:02
      219000 -- (-1838.745) (-1835.070) [-1838.484] (-1834.981) * [-1834.604] (-1831.731) (-1836.058) (-1832.183) -- 0:03:01
      219500 -- (-1835.539) (-1833.223) [-1837.029] (-1838.025) * [-1831.513] (-1834.318) (-1852.709) (-1832.603) -- 0:03:01
      220000 -- (-1837.036) (-1835.122) [-1834.913] (-1842.632) * (-1839.640) (-1845.446) [-1833.480] (-1836.796) -- 0:03:00

      Average standard deviation of split frequencies: 0.000000

      220500 -- [-1830.147] (-1836.500) (-1836.694) (-1845.458) * (-1832.793) (-1849.500) (-1839.135) [-1837.919] -- 0:03:03
      221000 -- (-1835.888) [-1834.047] (-1837.789) (-1840.944) * (-1842.981) (-1845.458) (-1834.304) [-1835.728] -- 0:03:03
      221500 -- (-1841.173) [-1838.434] (-1842.315) (-1843.968) * [-1835.662] (-1837.876) (-1836.198) (-1840.832) -- 0:03:02
      222000 -- [-1835.554] (-1840.820) (-1837.937) (-1837.241) * [-1836.647] (-1833.626) (-1839.199) (-1837.097) -- 0:03:02
      222500 -- (-1836.470) [-1834.495] (-1832.805) (-1839.848) * (-1833.890) [-1837.653] (-1837.932) (-1834.131) -- 0:03:01
      223000 -- (-1835.015) (-1836.923) (-1831.068) [-1840.431] * (-1833.326) [-1837.034] (-1836.359) (-1833.530) -- 0:03:01
      223500 -- [-1833.132] (-1846.198) (-1841.031) (-1838.455) * [-1830.033] (-1836.680) (-1837.576) (-1837.844) -- 0:03:00
      224000 -- (-1836.849) [-1837.105] (-1836.058) (-1834.707) * (-1835.803) (-1835.878) (-1834.699) [-1841.001] -- 0:03:00
      224500 -- (-1834.804) (-1836.914) [-1832.969] (-1834.844) * (-1833.593) (-1842.629) (-1835.245) [-1832.344] -- 0:02:59
      225000 -- (-1834.425) (-1832.394) [-1835.703] (-1838.191) * (-1834.547) [-1834.948] (-1837.148) (-1837.027) -- 0:03:02

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-1832.648) (-1833.478) (-1841.306) [-1833.211] * [-1839.114] (-1838.469) (-1837.032) (-1836.335) -- 0:03:02
      226000 -- (-1834.021) (-1832.060) (-1841.589) [-1834.337] * (-1837.971) (-1833.936) (-1837.783) [-1836.091] -- 0:03:01
      226500 -- (-1834.424) (-1838.924) [-1837.273] (-1835.218) * [-1833.457] (-1835.112) (-1837.835) (-1832.702) -- 0:03:00
      227000 -- (-1838.404) [-1833.325] (-1835.105) (-1834.983) * [-1840.010] (-1831.819) (-1829.614) (-1836.286) -- 0:03:00
      227500 -- [-1831.052] (-1834.281) (-1831.502) (-1841.708) * (-1837.285) (-1841.486) (-1833.750) [-1843.942] -- 0:02:59
      228000 -- (-1843.534) (-1842.229) [-1836.652] (-1834.712) * (-1837.474) (-1833.409) (-1835.354) [-1835.652] -- 0:02:59
      228500 -- (-1834.998) (-1841.518) (-1833.811) [-1835.179] * (-1834.682) (-1832.607) [-1836.219] (-1831.277) -- 0:02:58
      229000 -- [-1833.581] (-1845.630) (-1843.260) (-1830.874) * (-1834.561) (-1830.911) [-1847.180] (-1837.861) -- 0:03:01
      229500 -- (-1834.427) (-1842.650) (-1840.071) [-1836.684] * (-1837.824) (-1836.246) (-1837.242) [-1837.105] -- 0:03:01
      230000 -- (-1834.926) (-1838.031) (-1837.568) [-1832.550] * (-1845.744) [-1829.574] (-1840.141) (-1832.755) -- 0:03:00

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-1832.821) (-1834.545) (-1835.784) [-1835.127] * (-1851.823) [-1834.888] (-1833.161) (-1830.900) -- 0:03:00
      231000 -- (-1834.534) (-1830.951) (-1836.248) [-1831.356] * (-1838.304) (-1833.554) [-1835.263] (-1840.884) -- 0:02:59
      231500 -- (-1840.914) [-1834.602] (-1841.994) (-1832.894) * (-1834.897) (-1834.290) [-1838.727] (-1836.564) -- 0:02:59
      232000 -- (-1838.663) (-1829.094) [-1835.803] (-1843.434) * (-1845.587) [-1834.857] (-1840.503) (-1838.800) -- 0:02:58
      232500 -- (-1835.143) (-1835.147) [-1836.262] (-1835.047) * (-1836.833) (-1832.919) (-1831.265) [-1841.408] -- 0:02:58
      233000 -- [-1832.496] (-1837.290) (-1835.119) (-1848.885) * (-1836.056) (-1834.760) [-1830.954] (-1836.740) -- 0:02:57
      233500 -- (-1835.924) [-1833.975] (-1831.830) (-1832.676) * (-1842.755) (-1836.941) (-1836.297) [-1832.894] -- 0:03:00
      234000 -- (-1841.228) (-1833.144) (-1830.209) [-1837.117] * [-1834.656] (-1836.361) (-1834.487) (-1836.553) -- 0:03:00
      234500 -- (-1837.270) (-1836.061) [-1834.551] (-1836.740) * [-1839.637] (-1835.102) (-1833.672) (-1843.767) -- 0:02:59
      235000 -- (-1832.541) (-1834.912) (-1833.198) [-1832.592] * (-1838.435) [-1833.164] (-1838.774) (-1834.133) -- 0:02:59

      Average standard deviation of split frequencies: 0.000000

      235500 -- [-1839.448] (-1837.448) (-1832.667) (-1840.994) * (-1832.829) [-1832.397] (-1853.521) (-1834.777) -- 0:02:58
      236000 -- (-1836.111) (-1832.449) (-1838.159) [-1831.267] * (-1830.083) [-1838.823] (-1837.314) (-1839.350) -- 0:02:58
      236500 -- (-1834.775) (-1830.912) [-1832.904] (-1834.770) * (-1835.871) [-1835.117] (-1839.527) (-1833.597) -- 0:02:57
      237000 -- (-1835.238) [-1835.855] (-1833.777) (-1839.824) * (-1837.601) (-1840.532) [-1830.724] (-1835.475) -- 0:02:57
      237500 -- (-1836.824) [-1831.742] (-1832.361) (-1840.656) * (-1839.900) (-1841.286) (-1832.716) [-1836.686] -- 0:02:56
      238000 -- (-1833.381) (-1829.954) [-1829.884] (-1841.131) * (-1836.208) (-1836.546) [-1832.244] (-1839.376) -- 0:02:59
      238500 -- (-1838.598) (-1835.857) [-1838.883] (-1841.990) * (-1834.938) (-1840.647) (-1834.632) [-1837.677] -- 0:02:58
      239000 -- (-1836.320) [-1832.878] (-1836.005) (-1835.911) * (-1837.875) [-1835.406] (-1835.414) (-1841.487) -- 0:02:58
      239500 -- [-1834.561] (-1834.140) (-1835.945) (-1836.424) * (-1839.923) [-1838.105] (-1836.262) (-1841.786) -- 0:02:57
      240000 -- (-1836.330) (-1833.276) (-1831.682) [-1837.828] * (-1836.438) (-1832.793) (-1831.215) [-1836.107] -- 0:02:57

      Average standard deviation of split frequencies: 0.000000

      240500 -- (-1840.750) (-1834.652) (-1836.590) [-1837.114] * (-1839.434) (-1836.601) (-1835.740) [-1836.080] -- 0:02:56
      241000 -- (-1840.830) (-1836.289) (-1835.508) [-1834.164] * (-1838.789) [-1835.631] (-1839.949) (-1837.427) -- 0:02:56
      241500 -- (-1837.706) (-1831.437) (-1835.994) [-1838.516] * (-1838.577) [-1838.510] (-1835.715) (-1844.751) -- 0:02:55
      242000 -- [-1835.305] (-1835.527) (-1832.117) (-1842.716) * (-1834.665) (-1839.931) (-1833.945) [-1832.967] -- 0:02:58
      242500 -- (-1836.890) (-1837.021) [-1835.950] (-1832.387) * (-1845.542) [-1832.519] (-1832.697) (-1839.522) -- 0:02:58
      243000 -- (-1841.730) (-1841.501) [-1836.748] (-1833.147) * (-1837.088) (-1834.480) [-1836.458] (-1837.911) -- 0:02:57
      243500 -- [-1837.695] (-1849.059) (-1832.667) (-1838.487) * (-1833.991) [-1832.848] (-1836.432) (-1838.312) -- 0:02:57
      244000 -- [-1840.438] (-1839.794) (-1834.242) (-1840.783) * (-1837.692) [-1832.243] (-1836.803) (-1837.756) -- 0:02:56
      244500 -- [-1833.251] (-1837.892) (-1831.754) (-1841.487) * (-1834.478) (-1835.646) (-1845.105) [-1836.957] -- 0:02:56
      245000 -- [-1838.363] (-1839.094) (-1834.455) (-1842.187) * (-1837.147) (-1837.116) [-1836.631] (-1831.663) -- 0:02:55

      Average standard deviation of split frequencies: 0.000000

      245500 -- (-1837.042) (-1836.294) (-1830.957) [-1836.305] * [-1834.580] (-1832.699) (-1840.297) (-1835.678) -- 0:02:55
      246000 -- (-1833.269) [-1837.020] (-1835.705) (-1833.492) * (-1837.246) (-1835.951) [-1840.032] (-1831.897) -- 0:02:54
      246500 -- (-1833.243) [-1832.443] (-1832.895) (-1838.475) * (-1838.802) [-1834.203] (-1837.907) (-1834.446) -- 0:02:57
      247000 -- (-1831.102) (-1836.418) [-1835.008] (-1835.701) * (-1842.171) (-1839.968) (-1835.034) [-1831.836] -- 0:02:56
      247500 -- (-1844.493) (-1839.025) [-1835.915] (-1833.496) * (-1841.285) [-1834.610] (-1835.255) (-1839.733) -- 0:02:56
      248000 -- (-1837.761) (-1841.236) [-1832.863] (-1835.041) * [-1835.139] (-1832.115) (-1839.268) (-1839.465) -- 0:02:55
      248500 -- (-1840.054) (-1834.214) (-1829.191) [-1835.547] * (-1832.123) [-1834.666] (-1830.745) (-1838.241) -- 0:02:55
      249000 -- (-1836.972) [-1831.087] (-1831.410) (-1840.742) * (-1831.591) (-1836.793) (-1833.289) [-1834.442] -- 0:02:54
      249500 -- (-1843.341) [-1835.514] (-1838.299) (-1847.514) * [-1836.002] (-1838.656) (-1836.583) (-1843.973) -- 0:02:54
      250000 -- [-1837.230] (-1832.037) (-1834.239) (-1840.148) * (-1836.606) [-1833.598] (-1838.374) (-1833.263) -- 0:02:54

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-1834.577) (-1846.383) [-1838.365] (-1840.488) * (-1833.448) (-1839.919) (-1841.273) [-1837.532] -- 0:02:56
      251000 -- [-1835.949] (-1840.821) (-1831.140) (-1836.186) * (-1833.587) (-1841.327) [-1833.662] (-1842.936) -- 0:02:56
      251500 -- (-1836.959) (-1835.418) [-1829.811] (-1837.578) * [-1835.321] (-1841.747) (-1834.300) (-1836.737) -- 0:02:55
      252000 -- (-1839.950) [-1835.564] (-1841.441) (-1835.814) * (-1836.938) (-1840.055) [-1835.789] (-1848.808) -- 0:02:55
      252500 -- [-1833.170] (-1835.240) (-1840.188) (-1833.480) * (-1840.293) (-1836.542) [-1836.831] (-1849.835) -- 0:02:54
      253000 -- (-1836.098) [-1840.577] (-1838.626) (-1834.401) * (-1835.704) [-1836.735] (-1836.375) (-1845.829) -- 0:02:54
      253500 -- (-1837.796) (-1835.618) (-1833.651) [-1831.272] * (-1832.494) [-1837.093] (-1844.082) (-1839.837) -- 0:02:53
      254000 -- [-1841.854] (-1835.253) (-1836.235) (-1838.278) * (-1834.650) (-1841.403) [-1833.506] (-1834.676) -- 0:02:53
      254500 -- [-1838.610] (-1835.978) (-1833.505) (-1837.020) * (-1836.340) [-1836.724] (-1838.314) (-1836.678) -- 0:02:52
      255000 -- [-1837.687] (-1843.315) (-1836.472) (-1835.502) * [-1836.813] (-1838.310) (-1841.441) (-1838.303) -- 0:02:55

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-1836.618) (-1834.367) (-1832.991) [-1833.162] * (-1839.828) (-1839.313) (-1846.910) [-1831.532] -- 0:02:54
      256000 -- (-1835.834) (-1837.548) [-1834.657] (-1836.433) * (-1833.647) [-1833.817] (-1834.829) (-1841.984) -- 0:02:54
      256500 -- (-1839.847) (-1835.056) (-1834.299) [-1834.065] * (-1837.669) (-1839.802) (-1836.279) [-1831.691] -- 0:02:53
      257000 -- (-1834.856) (-1836.334) [-1840.612] (-1835.351) * (-1832.963) [-1831.228] (-1838.119) (-1834.366) -- 0:02:53
      257500 -- (-1839.375) (-1834.085) [-1838.606] (-1840.360) * (-1833.782) [-1831.245] (-1844.242) (-1835.617) -- 0:02:53
      258000 -- (-1840.449) [-1838.262] (-1836.876) (-1836.872) * (-1835.187) (-1832.900) [-1836.922] (-1835.311) -- 0:02:52
      258500 -- (-1841.487) (-1835.313) [-1838.001] (-1832.682) * (-1839.550) [-1837.932] (-1835.976) (-1840.045) -- 0:02:52
      259000 -- (-1837.509) [-1842.228] (-1834.985) (-1837.577) * [-1835.990] (-1838.725) (-1833.184) (-1836.991) -- 0:02:51
      259500 -- (-1834.010) [-1834.882] (-1834.575) (-1837.029) * (-1835.054) [-1834.658] (-1835.381) (-1834.363) -- 0:02:54
      260000 -- (-1838.565) (-1833.409) (-1835.752) [-1847.348] * (-1840.109) [-1831.223] (-1835.850) (-1834.519) -- 0:02:53

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-1838.025) (-1837.834) [-1837.506] (-1838.147) * (-1838.907) (-1838.961) [-1835.185] (-1835.330) -- 0:02:53
      261000 -- (-1838.008) (-1838.670) (-1834.952) [-1840.475] * (-1837.398) (-1832.090) [-1835.631] (-1839.924) -- 0:02:52
      261500 -- [-1828.452] (-1836.498) (-1836.891) (-1840.933) * [-1834.555] (-1833.328) (-1832.326) (-1833.769) -- 0:02:52
      262000 -- [-1833.757] (-1837.239) (-1833.892) (-1837.193) * (-1831.381) (-1837.713) (-1831.755) [-1838.031] -- 0:02:51
      262500 -- [-1835.635] (-1844.353) (-1837.360) (-1835.034) * (-1835.915) (-1834.945) (-1837.245) [-1833.349] -- 0:02:51
      263000 -- (-1834.447) [-1836.466] (-1849.021) (-1839.697) * (-1833.767) (-1836.902) (-1837.640) [-1834.461] -- 0:02:50
      263500 -- (-1838.793) [-1834.458] (-1830.649) (-1841.707) * (-1837.333) (-1833.923) (-1838.720) [-1839.833] -- 0:02:53
      264000 -- (-1841.393) [-1832.473] (-1836.401) (-1839.537) * (-1835.188) [-1833.331] (-1836.738) (-1839.026) -- 0:02:52
      264500 -- (-1840.381) [-1833.223] (-1836.510) (-1843.906) * (-1839.219) (-1833.817) [-1837.930] (-1835.650) -- 0:02:52
      265000 -- (-1833.234) (-1837.949) [-1833.478] (-1844.790) * [-1838.276] (-1833.891) (-1833.846) (-1838.282) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-1832.383) [-1834.718] (-1837.657) (-1848.197) * (-1834.201) (-1839.588) (-1835.887) [-1833.699] -- 0:02:51
      266000 -- (-1838.636) (-1833.350) [-1833.668] (-1833.084) * (-1837.424) (-1836.376) (-1836.384) [-1833.465] -- 0:02:51
      266500 -- (-1834.269) (-1834.871) [-1833.304] (-1835.185) * (-1840.645) (-1833.084) (-1834.224) [-1835.143] -- 0:02:50
      267000 -- (-1835.120) (-1838.166) (-1835.584) [-1834.153] * (-1833.825) (-1836.656) (-1830.519) [-1831.758] -- 0:02:50
      267500 -- (-1836.134) (-1835.711) (-1836.463) [-1831.775] * (-1840.988) (-1845.341) [-1831.903] (-1838.248) -- 0:02:49
      268000 -- [-1832.810] (-1836.220) (-1834.668) (-1832.350) * (-1832.195) [-1835.989] (-1833.813) (-1838.051) -- 0:02:52
      268500 -- (-1831.988) (-1836.910) [-1833.894] (-1839.339) * (-1831.554) (-1835.609) (-1838.032) [-1832.861] -- 0:02:51
      269000 -- [-1837.742] (-1836.697) (-1839.184) (-1841.182) * [-1835.466] (-1832.587) (-1836.542) (-1832.428) -- 0:02:51
      269500 -- (-1841.011) [-1839.300] (-1840.901) (-1837.883) * [-1841.097] (-1832.288) (-1836.480) (-1836.790) -- 0:02:50
      270000 -- [-1834.103] (-1842.418) (-1837.835) (-1839.057) * (-1840.749) (-1835.923) [-1836.525] (-1837.144) -- 0:02:50

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-1834.442) (-1839.682) (-1837.810) [-1834.016] * (-1838.763) [-1831.581] (-1842.590) (-1840.724) -- 0:02:49
      271000 -- (-1838.871) (-1839.605) [-1832.250] (-1837.679) * (-1835.905) [-1831.238] (-1851.781) (-1836.340) -- 0:02:49
      271500 -- (-1831.179) (-1841.561) [-1835.505] (-1842.354) * (-1843.001) [-1831.044] (-1839.207) (-1835.276) -- 0:02:49
      272000 -- (-1843.641) (-1841.251) [-1830.044] (-1837.954) * (-1836.982) [-1832.493] (-1846.161) (-1836.366) -- 0:02:51
      272500 -- [-1835.965] (-1834.061) (-1832.947) (-1834.031) * (-1835.279) [-1834.804] (-1836.059) (-1838.309) -- 0:02:50
      273000 -- (-1836.566) (-1836.913) [-1837.219] (-1836.605) * (-1835.974) (-1832.018) [-1832.627] (-1846.254) -- 0:02:50
      273500 -- (-1842.318) [-1834.087] (-1835.233) (-1833.402) * [-1837.354] (-1833.838) (-1838.635) (-1837.928) -- 0:02:50
      274000 -- [-1835.405] (-1842.263) (-1841.001) (-1836.334) * [-1837.307] (-1834.981) (-1839.744) (-1837.718) -- 0:02:49
      274500 -- (-1838.049) (-1836.873) (-1832.030) [-1829.680] * (-1837.844) (-1832.471) (-1835.589) [-1835.299] -- 0:02:49
      275000 -- (-1832.785) (-1833.702) (-1835.846) [-1832.204] * (-1833.858) [-1831.647] (-1837.053) (-1841.060) -- 0:02:48

      Average standard deviation of split frequencies: 0.000000

      275500 -- (-1842.144) [-1840.028] (-1833.233) (-1832.141) * [-1834.113] (-1832.857) (-1837.146) (-1834.190) -- 0:02:48
      276000 -- (-1836.559) (-1850.523) (-1838.724) [-1832.306] * (-1835.903) (-1831.327) [-1834.845] (-1834.538) -- 0:02:47
      276500 -- (-1833.723) (-1838.804) [-1834.383] (-1840.032) * (-1838.924) (-1833.484) (-1832.433) [-1836.945] -- 0:02:50
      277000 -- [-1834.757] (-1838.506) (-1835.855) (-1832.416) * [-1844.639] (-1837.037) (-1835.694) (-1836.317) -- 0:02:49
      277500 -- [-1829.924] (-1834.908) (-1838.827) (-1838.601) * (-1836.707) (-1835.807) (-1835.281) [-1830.848] -- 0:02:49
      278000 -- (-1838.103) [-1841.069] (-1837.934) (-1838.145) * [-1841.275] (-1838.444) (-1836.167) (-1836.879) -- 0:02:48
      278500 -- [-1837.147] (-1836.232) (-1838.274) (-1843.463) * [-1835.686] (-1845.129) (-1836.947) (-1840.926) -- 0:02:48
      279000 -- (-1832.956) (-1841.144) [-1835.737] (-1841.076) * (-1835.032) (-1844.832) (-1839.291) [-1832.589] -- 0:02:47
      279500 -- (-1832.096) [-1836.210] (-1836.961) (-1835.323) * (-1841.707) [-1838.526] (-1839.232) (-1834.533) -- 0:02:47
      280000 -- (-1842.023) (-1831.351) (-1837.851) [-1834.842] * (-1841.879) (-1837.300) (-1836.127) [-1833.151] -- 0:02:47

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-1835.322) (-1838.119) [-1835.573] (-1839.408) * [-1835.402] (-1843.208) (-1844.954) (-1830.209) -- 0:02:49
      281000 -- (-1831.332) (-1831.467) [-1833.279] (-1839.604) * (-1836.044) (-1834.344) [-1836.911] (-1836.915) -- 0:02:48
      281500 -- (-1838.551) (-1833.313) (-1838.066) [-1836.385] * (-1830.113) [-1836.500] (-1841.262) (-1839.264) -- 0:02:48
      282000 -- [-1835.966] (-1847.189) (-1836.196) (-1836.891) * (-1835.810) [-1831.349] (-1836.819) (-1831.522) -- 0:02:48
      282500 -- (-1840.599) (-1841.023) (-1840.453) [-1830.455] * (-1837.868) (-1839.892) (-1833.890) [-1831.796] -- 0:02:47
      283000 -- (-1843.498) (-1836.857) [-1835.843] (-1835.289) * [-1835.468] (-1850.020) (-1838.766) (-1830.338) -- 0:02:47
      283500 -- (-1834.681) (-1834.441) [-1834.630] (-1832.294) * (-1834.968) (-1845.797) (-1843.380) [-1832.844] -- 0:02:46
      284000 -- (-1839.280) [-1836.225] (-1836.453) (-1837.880) * [-1832.914] (-1840.632) (-1842.691) (-1841.890) -- 0:02:46
      284500 -- (-1844.851) (-1837.259) [-1833.748] (-1834.505) * (-1843.488) (-1845.376) (-1840.096) [-1836.937] -- 0:02:45
      285000 -- (-1836.115) [-1832.252] (-1845.534) (-1835.019) * (-1836.644) [-1835.155] (-1838.455) (-1831.291) -- 0:02:48

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-1848.291) (-1835.654) [-1834.801] (-1831.361) * (-1834.146) (-1834.656) (-1839.911) [-1830.010] -- 0:02:47
      286000 -- (-1839.583) (-1839.043) (-1837.697) [-1833.441] * (-1832.847) (-1838.181) (-1835.132) [-1840.093] -- 0:02:47
      286500 -- (-1842.454) (-1836.578) (-1831.282) [-1837.740] * [-1833.211] (-1840.537) (-1834.136) (-1835.538) -- 0:02:46
      287000 -- (-1842.970) [-1833.312] (-1840.304) (-1834.635) * (-1832.851) (-1836.210) (-1837.028) [-1836.819] -- 0:02:46
      287500 -- (-1835.330) (-1838.379) [-1843.511] (-1834.104) * [-1834.836] (-1835.816) (-1833.356) (-1835.566) -- 0:02:46
      288000 -- [-1840.076] (-1838.812) (-1840.358) (-1843.669) * [-1831.243] (-1831.483) (-1834.489) (-1834.103) -- 0:02:45
      288500 -- (-1842.300) [-1834.643] (-1836.589) (-1842.981) * (-1841.680) [-1832.537] (-1833.584) (-1845.844) -- 0:02:45
      289000 -- [-1838.272] (-1834.292) (-1836.362) (-1839.784) * [-1833.874] (-1840.000) (-1835.374) (-1837.891) -- 0:02:44
      289500 -- (-1841.323) [-1838.948] (-1834.415) (-1846.156) * (-1838.980) (-1836.634) [-1839.694] (-1835.341) -- 0:02:46
      290000 -- (-1839.710) [-1834.120] (-1832.031) (-1843.505) * (-1829.801) (-1844.460) (-1838.434) [-1837.510] -- 0:02:46

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-1839.176) [-1829.550] (-1842.425) (-1842.735) * (-1837.469) (-1843.070) (-1840.481) [-1836.310] -- 0:02:46
      291000 -- (-1837.725) (-1835.275) [-1838.492] (-1840.535) * (-1842.533) [-1833.090] (-1834.984) (-1839.829) -- 0:02:45
      291500 -- (-1840.145) (-1835.829) (-1835.736) [-1832.437] * (-1838.024) [-1841.648] (-1836.436) (-1830.060) -- 0:02:45
      292000 -- (-1834.491) (-1830.993) (-1837.574) [-1834.350] * (-1831.116) (-1836.911) (-1837.177) [-1836.835] -- 0:02:44
      292500 -- (-1834.204) [-1835.600] (-1834.693) (-1839.684) * [-1835.021] (-1837.213) (-1834.547) (-1844.248) -- 0:02:44
      293000 -- [-1837.553] (-1839.529) (-1833.009) (-1839.142) * [-1834.334] (-1837.162) (-1835.886) (-1831.723) -- 0:02:44
      293500 -- [-1836.477] (-1838.929) (-1836.772) (-1838.450) * [-1834.709] (-1838.820) (-1840.188) (-1834.547) -- 0:02:46
      294000 -- (-1838.065) [-1831.912] (-1841.997) (-1835.448) * [-1838.114] (-1838.058) (-1841.689) (-1836.028) -- 0:02:45
      294500 -- [-1838.966] (-1835.934) (-1843.846) (-1834.943) * (-1833.627) [-1835.813] (-1842.446) (-1835.013) -- 0:02:45
      295000 -- (-1842.092) (-1839.204) (-1840.255) [-1835.665] * [-1841.001] (-1840.039) (-1840.896) (-1836.054) -- 0:02:44

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-1836.495) (-1851.209) (-1838.394) [-1834.134] * (-1835.095) (-1840.285) (-1838.872) [-1833.822] -- 0:02:44
      296000 -- (-1837.919) (-1842.217) [-1834.501] (-1832.544) * (-1832.686) (-1839.109) [-1839.385] (-1834.810) -- 0:02:44
      296500 -- (-1839.104) (-1838.481) [-1835.424] (-1843.870) * (-1838.334) (-1835.690) (-1847.292) [-1837.686] -- 0:02:43
      297000 -- [-1838.590] (-1842.954) (-1836.710) (-1833.621) * [-1829.189] (-1835.003) (-1843.543) (-1833.376) -- 0:02:43
      297500 -- (-1841.185) [-1833.130] (-1837.115) (-1834.942) * [-1832.719] (-1840.722) (-1839.939) (-1832.692) -- 0:02:42
      298000 -- (-1836.865) (-1835.326) [-1834.509] (-1834.612) * (-1835.025) (-1839.538) (-1836.419) [-1834.011] -- 0:02:44
      298500 -- (-1835.466) (-1836.746) [-1835.895] (-1831.007) * (-1831.881) [-1834.562] (-1840.009) (-1838.331) -- 0:02:44
      299000 -- (-1839.842) [-1840.884] (-1841.047) (-1834.872) * (-1834.615) (-1834.221) (-1841.014) [-1834.579] -- 0:02:44
      299500 -- (-1837.298) (-1835.318) (-1842.904) [-1832.926] * [-1836.908] (-1836.315) (-1837.742) (-1839.780) -- 0:02:43
      300000 -- [-1833.788] (-1835.568) (-1838.967) (-1834.425) * (-1838.466) (-1836.749) [-1838.218] (-1840.849) -- 0:02:43

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-1836.357) (-1841.109) (-1837.204) [-1835.371] * (-1840.946) (-1837.774) [-1835.338] (-1835.990) -- 0:02:42
      301000 -- (-1833.196) (-1833.834) (-1834.052) [-1833.563] * [-1836.177] (-1835.637) (-1842.385) (-1837.759) -- 0:02:42
      301500 -- (-1838.595) (-1835.883) (-1841.513) [-1833.419] * [-1833.989] (-1840.370) (-1832.592) (-1833.291) -- 0:02:42
      302000 -- (-1833.265) (-1839.455) [-1833.002] (-1839.073) * (-1842.713) (-1834.751) (-1834.934) [-1831.699] -- 0:02:41
      302500 -- (-1839.118) (-1840.112) (-1836.969) [-1836.879] * (-1835.390) (-1839.266) (-1831.609) [-1832.284] -- 0:02:43
      303000 -- (-1838.521) [-1832.985] (-1842.589) (-1840.094) * (-1840.066) (-1843.044) [-1836.920] (-1830.253) -- 0:02:43
      303500 -- (-1839.903) (-1837.394) (-1834.613) [-1843.858] * [-1833.474] (-1841.733) (-1834.305) (-1833.730) -- 0:02:42
      304000 -- (-1837.244) [-1832.956] (-1844.818) (-1845.327) * [-1831.146] (-1833.425) (-1837.680) (-1840.319) -- 0:02:42
      304500 -- (-1835.964) [-1841.182] (-1839.057) (-1846.669) * (-1847.045) [-1839.631] (-1838.086) (-1836.166) -- 0:02:42
      305000 -- (-1836.869) [-1832.962] (-1836.744) (-1844.567) * (-1836.713) [-1835.273] (-1836.293) (-1840.445) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      305500 -- (-1844.140) (-1837.433) [-1840.735] (-1836.664) * (-1841.562) [-1837.368] (-1841.807) (-1833.014) -- 0:02:41
      306000 -- (-1835.542) (-1837.443) (-1841.312) [-1840.943] * (-1848.238) [-1844.815] (-1840.046) (-1846.468) -- 0:02:41
      306500 -- [-1834.087] (-1841.954) (-1834.763) (-1836.447) * (-1839.035) [-1834.882] (-1832.850) (-1840.010) -- 0:02:42
      307000 -- (-1832.992) (-1835.953) (-1836.916) [-1833.381] * [-1838.666] (-1834.862) (-1834.408) (-1835.654) -- 0:02:42
      307500 -- [-1837.127] (-1833.934) (-1836.524) (-1839.337) * (-1841.165) [-1835.428] (-1837.655) (-1833.716) -- 0:02:42
      308000 -- (-1841.455) (-1840.033) (-1835.509) [-1833.688] * (-1842.783) [-1838.499] (-1836.875) (-1834.830) -- 0:02:41
      308500 -- (-1832.187) [-1837.657] (-1840.597) (-1839.275) * (-1838.875) (-1834.092) (-1837.286) [-1833.477] -- 0:02:41
      309000 -- [-1838.893] (-1834.494) (-1846.496) (-1837.715) * (-1838.048) [-1834.690] (-1838.521) (-1843.777) -- 0:02:41
      309500 -- (-1834.497) [-1837.288] (-1835.927) (-1836.346) * [-1832.347] (-1831.471) (-1843.673) (-1843.416) -- 0:02:40
      310000 -- (-1834.769) (-1837.049) (-1836.173) [-1832.031] * (-1837.344) [-1831.270] (-1839.318) (-1832.485) -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-1838.152) [-1835.566] (-1837.203) (-1834.710) * (-1834.672) (-1835.851) [-1833.140] (-1843.090) -- 0:02:39
      311000 -- (-1844.542) (-1836.373) (-1834.935) [-1836.548] * (-1843.808) [-1837.214] (-1836.767) (-1837.103) -- 0:02:41
      311500 -- [-1841.775] (-1835.731) (-1837.071) (-1834.173) * (-1843.794) (-1839.687) [-1833.760] (-1841.687) -- 0:02:41
      312000 -- (-1853.449) (-1840.071) [-1834.685] (-1833.017) * (-1836.913) [-1841.069] (-1833.307) (-1840.947) -- 0:02:40
      312500 -- (-1842.011) [-1839.988] (-1836.165) (-1836.989) * (-1834.409) (-1836.173) (-1835.424) [-1841.257] -- 0:02:40
      313000 -- (-1851.036) [-1833.979] (-1832.876) (-1836.368) * (-1832.751) (-1835.490) [-1832.121] (-1835.822) -- 0:02:40
      313500 -- (-1851.489) (-1843.694) (-1838.470) [-1837.792] * (-1836.284) (-1832.860) [-1840.555] (-1844.547) -- 0:02:39
      314000 -- (-1841.370) [-1832.543] (-1839.313) (-1833.478) * (-1835.244) (-1845.090) (-1833.564) [-1837.714] -- 0:02:39
      314500 -- (-1836.142) [-1830.362] (-1834.664) (-1834.977) * [-1830.829] (-1833.806) (-1835.656) (-1831.481) -- 0:02:39
      315000 -- (-1831.067) (-1838.417) (-1834.856) [-1833.321] * (-1838.859) (-1828.416) (-1847.032) [-1835.826] -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      315500 -- [-1833.788] (-1839.723) (-1837.761) (-1850.221) * (-1834.481) [-1834.966] (-1833.178) (-1835.091) -- 0:02:40
      316000 -- (-1837.758) [-1837.802] (-1832.259) (-1835.018) * [-1841.483] (-1830.677) (-1841.289) (-1837.435) -- 0:02:40
      316500 -- (-1841.466) [-1837.559] (-1831.638) (-1842.282) * (-1838.693) (-1829.920) (-1832.772) [-1836.252] -- 0:02:39
      317000 -- [-1833.547] (-1836.794) (-1834.578) (-1848.198) * (-1834.221) (-1836.487) [-1832.530] (-1836.221) -- 0:02:39
      317500 -- (-1838.529) [-1837.885] (-1840.555) (-1837.209) * (-1844.621) [-1840.765] (-1843.890) (-1841.834) -- 0:02:39
      318000 -- [-1834.286] (-1837.812) (-1844.716) (-1842.211) * (-1845.655) (-1839.805) [-1837.796] (-1833.908) -- 0:02:38
      318500 -- (-1835.657) (-1833.829) [-1838.178] (-1844.346) * (-1841.309) (-1841.368) [-1842.468] (-1832.752) -- 0:02:38
      319000 -- (-1842.437) [-1834.041] (-1834.132) (-1835.050) * [-1838.006] (-1840.934) (-1836.004) (-1831.042) -- 0:02:37
      319500 -- (-1835.795) (-1832.341) (-1834.760) [-1834.082] * (-1837.371) (-1836.366) [-1830.863] (-1834.305) -- 0:02:39
      320000 -- (-1833.888) (-1833.156) (-1838.917) [-1832.662] * [-1841.577] (-1834.997) (-1836.831) (-1835.391) -- 0:02:39

      Average standard deviation of split frequencies: 0.000000

      320500 -- [-1834.053] (-1841.587) (-1835.385) (-1836.502) * (-1834.724) (-1833.610) (-1840.070) [-1839.875] -- 0:02:39
      321000 -- (-1833.190) (-1840.660) (-1834.396) [-1836.036] * [-1838.721] (-1839.191) (-1833.591) (-1833.235) -- 0:02:38
      321500 -- [-1833.737] (-1839.932) (-1841.257) (-1834.576) * (-1838.094) [-1837.201] (-1834.039) (-1834.765) -- 0:02:38
      322000 -- [-1839.191] (-1839.691) (-1837.125) (-1838.190) * (-1843.364) (-1837.313) [-1831.674] (-1841.044) -- 0:02:37
      322500 -- [-1831.730] (-1832.085) (-1836.507) (-1837.065) * [-1839.896] (-1835.964) (-1834.318) (-1838.749) -- 0:02:37
      323000 -- (-1842.761) (-1837.148) [-1836.860] (-1838.552) * [-1834.193] (-1834.373) (-1835.694) (-1841.257) -- 0:02:37
      323500 -- (-1845.248) [-1835.420] (-1837.611) (-1835.334) * (-1830.825) (-1831.267) (-1831.402) [-1840.383] -- 0:02:36
      324000 -- (-1844.893) (-1842.842) [-1836.229] (-1834.261) * (-1837.993) [-1835.426] (-1833.398) (-1833.688) -- 0:02:38
      324500 -- (-1838.814) (-1836.357) [-1835.229] (-1839.859) * (-1838.501) (-1838.174) (-1839.322) [-1846.286] -- 0:02:38
      325000 -- (-1830.546) [-1836.085] (-1833.091) (-1830.256) * (-1840.195) [-1839.252] (-1834.535) (-1834.176) -- 0:02:37

      Average standard deviation of split frequencies: 0.000000

      325500 -- (-1833.859) (-1841.909) (-1831.120) [-1835.630] * [-1835.795] (-1837.852) (-1835.777) (-1839.260) -- 0:02:37
      326000 -- (-1832.171) [-1840.331] (-1843.961) (-1835.217) * (-1834.004) (-1840.246) (-1834.091) [-1834.708] -- 0:02:37
      326500 -- (-1832.783) (-1833.301) [-1838.048] (-1837.668) * (-1835.778) (-1836.643) (-1838.327) [-1832.153] -- 0:02:36
      327000 -- (-1838.857) [-1831.729] (-1834.332) (-1838.433) * (-1834.371) (-1835.203) (-1836.187) [-1835.592] -- 0:02:36
      327500 -- [-1833.273] (-1839.178) (-1834.357) (-1835.149) * (-1832.296) (-1835.598) [-1832.195] (-1832.785) -- 0:02:36
      328000 -- [-1834.778] (-1832.805) (-1840.742) (-1836.019) * [-1831.316] (-1842.823) (-1836.505) (-1837.452) -- 0:02:35
      328500 -- (-1840.529) (-1842.561) (-1835.722) [-1831.558] * [-1833.704] (-1837.780) (-1841.231) (-1838.140) -- 0:02:37
      329000 -- (-1839.643) (-1836.149) (-1838.848) [-1835.408] * (-1837.317) (-1837.544) (-1835.990) [-1835.239] -- 0:02:37
      329500 -- (-1841.120) (-1836.029) (-1836.761) [-1832.630] * (-1834.280) [-1834.926] (-1832.511) (-1839.644) -- 0:02:36
      330000 -- (-1848.359) (-1838.939) (-1836.039) [-1836.207] * [-1843.840] (-1830.628) (-1837.124) (-1841.045) -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-1839.186) (-1838.119) [-1834.675] (-1835.636) * [-1839.988] (-1835.699) (-1832.005) (-1832.946) -- 0:02:35
      331000 -- (-1835.883) (-1841.657) (-1833.484) [-1835.288] * (-1845.128) [-1838.103] (-1837.342) (-1834.114) -- 0:02:35
      331500 -- (-1835.419) (-1844.924) [-1831.226] (-1831.351) * (-1833.729) (-1840.458) (-1844.271) [-1837.443] -- 0:02:35
      332000 -- (-1840.709) (-1840.809) [-1836.754] (-1833.586) * (-1838.443) [-1839.673] (-1837.122) (-1839.857) -- 0:02:34
      332500 -- (-1832.745) (-1838.009) (-1840.928) [-1834.795] * (-1846.605) (-1843.751) [-1835.535] (-1839.343) -- 0:02:36
      333000 -- (-1838.919) (-1836.359) (-1834.872) [-1832.619] * [-1833.809] (-1838.080) (-1835.845) (-1842.870) -- 0:02:36
      333500 -- (-1837.329) [-1834.059] (-1840.393) (-1833.568) * (-1831.566) [-1838.863] (-1841.974) (-1836.826) -- 0:02:35
      334000 -- (-1842.023) (-1835.454) [-1835.007] (-1831.782) * (-1831.972) [-1840.232] (-1839.826) (-1834.916) -- 0:02:35
      334500 -- (-1836.776) (-1833.557) (-1830.783) [-1833.724] * [-1836.806] (-1836.101) (-1836.329) (-1838.257) -- 0:02:35
      335000 -- (-1833.300) [-1834.353] (-1834.933) (-1832.666) * [-1836.301] (-1839.681) (-1836.220) (-1840.861) -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      335500 -- [-1833.782] (-1837.863) (-1831.119) (-1845.910) * (-1834.169) [-1834.725] (-1832.645) (-1838.139) -- 0:02:34
      336000 -- (-1835.262) [-1838.698] (-1834.427) (-1838.508) * (-1836.491) [-1834.259] (-1840.242) (-1841.928) -- 0:02:34
      336500 -- (-1835.334) (-1833.591) [-1836.964] (-1840.711) * [-1839.754] (-1830.077) (-1836.380) (-1835.879) -- 0:02:33
      337000 -- [-1831.296] (-1840.284) (-1837.537) (-1835.705) * (-1838.179) (-1832.363) [-1840.567] (-1836.237) -- 0:02:35
      337500 -- (-1833.210) (-1839.191) (-1833.099) [-1837.645] * (-1838.636) (-1842.506) (-1831.905) [-1842.050] -- 0:02:35
      338000 -- (-1830.071) (-1836.105) [-1835.013] (-1843.376) * (-1841.222) (-1832.330) (-1831.452) [-1833.881] -- 0:02:34
      338500 -- (-1836.665) (-1836.421) [-1834.870] (-1841.063) * (-1830.400) (-1838.268) [-1834.442] (-1835.592) -- 0:02:34
      339000 -- [-1833.605] (-1834.213) (-1841.519) (-1838.443) * [-1832.878] (-1838.613) (-1833.679) (-1839.382) -- 0:02:34
      339500 -- (-1832.587) (-1836.492) [-1840.324] (-1839.350) * (-1834.959) (-1832.436) [-1839.592] (-1839.220) -- 0:02:33
      340000 -- (-1835.695) (-1831.558) [-1839.966] (-1834.014) * (-1835.134) (-1833.675) (-1839.024) [-1835.801] -- 0:02:33

      Average standard deviation of split frequencies: 0.000000

      340500 -- [-1832.640] (-1839.783) (-1847.956) (-1834.536) * [-1836.027] (-1833.244) (-1843.960) (-1837.269) -- 0:02:33
      341000 -- (-1835.134) [-1836.175] (-1835.641) (-1831.598) * [-1834.784] (-1844.320) (-1836.721) (-1835.003) -- 0:02:34
      341500 -- (-1832.516) (-1834.330) (-1840.598) [-1837.500] * (-1831.805) (-1842.011) (-1835.226) [-1832.458] -- 0:02:34
      342000 -- (-1836.558) (-1840.584) (-1842.661) [-1838.714] * (-1837.047) (-1841.193) [-1829.344] (-1831.870) -- 0:02:33
      342500 -- [-1834.503] (-1831.806) (-1839.670) (-1834.972) * (-1844.745) (-1839.191) [-1837.131] (-1838.667) -- 0:02:33
      343000 -- (-1833.161) [-1830.479] (-1830.668) (-1837.226) * (-1845.482) (-1835.728) [-1831.550] (-1840.148) -- 0:02:33
      343500 -- [-1834.606] (-1833.400) (-1836.906) (-1845.291) * (-1839.365) [-1836.248] (-1834.595) (-1841.079) -- 0:02:32
      344000 -- [-1835.943] (-1834.818) (-1833.269) (-1839.122) * [-1835.538] (-1838.481) (-1837.881) (-1837.037) -- 0:02:32
      344500 -- (-1834.784) (-1840.584) (-1836.047) [-1840.969] * (-1833.439) [-1834.911] (-1830.663) (-1833.352) -- 0:02:32
      345000 -- (-1837.144) [-1835.061] (-1836.879) (-1833.608) * [-1833.917] (-1834.768) (-1831.367) (-1835.240) -- 0:02:31

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-1834.537) (-1832.726) (-1834.508) [-1838.029] * (-1835.838) (-1850.685) (-1839.887) [-1837.409] -- 0:02:33
      346000 -- (-1834.265) [-1834.036] (-1833.935) (-1837.841) * (-1833.640) (-1839.144) (-1836.141) [-1838.654] -- 0:02:33
      346500 -- (-1839.461) (-1844.839) (-1836.050) [-1833.767] * (-1834.723) (-1836.233) (-1836.312) [-1839.566] -- 0:02:32
      347000 -- (-1838.757) [-1836.951] (-1836.911) (-1833.044) * [-1836.792] (-1830.337) (-1835.453) (-1832.384) -- 0:02:32
      347500 -- [-1835.945] (-1837.751) (-1832.334) (-1834.150) * (-1830.810) (-1833.977) (-1835.604) [-1832.410] -- 0:02:32
      348000 -- (-1838.486) (-1833.874) [-1831.284] (-1839.605) * [-1838.873] (-1834.867) (-1834.928) (-1837.998) -- 0:02:31
      348500 -- [-1838.163] (-1832.360) (-1836.274) (-1831.782) * (-1839.762) (-1832.459) [-1833.706] (-1840.341) -- 0:02:31
      349000 -- (-1836.527) (-1835.609) [-1834.041] (-1840.803) * (-1845.511) [-1833.997] (-1840.612) (-1840.657) -- 0:02:31
      349500 -- (-1837.158) (-1836.077) [-1833.828] (-1833.419) * [-1835.653] (-1832.938) (-1834.843) (-1837.787) -- 0:02:30
      350000 -- (-1836.250) [-1836.080] (-1833.457) (-1841.550) * [-1840.944] (-1831.575) (-1840.073) (-1837.754) -- 0:02:32

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-1838.313) (-1844.342) [-1830.575] (-1835.821) * (-1840.980) [-1836.733] (-1836.641) (-1841.861) -- 0:02:31
      351000 -- (-1832.276) (-1835.678) (-1834.313) [-1831.975] * [-1832.557] (-1838.254) (-1837.567) (-1836.556) -- 0:02:31
      351500 -- (-1835.212) [-1836.837] (-1841.888) (-1835.159) * (-1838.248) [-1830.405] (-1837.836) (-1832.205) -- 0:02:31
      352000 -- (-1832.010) (-1836.682) (-1839.647) [-1834.409] * [-1836.097] (-1835.688) (-1843.189) (-1837.242) -- 0:02:30
      352500 -- (-1839.513) (-1841.719) (-1839.695) [-1830.148] * (-1836.728) [-1830.466] (-1840.320) (-1836.159) -- 0:02:30
      353000 -- (-1838.365) (-1845.594) (-1832.659) [-1831.844] * (-1834.378) (-1840.149) (-1842.704) [-1834.675] -- 0:02:30
      353500 -- (-1833.634) (-1835.753) [-1835.201] (-1833.152) * [-1831.767] (-1835.160) (-1839.019) (-1840.127) -- 0:02:29
      354000 -- (-1838.936) [-1834.802] (-1835.889) (-1839.316) * (-1835.622) [-1833.839] (-1832.783) (-1834.973) -- 0:02:31
      354500 -- [-1833.714] (-1830.841) (-1836.074) (-1833.546) * (-1836.513) (-1830.651) (-1838.392) [-1838.687] -- 0:02:31
      355000 -- [-1835.918] (-1840.109) (-1839.870) (-1839.366) * (-1834.342) (-1839.487) (-1842.146) [-1829.369] -- 0:02:30

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-1836.649) (-1836.304) (-1832.567) [-1834.872] * (-1832.935) (-1835.119) [-1837.364] (-1844.306) -- 0:02:30
      356000 -- [-1836.319] (-1838.608) (-1834.487) (-1837.835) * (-1836.480) (-1838.310) (-1836.716) [-1843.127] -- 0:02:30
      356500 -- (-1839.157) (-1840.985) [-1835.679] (-1838.396) * (-1833.843) (-1834.834) [-1832.075] (-1842.274) -- 0:02:29
      357000 -- (-1833.820) (-1838.867) [-1838.415] (-1838.408) * (-1834.452) [-1835.367] (-1831.241) (-1834.969) -- 0:02:29
      357500 -- (-1831.639) (-1842.589) (-1843.519) [-1833.718] * (-1835.063) [-1836.769] (-1831.544) (-1835.535) -- 0:02:29
      358000 -- (-1838.164) (-1847.868) (-1836.773) [-1831.970] * (-1834.100) (-1836.418) [-1837.984] (-1845.572) -- 0:02:28
      358500 -- (-1837.511) (-1841.432) (-1834.008) [-1836.637] * (-1832.539) (-1838.206) [-1837.072] (-1844.775) -- 0:02:30
      359000 -- (-1832.680) [-1831.700] (-1833.405) (-1835.560) * (-1839.468) (-1833.640) [-1835.122] (-1836.900) -- 0:02:29
      359500 -- (-1835.957) (-1837.399) (-1838.798) [-1837.411] * [-1838.538] (-1839.984) (-1836.246) (-1838.887) -- 0:02:29
      360000 -- (-1831.178) (-1830.606) [-1840.430] (-1834.875) * [-1832.784] (-1843.252) (-1837.495) (-1843.924) -- 0:02:29

      Average standard deviation of split frequencies: 0.000000

      360500 -- (-1834.337) (-1837.060) (-1839.119) [-1837.276] * (-1835.155) (-1847.345) (-1842.231) [-1834.746] -- 0:02:29
      361000 -- (-1829.596) [-1836.973] (-1834.690) (-1838.886) * (-1841.074) (-1847.258) (-1839.457) [-1831.671] -- 0:02:28
      361500 -- [-1837.059] (-1832.832) (-1840.319) (-1832.799) * (-1840.257) (-1834.316) [-1834.778] (-1835.781) -- 0:02:28
      362000 -- (-1841.454) [-1838.104] (-1834.433) (-1835.395) * (-1835.655) (-1838.029) (-1832.553) [-1843.781] -- 0:02:28
      362500 -- (-1844.494) (-1838.479) (-1843.932) [-1835.300] * [-1836.367] (-1835.266) (-1838.023) (-1839.223) -- 0:02:29
      363000 -- (-1836.546) (-1844.634) (-1837.714) [-1832.724] * [-1833.021] (-1836.701) (-1836.381) (-1837.164) -- 0:02:29
      363500 -- (-1838.470) (-1838.628) (-1841.095) [-1840.266] * (-1842.464) (-1836.198) [-1831.177] (-1836.741) -- 0:02:28
      364000 -- (-1832.460) [-1836.460] (-1847.399) (-1834.353) * [-1830.648] (-1836.919) (-1838.831) (-1834.171) -- 0:02:28
      364500 -- (-1836.546) (-1834.116) [-1839.950] (-1836.932) * (-1837.130) [-1837.228] (-1839.216) (-1834.602) -- 0:02:28
      365000 -- [-1833.630] (-1831.818) (-1838.299) (-1843.594) * [-1838.475] (-1835.516) (-1833.383) (-1838.760) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      365500 -- (-1833.666) (-1841.377) [-1837.779] (-1834.211) * [-1833.782] (-1839.273) (-1835.176) (-1835.129) -- 0:02:27
      366000 -- [-1837.737] (-1833.674) (-1833.082) (-1835.573) * [-1836.213] (-1837.337) (-1838.685) (-1830.731) -- 0:02:27
      366500 -- (-1839.107) (-1837.732) [-1835.861] (-1834.208) * [-1833.433] (-1843.935) (-1844.128) (-1838.697) -- 0:02:26
      367000 -- (-1845.526) (-1837.376) (-1837.665) [-1833.606] * (-1833.721) (-1837.896) [-1834.783] (-1835.410) -- 0:02:28
      367500 -- (-1833.922) [-1836.100] (-1833.996) (-1836.740) * (-1834.930) (-1838.126) [-1840.547] (-1839.443) -- 0:02:28
      368000 -- [-1837.447] (-1835.683) (-1832.818) (-1839.054) * [-1833.170] (-1837.951) (-1834.779) (-1837.565) -- 0:02:27
      368500 -- (-1837.011) [-1838.531] (-1833.985) (-1836.234) * [-1836.358] (-1837.867) (-1839.834) (-1834.834) -- 0:02:27
      369000 -- (-1833.186) [-1833.938] (-1838.080) (-1833.961) * (-1840.175) (-1840.165) (-1839.346) [-1835.372] -- 0:02:27
      369500 -- [-1833.781] (-1835.520) (-1838.191) (-1842.198) * (-1838.513) (-1838.977) [-1831.395] (-1848.252) -- 0:02:26
      370000 -- (-1842.538) (-1834.323) [-1832.801] (-1841.628) * (-1841.459) (-1836.404) [-1829.675] (-1840.035) -- 0:02:26

      Average standard deviation of split frequencies: 0.000000

      370500 -- [-1833.805] (-1836.234) (-1830.785) (-1842.882) * (-1836.506) (-1832.979) (-1832.961) [-1839.142] -- 0:02:26
      371000 -- (-1838.629) [-1836.451] (-1832.237) (-1841.593) * [-1835.594] (-1835.376) (-1835.349) (-1840.164) -- 0:02:25
      371500 -- (-1837.848) [-1831.382] (-1834.213) (-1840.399) * (-1835.538) (-1834.556) [-1831.391] (-1837.382) -- 0:02:27
      372000 -- (-1831.294) (-1836.925) (-1833.150) [-1840.126] * (-1830.073) (-1846.392) (-1834.255) [-1831.909] -- 0:02:26
      372500 -- (-1835.552) [-1833.661] (-1838.311) (-1843.077) * (-1832.343) (-1838.730) [-1833.128] (-1836.307) -- 0:02:26
      373000 -- (-1835.946) [-1832.290] (-1842.120) (-1833.619) * [-1837.920] (-1835.645) (-1834.519) (-1829.608) -- 0:02:26
      373500 -- (-1839.603) [-1833.035] (-1838.654) (-1835.499) * [-1831.724] (-1831.132) (-1830.928) (-1834.581) -- 0:02:25
      374000 -- (-1832.020) (-1837.521) (-1837.571) [-1835.080] * (-1834.718) (-1830.862) (-1837.327) [-1834.008] -- 0:02:25
      374500 -- (-1835.391) [-1832.030] (-1844.447) (-1833.817) * (-1842.095) (-1838.104) (-1840.525) [-1832.686] -- 0:02:25
      375000 -- [-1834.702] (-1834.661) (-1843.885) (-1832.860) * [-1834.899] (-1840.023) (-1836.397) (-1836.923) -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      375500 -- (-1832.804) (-1837.113) [-1832.785] (-1839.522) * (-1840.101) (-1839.260) (-1832.474) [-1834.332] -- 0:02:26
      376000 -- (-1833.382) (-1842.668) [-1834.652] (-1838.380) * (-1834.962) (-1838.715) (-1835.882) [-1838.830] -- 0:02:26
      376500 -- [-1836.569] (-1836.974) (-1839.785) (-1836.791) * (-1832.735) (-1832.320) (-1833.252) [-1833.432] -- 0:02:25
      377000 -- (-1837.061) [-1834.370] (-1833.182) (-1838.606) * (-1834.902) (-1836.699) (-1835.835) [-1834.073] -- 0:02:25
      377500 -- (-1834.442) (-1832.689) (-1841.180) [-1835.088] * (-1835.370) (-1844.172) [-1836.442] (-1834.368) -- 0:02:25
      378000 -- (-1837.916) [-1837.490] (-1836.656) (-1829.251) * (-1832.664) (-1832.273) [-1835.842] (-1837.981) -- 0:02:24
      378500 -- [-1835.928] (-1833.048) (-1844.935) (-1836.052) * (-1831.416) [-1830.969] (-1831.678) (-1837.694) -- 0:02:24
      379000 -- (-1842.487) (-1831.936) (-1836.343) [-1829.835] * (-1834.409) (-1834.961) (-1833.770) [-1835.474] -- 0:02:24
      379500 -- (-1837.571) [-1835.184] (-1839.122) (-1836.882) * (-1832.329) (-1847.574) (-1839.885) [-1833.163] -- 0:02:23
      380000 -- (-1834.700) (-1837.511) (-1836.343) [-1833.257] * (-1835.598) [-1831.821] (-1833.080) (-1832.177) -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      380500 -- (-1840.955) (-1830.187) [-1835.140] (-1834.002) * (-1835.279) (-1831.445) (-1842.114) [-1838.663] -- 0:02:24
      381000 -- (-1842.859) (-1836.962) (-1834.037) [-1830.537] * [-1837.168] (-1834.773) (-1837.605) (-1837.603) -- 0:02:24
      381500 -- [-1838.961] (-1834.068) (-1837.379) (-1833.549) * (-1834.987) (-1830.824) (-1841.938) [-1833.354] -- 0:02:24
      382000 -- (-1835.609) [-1834.540] (-1832.745) (-1836.287) * (-1837.592) [-1835.093] (-1835.253) (-1835.176) -- 0:02:23
      382500 -- (-1843.401) (-1837.227) [-1834.459] (-1834.375) * (-1839.613) [-1840.816] (-1841.153) (-1833.966) -- 0:02:23
      383000 -- (-1842.604) (-1828.767) [-1832.607] (-1832.035) * (-1840.989) (-1836.700) (-1838.799) [-1838.866] -- 0:02:23
      383500 -- [-1838.952] (-1837.396) (-1845.487) (-1838.962) * (-1836.648) [-1838.661] (-1833.733) (-1837.659) -- 0:02:23
      384000 -- [-1836.549] (-1837.339) (-1838.079) (-1836.378) * (-1835.041) (-1835.012) [-1831.809] (-1843.562) -- 0:02:24
      384500 -- (-1834.829) (-1840.166) [-1839.003] (-1838.015) * (-1846.699) (-1835.823) [-1836.687] (-1833.761) -- 0:02:24
      385000 -- (-1833.807) (-1837.090) (-1842.991) [-1829.941] * (-1835.818) (-1835.406) [-1833.312] (-1840.839) -- 0:02:23

      Average standard deviation of split frequencies: 0.000000

      385500 -- [-1836.446] (-1838.907) (-1836.468) (-1843.544) * [-1834.222] (-1834.646) (-1832.676) (-1842.768) -- 0:02:23
      386000 -- (-1830.434) (-1837.979) (-1831.841) [-1833.193] * (-1833.217) (-1839.007) (-1835.458) [-1836.661] -- 0:02:23
      386500 -- (-1833.601) (-1842.954) (-1835.719) [-1839.899] * (-1844.963) [-1830.430] (-1842.926) (-1833.697) -- 0:02:22
      387000 -- (-1836.353) [-1834.615] (-1835.837) (-1840.385) * (-1839.700) [-1835.318] (-1838.864) (-1839.057) -- 0:02:22
      387500 -- (-1834.174) (-1843.611) (-1834.917) [-1836.829] * [-1839.227] (-1834.312) (-1840.726) (-1836.894) -- 0:02:22
      388000 -- (-1836.039) (-1842.295) [-1832.928] (-1836.806) * (-1839.262) (-1838.646) (-1836.981) [-1836.137] -- 0:02:21
      388500 -- [-1833.868] (-1837.384) (-1838.825) (-1843.946) * (-1837.439) (-1831.755) [-1831.152] (-1833.585) -- 0:02:23
      389000 -- (-1835.902) [-1831.544] (-1841.057) (-1840.526) * (-1835.695) (-1839.360) (-1841.100) [-1835.849] -- 0:02:22
      389500 -- (-1840.431) (-1835.263) [-1836.973] (-1839.127) * [-1833.875] (-1837.029) (-1844.954) (-1832.580) -- 0:02:22
      390000 -- [-1842.173] (-1835.416) (-1833.658) (-1839.286) * (-1838.490) (-1835.047) (-1838.170) [-1837.218] -- 0:02:22

      Average standard deviation of split frequencies: 0.000000

      390500 -- (-1834.820) (-1836.112) [-1837.254] (-1843.529) * (-1840.518) (-1834.713) (-1834.643) [-1837.376] -- 0:02:22
      391000 -- [-1835.122] (-1840.433) (-1836.492) (-1836.030) * (-1832.692) (-1838.940) (-1839.101) [-1837.650] -- 0:02:21
      391500 -- (-1836.896) (-1841.898) (-1837.104) [-1837.954] * [-1834.693] (-1840.169) (-1838.650) (-1845.113) -- 0:02:21
      392000 -- [-1836.911] (-1838.940) (-1841.161) (-1833.185) * (-1841.386) [-1839.127] (-1836.648) (-1846.206) -- 0:02:21
      392500 -- (-1839.511) (-1836.408) [-1834.708] (-1836.077) * (-1832.966) [-1843.234] (-1839.021) (-1837.041) -- 0:02:20
      393000 -- (-1837.209) [-1836.524] (-1844.444) (-1838.127) * [-1832.241] (-1837.044) (-1846.110) (-1845.502) -- 0:02:22
      393500 -- (-1839.937) [-1837.120] (-1837.103) (-1837.950) * [-1838.610] (-1832.896) (-1835.123) (-1833.227) -- 0:02:21
      394000 -- (-1837.364) [-1834.080] (-1834.473) (-1836.220) * (-1834.057) (-1835.460) (-1833.838) [-1839.517] -- 0:02:21
      394500 -- (-1835.718) [-1841.615] (-1836.729) (-1833.226) * (-1834.906) (-1830.812) (-1837.568) [-1837.076] -- 0:02:21
      395000 -- (-1842.451) (-1840.541) (-1837.745) [-1835.535] * (-1830.603) [-1833.634] (-1835.260) (-1839.918) -- 0:02:20

      Average standard deviation of split frequencies: 0.000000

      395500 -- (-1840.217) [-1834.607] (-1840.853) (-1836.189) * (-1836.916) [-1834.025] (-1836.605) (-1829.080) -- 0:02:20
      396000 -- (-1835.266) (-1831.495) (-1839.737) [-1835.276] * (-1837.345) (-1844.936) [-1838.418] (-1831.078) -- 0:02:20
      396500 -- (-1838.631) (-1836.446) (-1839.749) [-1837.369] * (-1836.579) (-1836.414) [-1832.271] (-1833.952) -- 0:02:20
      397000 -- (-1836.843) (-1841.465) (-1836.984) [-1835.640] * (-1834.172) (-1841.537) [-1832.073] (-1837.132) -- 0:02:21
      397500 -- (-1834.949) (-1832.293) (-1834.237) [-1835.420] * (-1839.662) (-1839.232) [-1837.692] (-1835.319) -- 0:02:20
      398000 -- [-1836.611] (-1831.349) (-1835.190) (-1838.719) * [-1839.640] (-1834.315) (-1841.701) (-1837.265) -- 0:02:20
      398500 -- (-1844.834) (-1839.468) [-1837.689] (-1832.857) * (-1834.735) [-1834.071] (-1838.566) (-1835.075) -- 0:02:20
      399000 -- (-1840.420) [-1835.726] (-1835.032) (-1837.678) * [-1829.240] (-1843.525) (-1841.376) (-1835.145) -- 0:02:20
      399500 -- (-1834.526) (-1836.440) [-1841.827] (-1837.821) * [-1835.114] (-1831.181) (-1832.248) (-1832.886) -- 0:02:19
      400000 -- [-1839.542] (-1841.107) (-1835.616) (-1835.346) * (-1844.219) (-1832.591) (-1833.898) [-1837.685] -- 0:02:19

      Average standard deviation of split frequencies: 0.000000

      400500 -- (-1845.086) (-1833.518) [-1837.341] (-1836.941) * (-1833.604) [-1830.866] (-1834.364) (-1838.114) -- 0:02:19
      401000 -- (-1837.437) (-1834.645) (-1842.405) [-1834.417] * (-1833.016) (-1838.799) (-1834.340) [-1833.778] -- 0:02:18
      401500 -- (-1836.256) [-1832.955] (-1840.103) (-1842.854) * (-1834.939) [-1833.137] (-1834.141) (-1837.919) -- 0:02:20
      402000 -- (-1834.487) (-1837.340) [-1836.032] (-1838.324) * [-1834.275] (-1832.189) (-1833.664) (-1831.492) -- 0:02:19
      402500 -- (-1837.090) [-1835.239] (-1839.274) (-1838.453) * (-1833.703) (-1841.640) (-1833.619) [-1834.284] -- 0:02:19
      403000 -- (-1837.918) [-1831.751] (-1838.582) (-1833.208) * (-1840.894) (-1835.279) [-1832.833] (-1840.278) -- 0:02:19
      403500 -- [-1832.134] (-1828.955) (-1833.481) (-1841.592) * (-1835.378) [-1837.529] (-1845.429) (-1841.161) -- 0:02:18
      404000 -- (-1841.411) [-1838.167] (-1832.945) (-1837.861) * (-1832.071) (-1837.887) [-1830.712] (-1835.648) -- 0:02:18
      404500 -- (-1839.008) (-1835.798) (-1834.370) [-1835.151] * (-1833.299) (-1834.712) (-1830.469) [-1836.314] -- 0:02:18
      405000 -- (-1839.483) (-1834.878) (-1841.726) [-1830.533] * (-1837.087) (-1834.548) [-1837.899] (-1837.261) -- 0:02:18

      Average standard deviation of split frequencies: 0.000000

      405500 -- (-1837.808) (-1838.408) (-1837.004) [-1841.798] * (-1840.284) (-1838.324) (-1833.462) [-1838.412] -- 0:02:19
      406000 -- (-1838.000) [-1837.886] (-1834.779) (-1838.205) * (-1834.372) (-1836.437) [-1837.260] (-1832.072) -- 0:02:18
      406500 -- [-1835.162] (-1838.857) (-1836.463) (-1841.228) * [-1836.032] (-1839.939) (-1839.627) (-1839.984) -- 0:02:18
      407000 -- (-1839.850) [-1835.896] (-1831.975) (-1834.067) * (-1836.001) (-1834.437) (-1837.579) [-1840.475] -- 0:02:18
      407500 -- (-1835.911) (-1833.771) (-1833.473) [-1834.770] * [-1831.211] (-1830.620) (-1837.974) (-1840.165) -- 0:02:18
      408000 -- [-1834.571] (-1831.218) (-1835.610) (-1843.433) * (-1834.613) [-1831.687] (-1838.046) (-1844.718) -- 0:02:17
      408500 -- [-1845.078] (-1833.302) (-1831.804) (-1842.214) * (-1834.172) [-1832.903] (-1834.141) (-1834.574) -- 0:02:17
      409000 -- (-1837.094) [-1833.061] (-1834.448) (-1835.180) * (-1837.045) (-1834.922) [-1830.230] (-1844.323) -- 0:02:17
      409500 -- (-1831.995) (-1842.091) [-1832.637] (-1835.680) * (-1837.023) [-1834.565] (-1836.925) (-1841.535) -- 0:02:16
      410000 -- (-1836.331) (-1832.370) [-1833.549] (-1839.209) * (-1842.918) (-1840.076) [-1839.932] (-1836.506) -- 0:02:18

      Average standard deviation of split frequencies: 0.000000

      410500 -- (-1833.362) [-1832.897] (-1841.547) (-1835.057) * (-1840.048) [-1839.604] (-1840.490) (-1834.717) -- 0:02:17
      411000 -- (-1837.921) (-1839.557) [-1833.572] (-1836.647) * [-1838.874] (-1836.910) (-1833.762) (-1837.721) -- 0:02:17
      411500 -- [-1836.935] (-1838.173) (-1835.783) (-1832.136) * (-1830.839) [-1836.706] (-1832.841) (-1834.735) -- 0:02:17
      412000 -- (-1836.541) [-1836.709] (-1833.619) (-1841.171) * (-1841.770) [-1837.146] (-1837.453) (-1832.539) -- 0:02:17
      412500 -- (-1838.604) (-1838.281) [-1832.279] (-1838.066) * (-1831.005) (-1833.868) [-1835.408] (-1836.701) -- 0:02:16
      413000 -- [-1835.455] (-1840.202) (-1839.299) (-1846.731) * (-1835.346) [-1835.422] (-1834.537) (-1835.132) -- 0:02:16
      413500 -- (-1837.733) [-1837.219] (-1830.138) (-1837.235) * [-1833.626] (-1836.379) (-1834.057) (-1840.779) -- 0:02:16
      414000 -- (-1830.855) (-1836.860) [-1832.659] (-1836.505) * (-1836.828) (-1839.130) [-1838.408] (-1842.112) -- 0:02:15
      414500 -- (-1834.794) (-1841.381) (-1835.416) [-1833.374] * (-1832.146) (-1843.347) [-1836.226] (-1842.952) -- 0:02:17
      415000 -- [-1836.014] (-1845.175) (-1837.355) (-1833.803) * (-1836.426) (-1840.856) [-1832.970] (-1833.054) -- 0:02:16

      Average standard deviation of split frequencies: 0.000000

      415500 -- [-1833.811] (-1838.859) (-1836.832) (-1834.553) * [-1836.609] (-1836.239) (-1843.644) (-1834.551) -- 0:02:16
      416000 -- (-1835.214) (-1844.833) (-1836.266) [-1838.421] * [-1836.018] (-1837.371) (-1836.998) (-1835.569) -- 0:02:16
      416500 -- (-1837.559) (-1833.646) [-1834.478] (-1835.713) * [-1836.162] (-1834.800) (-1835.667) (-1840.499) -- 0:02:15
      417000 -- (-1835.078) (-1845.561) (-1839.698) [-1840.286] * (-1834.600) [-1834.519] (-1833.967) (-1838.343) -- 0:02:15
      417500 -- (-1840.371) [-1834.857] (-1836.620) (-1843.681) * (-1836.985) [-1834.386] (-1834.869) (-1840.641) -- 0:02:15
      418000 -- [-1834.999] (-1836.605) (-1836.468) (-1845.314) * (-1832.370) [-1834.985] (-1833.840) (-1838.892) -- 0:02:15
      418500 -- (-1841.502) [-1841.418] (-1835.506) (-1844.510) * [-1830.231] (-1841.206) (-1844.577) (-1841.561) -- 0:02:16
      419000 -- (-1839.665) [-1837.118] (-1841.195) (-1845.091) * (-1836.986) (-1832.556) [-1832.985] (-1838.646) -- 0:02:15
      419500 -- (-1838.206) [-1834.506] (-1838.878) (-1841.463) * [-1832.176] (-1833.820) (-1839.558) (-1839.713) -- 0:02:15
      420000 -- (-1838.748) (-1841.700) (-1837.873) [-1836.946] * (-1836.899) (-1835.556) (-1839.086) [-1836.960] -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      420500 -- (-1839.496) [-1838.993] (-1836.833) (-1838.798) * (-1846.840) (-1832.956) [-1833.646] (-1839.392) -- 0:02:15
      421000 -- (-1844.662) (-1837.503) [-1836.013] (-1838.420) * [-1841.170] (-1836.338) (-1832.785) (-1842.883) -- 0:02:14
      421500 -- (-1839.665) [-1833.901] (-1833.312) (-1842.906) * (-1844.253) (-1837.509) [-1834.303] (-1846.910) -- 0:02:14
      422000 -- (-1839.679) (-1831.464) (-1837.393) [-1834.524] * (-1843.521) (-1831.746) (-1835.218) [-1838.536] -- 0:02:14
      422500 -- (-1831.490) (-1845.578) [-1835.475] (-1837.234) * (-1841.750) (-1834.469) (-1833.269) [-1834.113] -- 0:02:13
      423000 -- (-1838.423) (-1841.459) [-1833.731] (-1834.464) * [-1835.909] (-1837.138) (-1833.706) (-1841.218) -- 0:02:15
      423500 -- (-1837.788) [-1837.395] (-1838.230) (-1837.984) * (-1835.722) [-1835.309] (-1833.527) (-1837.330) -- 0:02:14
      424000 -- (-1835.386) (-1840.088) (-1833.675) [-1834.709] * [-1836.739] (-1842.518) (-1835.534) (-1838.629) -- 0:02:14
      424500 -- (-1833.274) (-1837.005) (-1830.382) [-1841.648] * (-1834.693) (-1841.427) [-1832.467] (-1836.656) -- 0:02:14
      425000 -- (-1835.639) [-1834.256] (-1834.662) (-1842.164) * [-1835.047] (-1839.716) (-1834.576) (-1836.689) -- 0:02:13

      Average standard deviation of split frequencies: 0.000000

      425500 -- (-1845.181) (-1837.126) [-1834.445] (-1837.031) * (-1836.382) (-1831.342) (-1838.471) [-1835.875] -- 0:02:13
      426000 -- [-1837.287] (-1836.137) (-1838.181) (-1841.100) * (-1832.796) [-1836.951] (-1834.448) (-1831.135) -- 0:02:13
      426500 -- (-1839.134) [-1833.192] (-1834.309) (-1843.756) * [-1840.689] (-1832.669) (-1838.654) (-1835.343) -- 0:02:13
      427000 -- (-1840.480) [-1830.863] (-1833.051) (-1833.758) * (-1849.906) [-1833.369] (-1841.103) (-1837.046) -- 0:02:12
      427500 -- (-1837.642) [-1834.388] (-1834.316) (-1835.306) * (-1837.430) (-1838.561) [-1839.537] (-1836.319) -- 0:02:13
      428000 -- (-1843.919) (-1833.149) (-1836.852) [-1836.730] * (-1839.651) (-1837.478) (-1835.504) [-1841.079] -- 0:02:13
      428500 -- (-1843.753) (-1834.044) (-1829.728) [-1836.593] * [-1833.619] (-1834.181) (-1837.891) (-1840.196) -- 0:02:13
      429000 -- (-1838.386) [-1841.644] (-1853.123) (-1834.329) * [-1835.800] (-1835.939) (-1840.668) (-1837.543) -- 0:02:13
      429500 -- [-1837.275] (-1839.223) (-1835.798) (-1832.608) * (-1837.112) [-1836.954] (-1844.717) (-1835.344) -- 0:02:12
      430000 -- [-1835.045] (-1837.385) (-1838.805) (-1832.810) * (-1837.847) (-1838.281) [-1841.199] (-1835.557) -- 0:02:12

      Average standard deviation of split frequencies: 0.000000

      430500 -- (-1833.777) [-1833.011] (-1839.522) (-1834.192) * (-1833.486) (-1829.853) [-1842.078] (-1834.894) -- 0:02:12
      431000 -- (-1835.571) [-1837.419] (-1835.723) (-1833.430) * [-1831.457] (-1836.725) (-1845.160) (-1836.506) -- 0:02:12
      431500 -- (-1834.371) (-1837.271) [-1837.266] (-1838.981) * (-1829.760) [-1836.533] (-1835.571) (-1838.031) -- 0:02:13
      432000 -- [-1834.193] (-1831.183) (-1836.528) (-1837.439) * (-1842.468) [-1836.293] (-1837.407) (-1830.553) -- 0:02:12
      432500 -- (-1837.872) (-1835.971) (-1841.698) [-1837.858] * (-1839.809) (-1838.092) (-1838.659) [-1831.877] -- 0:02:12
      433000 -- (-1844.268) [-1842.233] (-1837.731) (-1836.709) * (-1836.460) (-1837.940) (-1840.337) [-1832.520] -- 0:02:12
      433500 -- [-1838.272] (-1839.712) (-1836.927) (-1836.454) * (-1831.445) [-1835.495] (-1831.112) (-1832.464) -- 0:02:11
      434000 -- (-1844.707) [-1840.282] (-1834.989) (-1840.788) * (-1839.340) (-1843.030) (-1835.434) [-1832.981] -- 0:02:11
      434500 -- (-1837.636) [-1831.963] (-1835.564) (-1834.453) * [-1835.676] (-1832.402) (-1837.450) (-1839.856) -- 0:02:11
      435000 -- (-1834.123) (-1835.766) [-1838.235] (-1841.373) * (-1836.847) [-1836.159] (-1835.612) (-1839.839) -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      435500 -- (-1837.041) (-1836.730) (-1840.615) [-1835.008] * (-1831.631) (-1831.424) (-1842.673) [-1841.583] -- 0:02:10
      436000 -- [-1841.282] (-1838.154) (-1836.193) (-1834.784) * (-1838.313) (-1833.044) [-1843.152] (-1836.875) -- 0:02:11
      436500 -- (-1835.682) (-1835.764) (-1836.670) [-1834.733] * (-1837.994) [-1837.581] (-1838.464) (-1832.568) -- 0:02:11
      437000 -- (-1831.339) (-1836.188) [-1832.379] (-1833.732) * (-1830.204) [-1832.522] (-1840.803) (-1841.713) -- 0:02:11
      437500 -- [-1839.001] (-1839.786) (-1833.017) (-1839.878) * (-1839.438) [-1836.663] (-1837.664) (-1837.246) -- 0:02:11
      438000 -- [-1836.080] (-1836.569) (-1834.987) (-1837.734) * [-1838.275] (-1832.417) (-1834.360) (-1831.895) -- 0:02:10
      438500 -- [-1831.347] (-1835.251) (-1838.706) (-1840.130) * [-1834.620] (-1835.611) (-1829.428) (-1837.126) -- 0:02:10
      439000 -- [-1834.299] (-1836.316) (-1842.602) (-1841.604) * (-1832.942) (-1833.246) [-1832.951] (-1835.210) -- 0:02:10
      439500 -- (-1840.717) (-1834.801) [-1838.651] (-1843.171) * (-1836.877) (-1833.159) (-1838.485) [-1834.710] -- 0:02:10
      440000 -- [-1832.536] (-1836.736) (-1841.268) (-1838.392) * (-1840.586) [-1831.701] (-1837.121) (-1831.831) -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      440500 -- (-1834.300) (-1835.887) (-1833.077) [-1831.878] * (-1836.804) (-1838.055) (-1837.880) [-1832.091] -- 0:02:10
      441000 -- [-1831.280] (-1838.766) (-1838.628) (-1837.177) * (-1834.734) (-1841.508) [-1836.122] (-1838.455) -- 0:02:10
      441500 -- (-1837.719) (-1844.185) (-1836.933) [-1840.069] * (-1843.015) (-1840.134) [-1840.099] (-1837.313) -- 0:02:10
      442000 -- (-1831.947) [-1838.998] (-1833.199) (-1843.561) * (-1840.457) (-1848.533) (-1836.518) [-1838.970] -- 0:02:10
      442500 -- (-1835.482) (-1837.343) [-1837.955] (-1833.716) * (-1831.415) (-1840.984) (-1831.689) [-1835.579] -- 0:02:09
      443000 -- (-1831.265) (-1845.863) [-1840.705] (-1835.572) * (-1832.140) (-1838.528) [-1831.120] (-1834.746) -- 0:02:09
      443500 -- (-1836.316) (-1833.999) (-1842.129) [-1833.812] * [-1828.832] (-1838.084) (-1837.736) (-1843.647) -- 0:02:09
      444000 -- (-1831.207) (-1837.690) (-1831.662) [-1832.293] * (-1833.265) (-1837.566) [-1831.639] (-1836.268) -- 0:02:08
      444500 -- (-1839.284) (-1833.803) (-1830.649) [-1839.429] * (-1835.532) [-1837.360] (-1836.904) (-1834.760) -- 0:02:09
      445000 -- (-1835.572) (-1838.669) [-1832.107] (-1833.488) * [-1836.608] (-1833.450) (-1841.078) (-1835.526) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      445500 -- (-1832.895) [-1834.310] (-1837.037) (-1838.827) * (-1838.277) [-1830.131] (-1834.796) (-1841.564) -- 0:02:09
      446000 -- (-1836.609) (-1838.752) (-1839.472) [-1835.460] * (-1840.264) [-1831.100] (-1835.258) (-1838.570) -- 0:02:09
      446500 -- [-1839.854] (-1840.400) (-1834.550) (-1843.382) * [-1836.870] (-1837.590) (-1837.335) (-1838.925) -- 0:02:08
      447000 -- (-1832.240) (-1839.643) (-1838.243) [-1833.902] * (-1833.469) (-1830.917) [-1836.904] (-1841.284) -- 0:02:08
      447500 -- (-1831.717) (-1836.939) (-1841.138) [-1832.170] * (-1834.872) [-1834.198] (-1837.601) (-1834.604) -- 0:02:08
      448000 -- (-1836.573) (-1836.640) [-1838.837] (-1834.125) * [-1832.825] (-1837.980) (-1837.545) (-1844.342) -- 0:02:08
      448500 -- [-1840.518] (-1839.055) (-1845.434) (-1836.783) * [-1840.901] (-1840.370) (-1837.970) (-1842.929) -- 0:02:07
      449000 -- (-1842.758) [-1833.213] (-1843.108) (-1832.787) * (-1832.121) (-1833.942) (-1841.858) [-1834.468] -- 0:02:08
      449500 -- (-1831.694) [-1833.680] (-1841.739) (-1834.646) * [-1839.128] (-1834.804) (-1835.127) (-1845.096) -- 0:02:08
      450000 -- (-1835.085) [-1844.904] (-1844.206) (-1836.968) * (-1841.237) (-1833.644) (-1839.750) [-1836.066] -- 0:02:08

      Average standard deviation of split frequencies: 0.000000

      450500 -- [-1833.250] (-1834.591) (-1840.382) (-1835.772) * (-1833.460) [-1831.950] (-1840.930) (-1832.974) -- 0:02:08
      451000 -- (-1837.576) [-1835.629] (-1837.012) (-1838.504) * [-1833.642] (-1837.046) (-1838.241) (-1832.303) -- 0:02:07
      451500 -- (-1833.949) (-1837.186) (-1838.523) [-1835.913] * [-1832.680] (-1841.543) (-1840.880) (-1841.524) -- 0:02:07
      452000 -- [-1843.416] (-1841.383) (-1839.116) (-1843.884) * (-1835.770) (-1838.843) [-1840.085] (-1837.998) -- 0:02:07
      452500 -- (-1844.116) (-1835.882) [-1834.076] (-1833.669) * (-1838.229) [-1831.893] (-1839.947) (-1839.647) -- 0:02:07
      453000 -- (-1843.676) (-1840.076) [-1831.586] (-1835.920) * (-1834.321) [-1833.349] (-1837.527) (-1837.835) -- 0:02:06
      453500 -- (-1838.518) (-1837.664) (-1834.635) [-1835.253] * (-1833.705) (-1843.449) [-1837.452] (-1838.016) -- 0:02:07
      454000 -- [-1836.505] (-1832.887) (-1837.680) (-1833.511) * (-1831.932) (-1839.412) [-1831.899] (-1831.663) -- 0:02:07
      454500 -- [-1848.059] (-1835.406) (-1840.520) (-1834.087) * (-1838.120) [-1836.290] (-1836.413) (-1832.166) -- 0:02:07
      455000 -- [-1838.825] (-1842.176) (-1841.478) (-1834.303) * [-1833.355] (-1831.728) (-1841.417) (-1835.863) -- 0:02:06

      Average standard deviation of split frequencies: 0.000000

      455500 -- (-1832.886) (-1832.268) [-1840.071] (-1838.090) * (-1843.712) (-1835.613) (-1836.343) [-1836.474] -- 0:02:06
      456000 -- (-1839.965) [-1837.950] (-1841.867) (-1837.293) * (-1833.183) [-1833.854] (-1832.026) (-1836.881) -- 0:02:06
      456500 -- (-1845.014) (-1840.041) [-1832.995] (-1837.962) * (-1834.693) [-1836.059] (-1838.954) (-1842.385) -- 0:02:06
      457000 -- (-1845.957) (-1834.614) [-1833.849] (-1834.979) * (-1836.672) (-1839.137) [-1834.770] (-1837.812) -- 0:02:05
      457500 -- (-1836.322) [-1836.011] (-1844.730) (-1840.607) * (-1848.844) [-1840.482] (-1844.915) (-1832.723) -- 0:02:06
      458000 -- [-1839.221] (-1836.165) (-1852.337) (-1835.795) * [-1839.962] (-1835.215) (-1843.960) (-1835.783) -- 0:02:06
      458500 -- (-1831.775) (-1835.212) [-1835.322] (-1840.754) * (-1836.950) (-1832.807) [-1842.434] (-1836.409) -- 0:02:06
      459000 -- [-1830.431] (-1834.796) (-1836.669) (-1844.645) * (-1834.665) (-1837.890) [-1833.879] (-1849.636) -- 0:02:06
      459500 -- [-1832.102] (-1835.144) (-1835.907) (-1836.728) * [-1839.766] (-1843.742) (-1839.227) (-1835.973) -- 0:02:05
      460000 -- (-1836.289) (-1837.395) [-1832.896] (-1834.354) * (-1832.764) (-1840.062) [-1840.850] (-1840.962) -- 0:02:05

      Average standard deviation of split frequencies: 0.000000

      460500 -- [-1834.013] (-1839.755) (-1838.576) (-1838.288) * (-1840.119) [-1839.977] (-1832.225) (-1840.760) -- 0:02:05
      461000 -- (-1832.727) [-1833.644] (-1834.564) (-1840.332) * (-1831.773) (-1838.073) [-1835.537] (-1836.214) -- 0:02:05
      461500 -- (-1834.821) (-1838.713) [-1837.051] (-1843.718) * (-1836.748) (-1840.010) (-1837.031) [-1834.014] -- 0:02:04
      462000 -- (-1843.207) (-1843.456) (-1838.004) [-1840.326] * (-1846.200) (-1838.922) (-1846.675) [-1831.793] -- 0:02:05
      462500 -- [-1836.192] (-1842.600) (-1838.153) (-1837.872) * (-1841.487) (-1841.089) (-1837.977) [-1836.378] -- 0:02:05
      463000 -- (-1832.024) (-1834.863) [-1839.791] (-1839.552) * (-1838.992) [-1838.309] (-1836.422) (-1830.272) -- 0:02:05
      463500 -- (-1834.730) [-1836.378] (-1835.539) (-1835.562) * (-1838.543) (-1841.597) (-1837.539) [-1837.994] -- 0:02:05
      464000 -- [-1836.919] (-1836.459) (-1834.661) (-1837.843) * [-1831.693] (-1847.316) (-1836.546) (-1836.724) -- 0:02:04
      464500 -- [-1833.439] (-1835.425) (-1835.834) (-1838.143) * [-1837.025] (-1843.698) (-1835.612) (-1840.696) -- 0:02:04
      465000 -- (-1832.118) [-1834.379] (-1832.963) (-1845.393) * (-1838.040) (-1843.673) [-1833.760] (-1832.187) -- 0:02:04

      Average standard deviation of split frequencies: 0.000000

      465500 -- (-1842.436) (-1840.688) (-1835.993) [-1842.379] * (-1835.793) (-1851.138) [-1835.186] (-1833.623) -- 0:02:04
      466000 -- (-1838.194) (-1833.675) [-1836.097] (-1829.228) * (-1836.128) (-1840.313) [-1837.474] (-1831.583) -- 0:02:03
      466500 -- (-1845.041) [-1835.487] (-1832.825) (-1837.349) * (-1836.242) [-1841.029] (-1834.322) (-1838.866) -- 0:02:04
      467000 -- [-1831.348] (-1833.721) (-1831.827) (-1834.085) * (-1835.217) (-1839.354) (-1843.776) [-1835.337] -- 0:02:04
      467500 -- (-1835.173) [-1837.088] (-1837.374) (-1834.555) * [-1835.964] (-1841.351) (-1840.198) (-1833.720) -- 0:02:04
      468000 -- (-1835.895) [-1838.075] (-1836.897) (-1835.206) * (-1837.700) (-1845.599) [-1840.311] (-1837.620) -- 0:02:03
      468500 -- [-1833.427] (-1840.416) (-1835.823) (-1835.605) * (-1837.758) [-1840.596] (-1842.238) (-1836.390) -- 0:02:03
      469000 -- [-1833.218] (-1835.389) (-1833.963) (-1833.489) * (-1836.643) (-1837.713) [-1837.375] (-1836.215) -- 0:02:03
      469500 -- (-1832.474) (-1833.492) [-1830.433] (-1844.295) * (-1828.725) [-1837.234] (-1832.958) (-1835.863) -- 0:02:03
      470000 -- [-1830.860] (-1837.727) (-1832.931) (-1837.640) * (-1833.500) [-1836.646] (-1833.311) (-1840.350) -- 0:02:02

      Average standard deviation of split frequencies: 0.000000

      470500 -- (-1835.672) (-1840.022) [-1831.738] (-1835.383) * (-1831.643) (-1840.026) (-1842.269) [-1838.248] -- 0:02:03
      471000 -- (-1832.927) (-1830.449) [-1840.743] (-1839.628) * (-1834.168) (-1836.822) [-1832.753] (-1838.449) -- 0:02:03
      471500 -- (-1835.387) (-1830.844) [-1834.097] (-1832.002) * (-1838.354) [-1840.614] (-1834.001) (-1839.599) -- 0:02:03
      472000 -- (-1838.239) (-1830.218) [-1837.844] (-1832.661) * (-1835.271) (-1838.315) [-1833.100] (-1832.910) -- 0:02:03
      472500 -- [-1838.360] (-1838.988) (-1836.154) (-1849.168) * (-1834.640) (-1840.911) [-1836.719] (-1835.967) -- 0:02:02
      473000 -- (-1832.622) (-1835.740) (-1832.781) [-1834.411] * (-1835.540) (-1836.724) (-1838.147) [-1839.110] -- 0:02:02
      473500 -- (-1840.246) [-1835.791] (-1838.325) (-1836.636) * [-1838.647] (-1838.500) (-1838.292) (-1841.309) -- 0:02:02
      474000 -- (-1839.616) (-1834.701) [-1836.858] (-1842.900) * [-1835.870] (-1842.934) (-1830.707) (-1849.468) -- 0:02:02
      474500 -- (-1839.062) [-1836.206] (-1840.392) (-1834.143) * [-1833.036] (-1849.671) (-1841.973) (-1835.643) -- 0:02:01
      475000 -- (-1835.540) (-1840.198) (-1833.195) [-1834.525] * (-1836.298) (-1841.503) [-1837.918] (-1837.292) -- 0:02:02

      Average standard deviation of split frequencies: 0.000000

      475500 -- (-1833.379) [-1832.943] (-1839.746) (-1832.029) * (-1833.267) [-1833.859] (-1839.577) (-1837.730) -- 0:02:02
      476000 -- (-1838.790) [-1832.302] (-1835.648) (-1834.084) * (-1836.672) [-1832.218] (-1839.805) (-1831.420) -- 0:02:02
      476500 -- (-1832.684) (-1831.891) (-1848.810) [-1836.899] * [-1841.039] (-1828.999) (-1844.240) (-1835.867) -- 0:02:01
      477000 -- (-1839.738) (-1832.580) (-1849.066) [-1835.291] * [-1834.503] (-1834.517) (-1835.887) (-1836.248) -- 0:02:01
      477500 -- (-1839.991) (-1833.271) [-1835.341] (-1841.287) * (-1836.236) [-1833.621] (-1836.134) (-1840.475) -- 0:02:01
      478000 -- (-1844.308) [-1831.890] (-1833.138) (-1839.334) * (-1837.915) (-1840.286) (-1829.943) [-1837.182] -- 0:02:01
      478500 -- (-1834.294) [-1838.125] (-1832.830) (-1837.036) * (-1831.240) (-1836.393) [-1833.035] (-1838.194) -- 0:02:00
      479000 -- [-1838.130] (-1832.295) (-1835.698) (-1837.138) * (-1836.557) (-1840.269) (-1837.050) [-1836.888] -- 0:02:01
      479500 -- (-1834.708) (-1831.908) (-1834.998) [-1834.730] * [-1837.911] (-1840.574) (-1838.595) (-1832.751) -- 0:02:01
      480000 -- [-1835.865] (-1838.671) (-1834.254) (-1842.210) * (-1844.435) (-1836.041) [-1832.332] (-1839.580) -- 0:02:01

      Average standard deviation of split frequencies: 0.000000

      480500 -- (-1840.610) (-1836.395) [-1831.734] (-1836.779) * (-1838.188) (-1836.662) (-1835.298) [-1833.829] -- 0:02:01
      481000 -- (-1842.072) (-1837.560) [-1830.325] (-1841.385) * (-1836.371) (-1839.062) (-1838.821) [-1841.184] -- 0:02:00
      481500 -- (-1838.870) (-1836.475) (-1840.471) [-1834.564] * (-1830.108) (-1834.894) (-1846.022) [-1836.076] -- 0:02:00
      482000 -- (-1840.133) (-1838.697) [-1839.809] (-1838.420) * (-1833.861) (-1833.335) (-1833.587) [-1840.834] -- 0:02:00
      482500 -- (-1837.934) (-1838.724) [-1840.202] (-1830.833) * (-1837.451) (-1836.034) [-1838.283] (-1835.720) -- 0:02:00
      483000 -- (-1840.337) (-1841.762) [-1838.278] (-1840.052) * (-1851.705) [-1835.961] (-1840.342) (-1835.074) -- 0:01:59
      483500 -- (-1839.445) (-1830.885) [-1838.196] (-1843.699) * [-1838.788] (-1842.964) (-1839.771) (-1842.287) -- 0:02:00
      484000 -- (-1834.389) (-1835.959) [-1831.947] (-1839.379) * [-1834.329] (-1837.035) (-1838.657) (-1841.269) -- 0:02:00
      484500 -- (-1832.711) (-1835.740) (-1836.680) [-1834.465] * [-1829.758] (-1835.257) (-1837.015) (-1835.433) -- 0:02:00
      485000 -- [-1841.528] (-1840.169) (-1838.821) (-1837.989) * (-1835.105) (-1835.844) (-1837.185) [-1836.091] -- 0:01:59

      Average standard deviation of split frequencies: 0.000000

      485500 -- [-1832.863] (-1834.867) (-1836.101) (-1834.456) * (-1835.508) (-1839.238) [-1831.889] (-1837.371) -- 0:01:59
      486000 -- (-1834.046) [-1837.428] (-1836.317) (-1837.821) * (-1834.396) (-1836.077) [-1837.382] (-1835.535) -- 0:01:59
      486500 -- (-1835.332) (-1847.321) [-1835.795] (-1830.030) * (-1838.663) (-1836.470) (-1834.963) [-1837.856] -- 0:01:59
      487000 -- (-1834.655) [-1834.897] (-1843.533) (-1841.569) * [-1839.802] (-1834.804) (-1833.136) (-1832.817) -- 0:01:59
      487500 -- (-1841.833) (-1833.040) [-1833.809] (-1845.882) * (-1832.830) [-1834.049] (-1838.011) (-1832.059) -- 0:01:58
      488000 -- (-1834.019) (-1832.166) (-1846.918) [-1838.324] * (-1842.682) [-1829.504] (-1832.828) (-1835.098) -- 0:01:59
      488500 -- [-1832.579] (-1842.871) (-1843.382) (-1840.626) * (-1834.014) (-1835.195) (-1831.849) [-1833.065] -- 0:01:59
      489000 -- [-1832.539] (-1846.792) (-1841.482) (-1840.838) * (-1835.611) (-1840.845) (-1833.747) [-1833.753] -- 0:01:59
      489500 -- [-1836.944] (-1841.038) (-1840.492) (-1836.319) * (-1837.349) [-1833.584] (-1838.627) (-1834.083) -- 0:01:58
      490000 -- (-1833.573) (-1840.888) (-1837.503) [-1834.454] * (-1839.724) (-1830.356) [-1833.757] (-1834.941) -- 0:01:58

      Average standard deviation of split frequencies: 0.000000

      490500 -- (-1839.782) [-1837.262] (-1838.988) (-1842.366) * (-1838.400) (-1834.313) (-1836.755) [-1833.964] -- 0:01:58
      491000 -- (-1847.676) [-1831.724] (-1844.584) (-1838.428) * [-1843.008] (-1833.725) (-1836.308) (-1834.462) -- 0:01:58
      491500 -- [-1834.412] (-1835.446) (-1832.393) (-1837.397) * (-1838.945) (-1834.135) (-1837.844) [-1837.632] -- 0:01:57
      492000 -- [-1832.693] (-1832.551) (-1838.034) (-1833.567) * (-1834.249) [-1836.525] (-1841.142) (-1834.644) -- 0:01:58
      492500 -- (-1841.907) (-1831.853) (-1834.303) [-1834.375] * (-1833.292) (-1837.849) (-1838.907) [-1834.085] -- 0:01:58
      493000 -- (-1833.638) (-1836.718) [-1840.270] (-1835.312) * [-1832.046] (-1836.371) (-1837.363) (-1837.928) -- 0:01:58
      493500 -- (-1833.781) [-1832.392] (-1841.522) (-1839.054) * [-1837.819] (-1836.495) (-1839.946) (-1843.305) -- 0:01:58
      494000 -- (-1835.011) [-1834.264] (-1838.068) (-1840.614) * [-1837.864] (-1850.735) (-1833.681) (-1836.828) -- 0:01:57
      494500 -- [-1839.371] (-1836.519) (-1834.723) (-1841.156) * (-1840.135) (-1838.349) (-1835.781) [-1836.343] -- 0:01:57
      495000 -- (-1839.304) (-1836.996) [-1837.140] (-1840.563) * (-1832.763) (-1839.888) [-1836.257] (-1837.811) -- 0:01:57

      Average standard deviation of split frequencies: 0.000000

      495500 -- (-1838.239) [-1833.251] (-1840.037) (-1835.916) * [-1832.884] (-1829.034) (-1841.994) (-1837.556) -- 0:01:57
      496000 -- (-1839.914) (-1836.538) (-1831.185) [-1832.093] * (-1839.879) [-1833.937] (-1846.402) (-1831.159) -- 0:01:56
      496500 -- (-1839.953) (-1838.778) (-1833.347) [-1837.028] * [-1828.032] (-1832.029) (-1842.893) (-1830.280) -- 0:01:57
      497000 -- (-1835.992) (-1836.544) (-1831.994) [-1832.069] * (-1837.892) [-1838.734] (-1842.035) (-1838.914) -- 0:01:57
      497500 -- (-1837.503) (-1838.886) (-1835.094) [-1839.797] * (-1834.241) (-1844.674) (-1837.114) [-1835.284] -- 0:01:57
      498000 -- (-1837.229) (-1842.106) [-1834.472] (-1838.771) * [-1835.676] (-1841.635) (-1837.811) (-1836.937) -- 0:01:56
      498500 -- (-1837.606) [-1834.303] (-1841.323) (-1839.965) * [-1836.287] (-1845.955) (-1837.565) (-1839.668) -- 0:01:56
      499000 -- [-1832.955] (-1831.472) (-1838.942) (-1842.588) * (-1834.682) [-1833.343] (-1840.906) (-1841.731) -- 0:01:56
      499500 -- (-1838.473) (-1831.841) [-1834.260] (-1835.200) * (-1832.009) (-1837.674) [-1838.520] (-1836.014) -- 0:01:56
      500000 -- [-1834.711] (-1833.328) (-1831.667) (-1839.868) * (-1833.147) (-1834.522) (-1833.096) [-1832.496] -- 0:01:56

      Average standard deviation of split frequencies: 0.000000

      500500 -- (-1840.775) (-1835.332) [-1837.466] (-1836.701) * (-1834.935) (-1837.312) (-1833.823) [-1834.061] -- 0:01:55
      501000 -- (-1834.554) (-1833.556) [-1837.127] (-1834.689) * (-1833.918) (-1837.289) [-1832.237] (-1838.617) -- 0:01:56
      501500 -- (-1841.459) (-1841.436) [-1833.036] (-1831.402) * (-1835.309) (-1836.976) (-1837.594) [-1836.127] -- 0:01:56
      502000 -- (-1836.662) [-1832.849] (-1834.525) (-1840.881) * (-1839.379) (-1838.224) (-1835.801) [-1840.236] -- 0:01:56
      502500 -- (-1839.383) (-1838.698) [-1836.540] (-1839.143) * [-1837.986] (-1839.993) (-1836.825) (-1835.073) -- 0:01:55
      503000 -- [-1837.647] (-1835.659) (-1847.714) (-1836.067) * (-1847.563) (-1840.952) [-1836.821] (-1831.508) -- 0:01:55
      503500 -- (-1834.626) (-1837.953) (-1835.425) [-1833.981] * [-1837.654] (-1838.817) (-1831.527) (-1839.667) -- 0:01:55
      504000 -- (-1837.448) [-1833.990] (-1839.948) (-1840.878) * [-1832.545] (-1837.145) (-1835.595) (-1843.145) -- 0:01:55
      504500 -- (-1835.266) [-1834.240] (-1831.809) (-1836.293) * (-1839.632) (-1842.019) [-1835.458] (-1839.108) -- 0:01:54
      505000 -- (-1837.817) (-1832.174) (-1836.760) [-1831.567] * (-1834.771) (-1839.804) (-1833.992) [-1840.895] -- 0:01:55

      Average standard deviation of split frequencies: 0.000000

      505500 -- [-1829.324] (-1836.297) (-1832.683) (-1836.327) * (-1830.811) [-1836.937] (-1834.184) (-1838.211) -- 0:01:55
      506000 -- (-1830.814) [-1836.994] (-1835.164) (-1835.766) * [-1835.380] (-1837.581) (-1838.602) (-1837.134) -- 0:01:55
      506500 -- [-1838.929] (-1840.309) (-1846.624) (-1835.324) * (-1831.313) [-1829.751] (-1834.435) (-1831.088) -- 0:01:54
      507000 -- [-1834.304] (-1832.326) (-1836.900) (-1834.944) * (-1833.838) (-1835.038) [-1836.033] (-1831.383) -- 0:01:54
      507500 -- (-1832.303) (-1836.961) [-1841.476] (-1833.847) * (-1834.747) (-1836.593) [-1841.261] (-1843.968) -- 0:01:54
      508000 -- (-1830.651) [-1833.273] (-1843.464) (-1832.483) * (-1841.034) [-1839.954] (-1835.145) (-1839.051) -- 0:01:54
      508500 -- (-1833.345) (-1836.149) (-1836.246) [-1832.919] * (-1840.462) [-1833.251] (-1836.855) (-1834.064) -- 0:01:54
      509000 -- (-1835.301) (-1833.323) [-1835.733] (-1836.136) * (-1841.001) (-1840.453) (-1836.076) [-1831.339] -- 0:01:53
      509500 -- (-1835.891) (-1833.957) [-1837.578] (-1833.279) * [-1834.032] (-1841.430) (-1835.814) (-1833.889) -- 0:01:54
      510000 -- (-1838.836) [-1836.671] (-1844.490) (-1834.637) * [-1835.311] (-1833.134) (-1845.030) (-1832.995) -- 0:01:54

      Average standard deviation of split frequencies: 0.000000

      510500 -- [-1840.469] (-1837.384) (-1835.758) (-1837.176) * (-1831.844) (-1834.687) [-1829.919] (-1837.074) -- 0:01:54
      511000 -- (-1835.937) (-1839.744) [-1837.670] (-1840.460) * (-1837.162) (-1837.867) [-1836.497] (-1835.529) -- 0:01:53
      511500 -- (-1836.366) (-1838.979) [-1834.450] (-1834.260) * (-1834.179) (-1838.345) [-1835.536] (-1837.263) -- 0:01:53
      512000 -- (-1836.890) [-1840.559] (-1834.984) (-1837.186) * [-1831.595] (-1831.690) (-1838.481) (-1831.958) -- 0:01:53
      512500 -- [-1833.395] (-1839.532) (-1834.072) (-1834.592) * (-1838.799) (-1830.531) (-1840.047) [-1829.062] -- 0:01:53
      513000 -- [-1834.020] (-1838.948) (-1835.698) (-1837.798) * (-1837.853) (-1835.985) (-1835.820) [-1833.565] -- 0:01:52
      513500 -- (-1840.200) [-1837.402] (-1836.568) (-1833.429) * (-1832.073) (-1834.549) [-1831.187] (-1834.531) -- 0:01:52
      514000 -- (-1840.569) (-1837.910) [-1837.122] (-1840.694) * (-1835.252) (-1831.327) [-1830.968] (-1837.322) -- 0:01:53
      514500 -- (-1836.383) [-1837.932] (-1846.727) (-1835.309) * (-1834.033) (-1831.700) [-1836.796] (-1834.602) -- 0:01:53
      515000 -- (-1841.661) (-1835.662) (-1836.921) [-1837.425] * (-1832.926) (-1839.118) (-1843.858) [-1833.099] -- 0:01:53

      Average standard deviation of split frequencies: 0.000000

      515500 -- (-1839.121) (-1836.533) [-1838.442] (-1840.059) * [-1842.900] (-1835.262) (-1838.452) (-1836.713) -- 0:01:52
      516000 -- [-1837.707] (-1834.103) (-1845.319) (-1846.215) * [-1831.675] (-1837.577) (-1837.780) (-1833.577) -- 0:01:52
      516500 -- (-1831.964) (-1838.566) [-1838.295] (-1842.182) * (-1838.015) (-1836.515) (-1837.137) [-1830.297] -- 0:01:52
      517000 -- (-1829.667) (-1836.118) (-1833.280) [-1837.556] * [-1836.726] (-1836.194) (-1833.580) (-1833.790) -- 0:01:52
      517500 -- (-1838.925) (-1843.838) (-1843.285) [-1833.659] * (-1835.222) (-1835.605) (-1835.579) [-1830.972] -- 0:01:51
      518000 -- (-1840.360) (-1835.028) (-1833.482) [-1831.752] * (-1835.276) (-1832.481) (-1832.015) [-1832.263] -- 0:01:52
      518500 -- (-1836.305) (-1838.432) (-1836.188) [-1835.456] * (-1839.313) (-1835.267) [-1838.335] (-1837.979) -- 0:01:52
      519000 -- (-1833.460) [-1835.528] (-1833.747) (-1835.521) * (-1833.615) [-1839.798] (-1838.182) (-1844.995) -- 0:01:52
      519500 -- (-1834.924) [-1832.312] (-1836.201) (-1835.060) * (-1830.517) (-1838.841) [-1832.990] (-1832.950) -- 0:01:51
      520000 -- (-1837.282) (-1840.696) (-1835.981) [-1831.438] * [-1833.860] (-1832.987) (-1847.186) (-1836.441) -- 0:01:51

      Average standard deviation of split frequencies: 0.000000

      520500 -- (-1834.698) [-1849.771] (-1840.030) (-1836.629) * (-1833.997) (-1833.240) (-1837.148) [-1835.674] -- 0:01:51
      521000 -- [-1834.338] (-1840.718) (-1839.792) (-1835.470) * [-1833.733] (-1834.082) (-1838.300) (-1833.699) -- 0:01:51
      521500 -- (-1832.271) (-1833.362) (-1843.062) [-1832.494] * (-1834.902) [-1833.918] (-1843.352) (-1834.608) -- 0:01:51
      522000 -- (-1837.848) (-1838.000) [-1841.143] (-1836.635) * [-1836.539] (-1836.201) (-1836.917) (-1837.390) -- 0:01:50
      522500 -- (-1831.175) (-1833.529) [-1834.185] (-1837.801) * (-1834.868) [-1834.806] (-1838.984) (-1839.584) -- 0:01:51
      523000 -- (-1834.633) (-1836.474) (-1845.036) [-1838.373] * (-1837.860) (-1832.097) [-1840.200] (-1837.728) -- 0:01:51
      523500 -- (-1838.972) (-1838.857) (-1841.443) [-1835.670] * (-1840.272) [-1839.524] (-1851.246) (-1833.018) -- 0:01:51
      524000 -- (-1832.338) (-1835.538) [-1835.400] (-1831.280) * (-1836.587) (-1836.018) (-1838.726) [-1835.859] -- 0:01:50
      524500 -- (-1835.320) [-1834.999] (-1841.710) (-1834.121) * (-1835.775) [-1834.039] (-1832.318) (-1833.468) -- 0:01:50
      525000 -- [-1833.027] (-1836.198) (-1837.925) (-1836.391) * (-1832.665) [-1836.220] (-1837.153) (-1834.613) -- 0:01:50

      Average standard deviation of split frequencies: 0.000000

      525500 -- [-1832.637] (-1843.072) (-1835.392) (-1833.883) * (-1833.096) (-1833.460) (-1833.599) [-1834.888] -- 0:01:50
      526000 -- [-1828.151] (-1839.256) (-1839.357) (-1833.030) * (-1835.364) (-1833.964) (-1831.356) [-1838.480] -- 0:01:49
      526500 -- (-1834.608) (-1841.803) [-1828.239] (-1841.315) * (-1834.131) [-1841.539] (-1829.500) (-1832.376) -- 0:01:49
      527000 -- (-1834.802) (-1843.540) [-1837.574] (-1839.466) * (-1834.879) [-1839.508] (-1829.674) (-1830.941) -- 0:01:50
      527500 -- (-1833.754) (-1841.930) (-1839.087) [-1834.665] * (-1836.405) (-1836.023) [-1834.554] (-1833.620) -- 0:01:50
      528000 -- (-1840.085) (-1840.707) [-1837.796] (-1833.114) * [-1831.753] (-1839.434) (-1839.487) (-1833.783) -- 0:01:49
      528500 -- [-1839.069] (-1837.905) (-1840.607) (-1839.028) * (-1838.818) (-1842.680) (-1836.739) [-1832.795] -- 0:01:49
      529000 -- [-1838.135] (-1838.718) (-1842.787) (-1838.352) * [-1841.952] (-1833.343) (-1836.048) (-1839.016) -- 0:01:49
      529500 -- (-1838.040) [-1835.431] (-1837.904) (-1834.900) * [-1838.954] (-1837.477) (-1835.460) (-1840.758) -- 0:01:49
      530000 -- [-1835.869] (-1832.137) (-1831.997) (-1834.102) * (-1839.828) [-1836.616] (-1834.336) (-1839.786) -- 0:01:49

      Average standard deviation of split frequencies: 0.000000

      530500 -- (-1830.970) (-1837.045) (-1835.980) [-1831.784] * (-1837.834) (-1839.177) (-1836.134) [-1836.287] -- 0:01:48
      531000 -- (-1839.482) (-1834.209) [-1834.095] (-1834.811) * (-1834.816) (-1842.086) [-1837.521] (-1832.054) -- 0:01:49
      531500 -- [-1838.438] (-1834.768) (-1836.744) (-1837.552) * (-1834.655) (-1847.472) [-1833.616] (-1837.452) -- 0:01:49
      532000 -- (-1839.689) (-1834.715) [-1836.070] (-1835.868) * [-1834.806] (-1833.247) (-1834.764) (-1839.943) -- 0:01:49
      532500 -- (-1847.530) [-1836.498] (-1841.578) (-1838.771) * (-1842.244) [-1835.626] (-1831.577) (-1834.003) -- 0:01:48
      533000 -- (-1833.616) [-1835.207] (-1836.398) (-1836.168) * (-1842.460) [-1833.439] (-1839.437) (-1840.758) -- 0:01:48
      533500 -- (-1835.147) (-1834.295) (-1840.187) [-1838.045] * (-1836.421) [-1832.293] (-1836.201) (-1837.512) -- 0:01:48
      534000 -- (-1831.758) [-1837.496] (-1836.066) (-1836.375) * (-1844.809) (-1835.376) [-1839.653] (-1840.019) -- 0:01:48
      534500 -- (-1832.367) (-1833.447) [-1836.595] (-1831.490) * (-1845.675) [-1835.531] (-1837.702) (-1841.448) -- 0:01:47
      535000 -- (-1837.418) (-1832.294) (-1840.445) [-1837.090] * (-1838.793) (-1835.176) (-1839.606) [-1834.548] -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      535500 -- [-1833.575] (-1832.341) (-1830.554) (-1839.824) * (-1840.461) (-1849.613) [-1841.057] (-1837.404) -- 0:01:48
      536000 -- (-1838.735) (-1833.930) (-1829.791) [-1833.702] * (-1837.586) [-1834.350] (-1846.379) (-1835.739) -- 0:01:48
      536500 -- (-1835.701) (-1833.399) (-1835.276) [-1834.052] * [-1837.803] (-1835.690) (-1840.629) (-1834.509) -- 0:01:47
      537000 -- (-1838.282) [-1838.741] (-1834.333) (-1842.264) * (-1834.864) (-1836.873) (-1840.067) [-1834.111] -- 0:01:47
      537500 -- (-1835.960) (-1842.375) [-1832.854] (-1839.570) * [-1833.650] (-1835.567) (-1834.566) (-1841.579) -- 0:01:47
      538000 -- [-1838.574] (-1843.016) (-1835.528) (-1841.397) * (-1830.130) [-1832.908] (-1833.555) (-1842.395) -- 0:01:47
      538500 -- (-1839.015) (-1834.337) [-1835.682] (-1840.768) * (-1832.823) [-1837.064] (-1836.389) (-1838.960) -- 0:01:47
      539000 -- (-1837.019) [-1840.546] (-1840.311) (-1834.103) * (-1842.257) (-1838.669) (-1835.853) [-1835.726] -- 0:01:46
      539500 -- [-1832.367] (-1837.465) (-1834.808) (-1833.617) * (-1835.359) (-1838.985) [-1833.960] (-1846.752) -- 0:01:46
      540000 -- (-1835.709) (-1831.775) [-1835.144] (-1835.682) * (-1838.774) (-1833.331) (-1835.356) [-1835.487] -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      540500 -- [-1834.311] (-1831.707) (-1834.475) (-1841.520) * (-1832.761) [-1836.034] (-1841.340) (-1836.989) -- 0:01:47
      541000 -- (-1838.737) [-1832.610] (-1832.905) (-1847.706) * [-1840.094] (-1840.246) (-1839.962) (-1839.280) -- 0:01:46
      541500 -- (-1836.412) [-1834.192] (-1835.956) (-1845.508) * (-1834.354) (-1837.997) [-1831.242] (-1836.574) -- 0:01:46
      542000 -- (-1833.835) (-1837.089) [-1834.001] (-1846.849) * (-1839.291) (-1835.777) [-1832.481] (-1843.246) -- 0:01:46
      542500 -- [-1835.538] (-1831.322) (-1836.686) (-1839.105) * (-1838.261) (-1838.311) (-1830.765) [-1842.744] -- 0:01:46
      543000 -- (-1842.519) [-1838.886] (-1840.413) (-1840.722) * (-1834.509) (-1831.815) (-1833.489) [-1835.305] -- 0:01:46
      543500 -- (-1835.188) [-1845.841] (-1836.901) (-1845.583) * (-1840.967) [-1832.687] (-1836.136) (-1836.662) -- 0:01:45
      544000 -- [-1833.172] (-1832.078) (-1837.494) (-1838.398) * (-1838.996) (-1832.802) [-1832.785] (-1836.273) -- 0:01:46
      544500 -- (-1834.115) (-1839.325) (-1836.866) [-1839.935] * [-1834.476] (-1831.876) (-1836.884) (-1841.382) -- 0:01:46
      545000 -- (-1842.330) [-1837.503] (-1843.703) (-1835.270) * (-1839.240) (-1838.512) [-1840.219] (-1838.922) -- 0:01:46

      Average standard deviation of split frequencies: 0.000000

      545500 -- (-1841.011) (-1836.585) [-1834.467] (-1836.460) * (-1838.735) (-1839.414) [-1834.958] (-1835.729) -- 0:01:45
      546000 -- (-1830.755) [-1834.442] (-1836.942) (-1841.142) * [-1834.932] (-1833.557) (-1840.931) (-1836.392) -- 0:01:45
      546500 -- (-1842.123) (-1835.076) [-1832.818] (-1842.986) * [-1836.490] (-1835.706) (-1841.031) (-1838.104) -- 0:01:45
      547000 -- (-1839.479) [-1834.264] (-1840.151) (-1843.453) * (-1836.484) (-1844.122) [-1844.044] (-1842.891) -- 0:01:45
      547500 -- (-1831.461) (-1836.706) [-1835.838] (-1837.724) * (-1839.754) [-1837.285] (-1846.168) (-1848.174) -- 0:01:44
      548000 -- (-1840.131) (-1834.727) [-1835.597] (-1838.372) * (-1839.273) [-1833.408] (-1835.157) (-1842.931) -- 0:01:44
      548500 -- [-1841.114] (-1841.164) (-1835.336) (-1847.205) * (-1842.574) (-1832.896) [-1833.198] (-1838.348) -- 0:01:45
      549000 -- (-1832.906) (-1839.367) [-1833.745] (-1837.841) * (-1842.642) (-1833.849) [-1832.439] (-1833.951) -- 0:01:45
      549500 -- [-1836.233] (-1841.220) (-1837.427) (-1837.305) * (-1844.141) (-1835.679) (-1833.556) [-1837.453] -- 0:01:44
      550000 -- (-1838.396) (-1831.072) [-1831.544] (-1838.759) * (-1836.970) (-1833.268) [-1834.963] (-1830.556) -- 0:01:44

      Average standard deviation of split frequencies: 0.000000

      550500 -- (-1838.376) (-1831.120) [-1831.823] (-1839.125) * (-1839.229) (-1831.043) (-1839.942) [-1835.565] -- 0:01:44
      551000 -- (-1841.816) [-1833.332] (-1837.611) (-1855.301) * (-1836.964) (-1837.766) (-1839.266) [-1835.887] -- 0:01:44
      551500 -- (-1835.771) [-1840.170] (-1831.544) (-1841.361) * (-1838.134) [-1834.527] (-1836.737) (-1836.306) -- 0:01:44
      552000 -- (-1837.476) [-1835.891] (-1838.862) (-1840.693) * (-1835.188) (-1835.978) [-1834.037] (-1834.082) -- 0:01:43
      552500 -- [-1832.002] (-1838.337) (-1838.312) (-1841.233) * (-1844.918) [-1839.062] (-1834.423) (-1837.144) -- 0:01:43
      553000 -- (-1838.848) (-1837.127) (-1834.822) [-1837.211] * (-1840.612) (-1838.200) (-1831.168) [-1831.324] -- 0:01:44
      553500 -- (-1837.288) (-1834.141) (-1834.972) [-1834.351] * (-1838.346) [-1838.121] (-1837.236) (-1836.775) -- 0:01:44
      554000 -- (-1833.609) (-1835.017) [-1843.243] (-1830.369) * [-1842.825] (-1842.358) (-1837.496) (-1832.244) -- 0:01:43
      554500 -- (-1843.964) (-1833.521) (-1841.514) [-1837.672] * (-1835.656) (-1834.073) (-1831.444) [-1831.924] -- 0:01:43
      555000 -- [-1836.297] (-1841.714) (-1841.169) (-1839.531) * (-1836.297) (-1838.408) [-1833.652] (-1837.482) -- 0:01:43

      Average standard deviation of split frequencies: 0.000000

      555500 -- (-1846.324) [-1843.277] (-1834.985) (-1840.445) * (-1837.543) [-1841.028] (-1836.112) (-1837.107) -- 0:01:43
      556000 -- (-1836.269) (-1833.722) (-1836.815) [-1835.225] * [-1839.319] (-1835.150) (-1853.605) (-1836.705) -- 0:01:43
      556500 -- (-1843.691) [-1836.700] (-1835.970) (-1839.981) * [-1834.820] (-1840.021) (-1840.539) (-1834.251) -- 0:01:42
      557000 -- (-1846.215) (-1833.232) [-1835.159] (-1834.801) * (-1840.271) (-1841.755) [-1836.811] (-1842.378) -- 0:01:43
      557500 -- (-1835.915) (-1833.506) [-1834.551] (-1832.940) * [-1833.183] (-1836.880) (-1834.863) (-1836.875) -- 0:01:43
      558000 -- (-1840.134) [-1848.260] (-1836.578) (-1840.437) * (-1837.528) [-1834.276] (-1834.218) (-1839.965) -- 0:01:42
      558500 -- (-1846.386) (-1836.737) [-1831.170] (-1834.707) * (-1839.382) (-1832.164) (-1836.201) [-1833.870] -- 0:01:42
      559000 -- (-1833.302) (-1839.060) [-1832.680] (-1831.810) * (-1832.985) (-1839.716) (-1834.482) [-1836.877] -- 0:01:42
      559500 -- (-1835.574) [-1834.170] (-1831.410) (-1833.741) * (-1838.430) [-1837.439] (-1839.087) (-1837.255) -- 0:01:42
      560000 -- (-1839.013) (-1836.149) (-1835.241) [-1833.030] * (-1839.969) (-1838.930) (-1831.479) [-1831.245] -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      560500 -- (-1841.524) (-1829.332) [-1830.426] (-1844.067) * [-1833.827] (-1834.051) (-1838.738) (-1831.553) -- 0:01:41
      561000 -- [-1833.438] (-1840.341) (-1842.386) (-1833.720) * (-1837.716) [-1836.254] (-1839.450) (-1837.902) -- 0:01:41
      561500 -- [-1831.331] (-1839.423) (-1836.195) (-1832.625) * (-1830.450) (-1836.280) [-1843.964] (-1834.963) -- 0:01:42
      562000 -- (-1833.697) (-1840.206) [-1836.603] (-1833.879) * (-1840.308) [-1835.762] (-1840.526) (-1832.496) -- 0:01:42
      562500 -- (-1832.999) [-1835.307] (-1835.760) (-1834.201) * [-1833.298] (-1841.952) (-1838.383) (-1833.110) -- 0:01:41
      563000 -- (-1837.034) (-1837.505) [-1837.514] (-1840.702) * [-1836.348] (-1836.723) (-1837.786) (-1835.806) -- 0:01:41
      563500 -- (-1838.114) (-1834.517) (-1836.829) [-1838.126] * (-1833.750) [-1834.498] (-1841.781) (-1835.929) -- 0:01:41
      564000 -- (-1839.180) (-1837.469) (-1841.097) [-1839.361] * [-1831.143] (-1835.467) (-1838.435) (-1840.220) -- 0:01:41
      564500 -- (-1842.952) (-1835.393) (-1840.413) [-1837.130] * (-1830.742) [-1837.606] (-1833.878) (-1832.471) -- 0:01:41
      565000 -- (-1844.430) (-1836.762) (-1833.659) [-1833.706] * (-1836.460) (-1831.682) (-1841.974) [-1841.197] -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      565500 -- (-1837.386) [-1837.322] (-1834.899) (-1839.937) * (-1835.966) [-1834.561] (-1835.584) (-1837.263) -- 0:01:40
      566000 -- (-1833.570) (-1835.151) (-1840.588) [-1834.209] * (-1836.239) (-1832.486) (-1839.676) [-1835.651] -- 0:01:41
      566500 -- (-1838.581) (-1839.384) (-1837.200) [-1834.260] * [-1835.718] (-1835.678) (-1835.186) (-1837.023) -- 0:01:41
      567000 -- (-1833.679) (-1837.780) [-1834.157] (-1834.024) * (-1839.553) [-1832.153] (-1844.020) (-1836.939) -- 0:01:40
      567500 -- [-1830.145] (-1842.442) (-1834.562) (-1835.385) * (-1835.613) (-1832.931) (-1831.441) [-1833.847] -- 0:01:40
      568000 -- (-1836.493) (-1840.740) (-1831.835) [-1831.712] * (-1832.382) [-1840.832] (-1834.762) (-1830.352) -- 0:01:40
      568500 -- [-1834.787] (-1833.746) (-1832.223) (-1831.890) * (-1834.719) (-1839.499) [-1838.273] (-1836.306) -- 0:01:40
      569000 -- (-1832.357) [-1833.324] (-1836.850) (-1835.127) * (-1839.889) (-1837.528) (-1837.051) [-1830.768] -- 0:01:39
      569500 -- (-1835.539) [-1836.215] (-1836.925) (-1844.113) * (-1847.073) (-1836.527) [-1835.734] (-1835.006) -- 0:01:39
      570000 -- (-1831.512) [-1835.398] (-1834.011) (-1839.351) * (-1843.831) (-1835.418) [-1837.322] (-1834.415) -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      570500 -- [-1836.036] (-1838.313) (-1840.802) (-1835.076) * [-1836.434] (-1839.099) (-1833.820) (-1838.041) -- 0:01:40
      571000 -- [-1836.990] (-1846.980) (-1837.150) (-1832.557) * (-1833.123) [-1835.540] (-1834.851) (-1832.973) -- 0:01:39
      571500 -- (-1833.474) (-1842.444) (-1842.433) [-1834.647] * (-1831.793) (-1837.406) [-1837.312] (-1833.842) -- 0:01:39
      572000 -- [-1834.563] (-1836.039) (-1835.610) (-1838.780) * (-1836.111) (-1834.471) (-1837.379) [-1837.725] -- 0:01:39
      572500 -- (-1834.401) [-1832.307] (-1834.645) (-1831.803) * (-1834.018) (-1837.325) (-1836.659) [-1838.047] -- 0:01:39
      573000 -- [-1836.707] (-1840.162) (-1837.893) (-1838.172) * [-1832.202] (-1837.019) (-1834.119) (-1832.903) -- 0:01:39
      573500 -- (-1838.098) (-1837.205) [-1837.188] (-1838.637) * (-1836.111) [-1837.026] (-1841.189) (-1836.792) -- 0:01:38
      574000 -- [-1832.032] (-1847.798) (-1839.935) (-1835.560) * [-1831.945] (-1832.120) (-1829.913) (-1841.155) -- 0:01:38
      574500 -- (-1833.792) [-1835.412] (-1838.610) (-1839.941) * [-1833.932] (-1831.659) (-1841.478) (-1841.181) -- 0:01:39
      575000 -- (-1831.353) (-1838.755) (-1838.285) [-1834.075] * [-1835.456] (-1834.063) (-1839.353) (-1841.711) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      575500 -- (-1835.616) [-1840.468] (-1836.008) (-1830.427) * (-1835.285) [-1836.688] (-1833.071) (-1838.857) -- 0:01:38
      576000 -- (-1837.517) (-1839.621) (-1838.931) [-1834.822] * [-1834.830] (-1838.358) (-1834.301) (-1837.796) -- 0:01:38
      576500 -- (-1839.323) (-1842.531) (-1842.651) [-1834.942] * (-1833.811) (-1834.566) [-1838.360] (-1842.355) -- 0:01:38
      577000 -- (-1842.976) [-1836.051] (-1843.696) (-1838.087) * (-1842.757) (-1833.738) (-1838.301) [-1838.043] -- 0:01:38
      577500 -- (-1832.177) (-1836.571) (-1854.581) [-1837.501] * [-1840.622] (-1837.089) (-1835.189) (-1835.936) -- 0:01:38
      578000 -- [-1836.920] (-1839.597) (-1834.070) (-1833.875) * [-1832.293] (-1834.666) (-1834.706) (-1840.389) -- 0:01:37
      578500 -- (-1834.936) (-1839.789) (-1837.533) [-1831.336] * (-1840.194) [-1836.394] (-1842.454) (-1834.397) -- 0:01:38
      579000 -- (-1838.896) [-1835.141] (-1836.021) (-1836.298) * [-1832.853] (-1836.919) (-1835.387) (-1837.186) -- 0:01:38
      579500 -- (-1836.304) [-1831.813] (-1839.977) (-1835.976) * (-1837.985) (-1839.013) [-1832.665] (-1839.436) -- 0:01:37
      580000 -- (-1842.838) (-1835.751) (-1838.468) [-1833.610] * [-1835.426] (-1835.389) (-1832.800) (-1837.885) -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      580500 -- (-1833.317) (-1837.710) [-1837.825] (-1829.082) * (-1837.658) [-1839.376] (-1832.022) (-1839.735) -- 0:01:37
      581000 -- (-1835.331) (-1837.414) [-1840.417] (-1839.927) * (-1841.290) (-1834.976) (-1831.021) [-1834.383] -- 0:01:37
      581500 -- [-1837.478] (-1835.307) (-1836.006) (-1840.644) * (-1838.254) (-1836.913) [-1832.167] (-1834.689) -- 0:01:37
      582000 -- (-1835.612) (-1837.431) (-1836.567) [-1835.166] * [-1839.673] (-1828.880) (-1833.146) (-1833.317) -- 0:01:36
      582500 -- (-1837.167) (-1838.084) [-1836.673] (-1833.206) * [-1837.712] (-1833.260) (-1835.615) (-1832.400) -- 0:01:36
      583000 -- (-1835.009) (-1839.117) (-1834.904) [-1833.317] * (-1835.269) (-1837.079) (-1835.249) [-1835.289] -- 0:01:37
      583500 -- (-1839.064) (-1835.495) (-1836.045) [-1835.591] * (-1835.871) [-1835.695] (-1834.234) (-1834.640) -- 0:01:37
      584000 -- (-1837.799) (-1833.979) [-1833.851] (-1841.719) * (-1837.233) [-1832.057] (-1842.023) (-1840.221) -- 0:01:36
      584500 -- (-1835.920) (-1834.616) [-1837.541] (-1835.115) * (-1836.468) (-1844.081) (-1841.095) [-1836.517] -- 0:01:36
      585000 -- (-1841.031) [-1835.774] (-1834.543) (-1839.203) * (-1833.816) [-1833.707] (-1837.479) (-1838.978) -- 0:01:36

      Average standard deviation of split frequencies: 0.000000

      585500 -- (-1846.710) (-1830.484) (-1830.851) [-1838.767] * [-1838.112] (-1832.554) (-1836.099) (-1846.679) -- 0:01:36
      586000 -- (-1843.466) [-1836.438] (-1836.736) (-1833.808) * (-1834.434) (-1842.350) [-1837.826] (-1842.638) -- 0:01:36
      586500 -- (-1844.210) [-1836.717] (-1841.774) (-1841.696) * (-1834.304) (-1836.419) (-1836.685) [-1836.792] -- 0:01:35
      587000 -- (-1846.248) (-1830.984) (-1835.410) [-1840.375] * [-1830.879] (-1841.357) (-1837.658) (-1834.573) -- 0:01:35
      587500 -- (-1835.580) (-1831.019) (-1839.287) [-1836.116] * (-1832.702) (-1840.162) [-1833.650] (-1836.342) -- 0:01:36
      588000 -- (-1840.268) (-1832.282) [-1838.564] (-1830.751) * [-1833.069] (-1833.616) (-1835.876) (-1834.348) -- 0:01:35
      588500 -- (-1835.422) [-1836.817] (-1834.705) (-1839.866) * [-1836.245] (-1834.831) (-1841.892) (-1836.141) -- 0:01:35
      589000 -- (-1835.286) [-1840.933] (-1839.852) (-1834.754) * [-1835.312] (-1835.622) (-1835.475) (-1836.644) -- 0:01:35
      589500 -- (-1843.459) [-1834.711] (-1843.453) (-1835.627) * [-1837.983] (-1838.397) (-1831.817) (-1836.523) -- 0:01:35
      590000 -- (-1838.547) (-1837.433) [-1836.619] (-1836.718) * (-1834.598) (-1835.437) [-1843.307] (-1833.625) -- 0:01:35

      Average standard deviation of split frequencies: 0.000000

      590500 -- (-1838.684) [-1836.932] (-1845.006) (-1835.217) * [-1833.790] (-1849.984) (-1838.571) (-1835.874) -- 0:01:35
      591000 -- (-1838.041) (-1832.297) (-1840.099) [-1839.854] * (-1835.094) (-1841.880) [-1833.358] (-1833.732) -- 0:01:34
      591500 -- (-1840.326) [-1840.290] (-1836.031) (-1832.595) * (-1838.508) (-1840.813) [-1829.268] (-1833.365) -- 0:01:35
      592000 -- (-1838.881) (-1839.404) (-1836.189) [-1837.723] * [-1835.673] (-1844.330) (-1835.099) (-1840.142) -- 0:01:35
      592500 -- (-1844.918) [-1833.402] (-1836.292) (-1836.936) * (-1840.060) (-1842.458) (-1832.705) [-1833.326] -- 0:01:34
      593000 -- [-1838.679] (-1838.429) (-1850.856) (-1837.809) * (-1831.188) (-1838.345) (-1836.846) [-1837.318] -- 0:01:34
      593500 -- (-1836.008) (-1845.018) (-1846.586) [-1835.295] * [-1832.662] (-1835.782) (-1833.473) (-1838.010) -- 0:01:34
      594000 -- (-1829.803) [-1840.301] (-1840.463) (-1833.230) * [-1833.800] (-1837.577) (-1833.827) (-1839.121) -- 0:01:34
      594500 -- (-1833.199) (-1835.644) (-1841.374) [-1834.786] * (-1837.942) (-1837.848) (-1830.015) [-1830.011] -- 0:01:34
      595000 -- (-1841.824) [-1831.975] (-1847.827) (-1844.765) * [-1839.301] (-1839.360) (-1835.177) (-1834.370) -- 0:01:33

      Average standard deviation of split frequencies: 0.000000

      595500 -- [-1835.379] (-1836.345) (-1839.484) (-1835.427) * (-1835.959) [-1840.374] (-1832.838) (-1833.678) -- 0:01:33
      596000 -- (-1834.101) (-1839.296) [-1843.169] (-1835.579) * (-1832.893) (-1837.987) [-1831.698] (-1835.024) -- 0:01:34
      596500 -- (-1837.644) (-1831.669) [-1837.174] (-1836.836) * (-1834.436) (-1832.551) (-1835.570) [-1833.255] -- 0:01:34
      597000 -- (-1839.654) (-1832.536) [-1835.091] (-1834.550) * (-1834.035) [-1839.584] (-1837.588) (-1837.829) -- 0:01:33
      597500 -- [-1831.724] (-1835.810) (-1836.281) (-1834.591) * (-1834.215) [-1834.253] (-1834.707) (-1848.048) -- 0:01:33
      598000 -- (-1831.786) [-1833.244] (-1832.877) (-1834.987) * (-1838.962) (-1836.057) [-1836.786] (-1837.831) -- 0:01:33
      598500 -- [-1833.622] (-1834.863) (-1834.086) (-1843.052) * (-1838.710) (-1832.848) (-1836.518) [-1834.341] -- 0:01:33
      599000 -- (-1834.925) (-1836.413) (-1836.287) [-1834.348] * [-1833.703] (-1833.652) (-1835.126) (-1843.832) -- 0:01:33
      599500 -- [-1836.433] (-1837.252) (-1836.924) (-1836.328) * (-1834.907) [-1836.664] (-1831.132) (-1835.005) -- 0:01:32
      600000 -- (-1840.037) (-1843.041) [-1836.434] (-1838.780) * (-1834.983) (-1831.411) (-1842.402) [-1833.095] -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      600500 -- (-1844.728) (-1835.134) [-1834.059] (-1844.460) * (-1839.419) (-1835.508) (-1835.866) [-1829.500] -- 0:01:33
      601000 -- (-1844.491) (-1837.038) [-1835.465] (-1847.451) * (-1837.846) (-1839.969) [-1832.925] (-1834.662) -- 0:01:32
      601500 -- [-1833.225] (-1839.934) (-1834.291) (-1843.892) * (-1840.813) (-1838.787) (-1836.513) [-1834.886] -- 0:01:32
      602000 -- (-1837.986) (-1839.660) (-1837.906) [-1840.257] * (-1836.915) (-1832.137) [-1833.268] (-1835.113) -- 0:01:32
      602500 -- [-1837.312] (-1835.635) (-1836.431) (-1840.333) * (-1844.001) (-1835.597) (-1833.237) [-1838.602] -- 0:01:32
      603000 -- (-1838.067) (-1833.365) [-1845.190] (-1842.950) * (-1844.600) [-1833.799] (-1840.363) (-1839.598) -- 0:01:32
      603500 -- (-1837.926) [-1833.080] (-1836.759) (-1845.676) * (-1835.112) (-1837.103) (-1835.992) [-1838.614] -- 0:01:31
      604000 -- (-1840.784) (-1830.853) [-1834.351] (-1844.804) * (-1838.500) [-1835.630] (-1837.889) (-1838.939) -- 0:01:31
      604500 -- (-1837.087) [-1830.880] (-1834.921) (-1839.550) * (-1839.977) (-1839.482) (-1849.305) [-1840.079] -- 0:01:32
      605000 -- (-1839.363) (-1834.135) (-1849.109) [-1833.125] * (-1841.446) (-1834.823) [-1837.982] (-1837.736) -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      605500 -- (-1829.834) [-1837.219] (-1840.589) (-1833.966) * (-1829.974) [-1833.483] (-1837.955) (-1839.102) -- 0:01:31
      606000 -- [-1831.578] (-1834.959) (-1837.753) (-1842.711) * (-1841.543) (-1833.177) (-1831.180) [-1838.422] -- 0:01:31
      606500 -- (-1834.822) [-1833.787] (-1840.751) (-1835.930) * (-1836.965) (-1840.030) [-1837.289] (-1833.946) -- 0:01:31
      607000 -- [-1830.228] (-1834.425) (-1837.652) (-1835.055) * [-1835.410] (-1842.471) (-1833.067) (-1830.694) -- 0:01:31
      607500 -- [-1838.245] (-1839.917) (-1838.431) (-1832.883) * (-1832.239) [-1832.548] (-1852.015) (-1835.937) -- 0:01:31
      608000 -- (-1846.153) (-1836.641) (-1836.968) [-1831.410] * (-1834.598) (-1832.924) (-1837.191) [-1833.644] -- 0:01:30
      608500 -- (-1833.635) (-1833.703) [-1833.883] (-1834.920) * [-1838.400] (-1836.185) (-1836.719) (-1831.800) -- 0:01:30
      609000 -- (-1834.758) [-1834.831] (-1831.048) (-1835.536) * (-1830.480) (-1842.753) (-1834.855) [-1837.758] -- 0:01:31
      609500 -- [-1832.329] (-1836.613) (-1832.044) (-1839.668) * (-1834.306) (-1834.162) (-1833.382) [-1828.269] -- 0:01:30
      610000 -- (-1835.469) [-1833.217] (-1837.477) (-1834.182) * (-1836.607) (-1837.929) [-1834.710] (-1834.247) -- 0:01:30

      Average standard deviation of split frequencies: 0.000000

      610500 -- (-1830.299) (-1839.994) [-1837.347] (-1834.655) * (-1837.927) (-1831.060) [-1830.823] (-1835.045) -- 0:01:30
      611000 -- (-1836.374) [-1835.990] (-1838.624) (-1837.796) * [-1840.785] (-1833.973) (-1833.890) (-1836.788) -- 0:01:30
      611500 -- (-1841.660) (-1836.638) [-1838.003] (-1838.323) * (-1837.628) (-1830.651) (-1833.126) [-1841.481] -- 0:01:30
      612000 -- [-1841.890] (-1838.089) (-1836.830) (-1835.808) * [-1839.857] (-1838.521) (-1832.858) (-1839.189) -- 0:01:30
      612500 -- (-1838.376) [-1832.712] (-1840.308) (-1833.619) * (-1836.629) [-1835.927] (-1836.282) (-1841.302) -- 0:01:29
      613000 -- (-1835.727) [-1832.853] (-1830.692) (-1839.659) * [-1832.692] (-1830.575) (-1831.092) (-1844.242) -- 0:01:29
      613500 -- [-1832.264] (-1834.487) (-1838.377) (-1836.615) * (-1835.658) (-1833.237) [-1833.932] (-1832.583) -- 0:01:30
      614000 -- (-1833.060) (-1832.942) (-1836.809) [-1835.619] * [-1837.550] (-1837.848) (-1833.884) (-1839.006) -- 0:01:29
      614500 -- [-1831.415] (-1834.574) (-1841.142) (-1840.881) * (-1832.456) (-1832.956) [-1835.628] (-1834.629) -- 0:01:29
      615000 -- (-1832.069) [-1837.743] (-1834.086) (-1832.552) * (-1833.993) (-1837.683) [-1835.175] (-1834.422) -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      615500 -- [-1833.810] (-1834.999) (-1831.748) (-1834.785) * (-1840.194) [-1835.615] (-1842.506) (-1845.891) -- 0:01:29
      616000 -- (-1834.189) (-1843.490) [-1835.947] (-1837.764) * (-1833.246) [-1838.166] (-1833.575) (-1846.597) -- 0:01:29
      616500 -- (-1836.488) (-1837.064) [-1838.923] (-1838.447) * (-1840.049) (-1836.865) [-1833.594] (-1833.639) -- 0:01:28
      617000 -- (-1834.294) (-1834.214) [-1836.221] (-1832.607) * (-1836.770) [-1840.224] (-1837.678) (-1836.384) -- 0:01:28
      617500 -- (-1834.221) (-1834.448) [-1835.564] (-1840.903) * (-1840.013) (-1846.362) [-1836.441] (-1835.305) -- 0:01:29
      618000 -- (-1836.402) (-1839.453) [-1833.465] (-1836.504) * (-1844.082) (-1837.253) (-1839.027) [-1836.325] -- 0:01:29
      618500 -- (-1832.699) [-1835.850] (-1837.072) (-1839.778) * (-1838.220) (-1834.406) (-1836.292) [-1839.842] -- 0:01:28
      619000 -- (-1835.821) (-1841.164) [-1829.599] (-1837.417) * (-1842.241) [-1837.739] (-1833.863) (-1832.898) -- 0:01:28
      619500 -- [-1835.636] (-1840.209) (-1836.731) (-1838.445) * [-1839.615] (-1839.288) (-1835.700) (-1835.646) -- 0:01:28
      620000 -- (-1832.889) (-1842.357) [-1830.896] (-1838.764) * (-1836.294) (-1836.341) [-1835.882] (-1835.639) -- 0:01:28

      Average standard deviation of split frequencies: 0.000000

      620500 -- (-1836.817) (-1840.421) (-1835.548) [-1832.034] * [-1834.778] (-1833.609) (-1838.282) (-1841.316) -- 0:01:28
      621000 -- (-1834.959) [-1832.570] (-1835.450) (-1833.869) * [-1835.313] (-1839.109) (-1831.866) (-1835.591) -- 0:01:27
      621500 -- (-1841.560) (-1835.211) (-1835.734) [-1837.471] * (-1837.956) [-1840.720] (-1835.707) (-1839.073) -- 0:01:27
      622000 -- (-1849.997) (-1832.924) (-1832.169) [-1834.144] * (-1837.220) (-1842.510) (-1836.505) [-1834.897] -- 0:01:28
      622500 -- (-1837.510) (-1832.547) (-1835.080) [-1836.130] * (-1830.676) (-1836.192) (-1839.287) [-1838.842] -- 0:01:27
      623000 -- [-1841.082] (-1838.581) (-1835.904) (-1840.043) * (-1837.143) [-1834.514] (-1832.328) (-1836.910) -- 0:01:27
      623500 -- (-1837.398) (-1838.427) (-1835.267) [-1837.940] * (-1836.030) (-1839.375) (-1840.115) [-1837.966] -- 0:01:27
      624000 -- (-1834.904) [-1839.157] (-1831.618) (-1834.540) * [-1831.303] (-1844.103) (-1838.053) (-1841.327) -- 0:01:27
      624500 -- [-1833.369] (-1838.312) (-1832.428) (-1838.551) * (-1833.724) [-1836.207] (-1847.088) (-1838.117) -- 0:01:27
      625000 -- [-1833.958] (-1841.869) (-1837.715) (-1840.601) * (-1835.716) [-1835.108] (-1837.372) (-1839.657) -- 0:01:27

      Average standard deviation of split frequencies: 0.000000

      625500 -- [-1838.532] (-1839.902) (-1833.570) (-1836.203) * (-1837.982) [-1836.677] (-1837.569) (-1834.716) -- 0:01:26
      626000 -- (-1831.676) [-1840.032] (-1835.731) (-1836.270) * [-1841.791] (-1835.690) (-1835.890) (-1837.592) -- 0:01:27
      626500 -- (-1834.519) [-1839.686] (-1842.865) (-1841.245) * (-1840.942) (-1838.912) [-1833.350] (-1834.953) -- 0:01:27
      627000 -- [-1832.327] (-1838.467) (-1833.468) (-1837.226) * (-1831.328) (-1838.558) (-1841.593) [-1838.183] -- 0:01:26
      627500 -- [-1835.217] (-1834.327) (-1838.144) (-1833.561) * [-1831.097] (-1837.860) (-1839.268) (-1840.554) -- 0:01:26
      628000 -- (-1835.896) (-1834.573) (-1835.898) [-1835.256] * (-1841.704) (-1837.782) (-1835.325) [-1832.049] -- 0:01:26
      628500 -- [-1834.263] (-1834.574) (-1833.854) (-1836.198) * (-1837.818) (-1834.679) (-1832.667) [-1831.918] -- 0:01:26
      629000 -- [-1836.854] (-1838.225) (-1830.880) (-1837.491) * (-1839.574) (-1833.875) [-1836.244] (-1833.944) -- 0:01:26
      629500 -- (-1835.489) [-1839.512] (-1843.350) (-1838.222) * (-1841.896) (-1843.592) [-1836.289] (-1842.271) -- 0:01:25
      630000 -- (-1839.657) (-1836.511) [-1836.644] (-1836.944) * (-1837.954) [-1841.108] (-1837.952) (-1838.599) -- 0:01:25

      Average standard deviation of split frequencies: 0.000000

      630500 -- (-1839.513) (-1836.435) [-1832.095] (-1840.318) * [-1838.507] (-1834.350) (-1836.018) (-1835.190) -- 0:01:26
      631000 -- [-1833.184] (-1835.076) (-1832.069) (-1834.808) * (-1837.631) (-1840.452) [-1836.262] (-1841.042) -- 0:01:25
      631500 -- [-1833.184] (-1834.680) (-1838.397) (-1839.621) * (-1839.810) [-1834.916] (-1831.793) (-1837.836) -- 0:01:25
      632000 -- (-1834.075) (-1835.162) (-1833.891) [-1838.735] * (-1840.290) (-1838.913) [-1834.375] (-1834.570) -- 0:01:25
      632500 -- [-1833.616] (-1837.885) (-1835.664) (-1838.696) * (-1834.244) (-1841.691) (-1839.131) [-1830.891] -- 0:01:25
      633000 -- [-1836.526] (-1840.143) (-1838.950) (-1836.240) * [-1835.230] (-1839.061) (-1838.726) (-1835.900) -- 0:01:25
      633500 -- (-1838.996) (-1839.129) (-1835.846) [-1835.447] * (-1834.195) [-1835.505] (-1847.783) (-1838.096) -- 0:01:25
      634000 -- [-1840.250] (-1835.574) (-1833.180) (-1833.804) * [-1836.380] (-1830.184) (-1845.123) (-1838.451) -- 0:01:24
      634500 -- (-1839.460) (-1841.848) [-1832.646] (-1832.755) * (-1834.570) [-1836.551] (-1841.943) (-1840.721) -- 0:01:25
      635000 -- (-1832.984) (-1831.614) [-1833.660] (-1833.124) * (-1835.258) (-1838.668) [-1836.050] (-1842.566) -- 0:01:25

      Average standard deviation of split frequencies: 0.000000

      635500 -- [-1832.894] (-1832.349) (-1837.307) (-1834.291) * (-1835.902) [-1835.699] (-1844.490) (-1836.888) -- 0:01:24
      636000 -- (-1837.300) (-1837.929) (-1834.796) [-1831.550] * [-1840.373] (-1832.452) (-1844.768) (-1840.483) -- 0:01:24
      636500 -- (-1841.467) (-1833.938) [-1836.583] (-1836.401) * (-1831.206) [-1835.973] (-1836.920) (-1843.938) -- 0:01:24
      637000 -- (-1838.335) [-1832.241] (-1836.968) (-1833.801) * (-1838.210) (-1837.595) [-1835.590] (-1834.594) -- 0:01:24
      637500 -- (-1833.004) (-1837.588) (-1836.300) [-1839.766] * [-1833.800] (-1834.072) (-1832.810) (-1839.978) -- 0:01:24
      638000 -- [-1833.188] (-1835.856) (-1835.165) (-1836.094) * (-1830.556) (-1834.539) [-1837.814] (-1836.275) -- 0:01:23
      638500 -- (-1843.752) (-1836.260) [-1834.430] (-1839.260) * (-1837.894) [-1832.114] (-1833.355) (-1835.203) -- 0:01:23
      639000 -- (-1836.002) (-1835.307) [-1834.377] (-1836.941) * (-1836.663) [-1836.612] (-1841.285) (-1833.986) -- 0:01:24
      639500 -- (-1838.208) (-1836.607) (-1843.331) [-1840.193] * [-1840.759] (-1832.284) (-1833.736) (-1829.817) -- 0:01:23
      640000 -- [-1840.430] (-1839.833) (-1842.084) (-1838.629) * (-1838.169) (-1833.829) (-1837.503) [-1830.296] -- 0:01:23

      Average standard deviation of split frequencies: 0.000000

      640500 -- [-1836.361] (-1836.792) (-1846.192) (-1843.925) * [-1834.707] (-1831.876) (-1837.013) (-1836.286) -- 0:01:23
      641000 -- [-1836.081] (-1834.026) (-1833.800) (-1834.657) * [-1832.651] (-1834.222) (-1841.124) (-1833.216) -- 0:01:23
      641500 -- (-1837.