--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 08 16:49:36 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/166/CG5172-PD/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1035.92 -1044.26
2 -1035.96 -1043.89
--------------------------------------
TOTAL -1035.94 -1044.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.296314 0.005023 0.177940 0.435425 0.286058 1098.03 1229.73 1.001
r(A<->C){all} 0.138782 0.003262 0.034008 0.248868 0.132041 808.73 849.64 1.000
r(A<->G){all} 0.086346 0.000991 0.035768 0.153983 0.081752 973.27 974.56 1.000
r(A<->T){all} 0.107468 0.002986 0.005152 0.207251 0.102866 733.34 803.64 1.000
r(C<->G){all} 0.013681 0.000107 0.000005 0.032937 0.011321 1100.05 1214.25 1.000
r(C<->T){all} 0.635538 0.005972 0.485295 0.781848 0.639666 689.59 727.72 1.000
r(G<->T){all} 0.018185 0.000181 0.000053 0.044197 0.015610 817.34 941.24 1.001
pi(A){all} 0.173761 0.000236 0.144738 0.205147 0.173821 1127.93 1271.42 1.002
pi(C){all} 0.198794 0.000245 0.167595 0.228583 0.198441 1184.73 1321.69 1.000
pi(G){all} 0.466851 0.000450 0.425953 0.509315 0.466315 1188.60 1195.86 1.002
pi(T){all} 0.160594 0.000203 0.132885 0.187525 0.160227 922.19 1148.58 1.000
alpha{1,2} 0.064853 0.003857 0.000113 0.164661 0.052184 1299.89 1339.59 1.000
alpha{3} 1.505476 0.495366 0.425647 2.957427 1.359816 1501.00 1501.00 1.000
pinvar{all} 0.311574 0.017644 0.024958 0.523511 0.324855 1501.00 1501.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -892.945376
Model 2: PositiveSelection -888.027459
Model 0: one-ratio -897.960889
Model 3: discrete -888.027461
Model 7: beta -892.967202
Model 8: beta&w>1 -888.030698
Model 0 vs 1 10.031025999999883
Model 2 vs 1 9.835833999999977
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.611 6.215
24 G 0.997** 10.050
35 G 0.525 5.354
47 Y 0.966* 9.742
52 Q 0.995** 10.028
53 K 0.996** 10.044
92 Q 0.524 5.343
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.501 4.132 +- 3.852
24 G 0.944 7.464 +- 2.621
47 Y 0.800 6.391 +- 3.370
52 Q 0.929 7.355 +- 2.726
53 K 0.937 7.399 +- 2.672
Model 8 vs 7 9.873008000000027
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.597 6.202
24 G 0.997** 10.260
35 G 0.511 5.333
47 Y 0.961* 9.899
52 Q 0.994** 10.234
53 K 0.996** 10.252
92 Q 0.507 5.293
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.533 4.383 +- 4.009
24 G 0.969* 7.734 +- 2.428
47 Y 0.859 6.897 +- 3.205
52 Q 0.959* 7.658 +- 2.522
53 K 0.966* 7.703 +- 2.458
>C1
MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGGGGYGGGGGGQSGY
GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGGGGGQGGYGG
GNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSWQGGNGGNKNGGGG
GGGGGLYGGGGGGGGKQHGGGWooooooooooooo
>C2
MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGGGYGGGGGGQSGYGGG
GQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGGGGHGGGGKGGYG
GGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSWQGGNGGNKHGGG
GGGGGGLYGGGGGGGGKQHGGGWoooooooooooo
>C3
MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGGGGGGQSGYGGGGGGQ
SGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGGGGHGGG
GQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSWQGGNGG
NKHGGGGGGGGGLYGGGGGGGGKQHGGGWoooooo
>C4
MRRAVILVFVCCLLIAVASAGLLGGGGGGGGYGGGGGGGQGGYGGGGGGG
GGQGGWQKNGGGGGGHGGGGHGGGGQGGYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGQGGYGGGNQGGHGGQGGYGGGQGGGGHASKSLAGNRGSSVSWQ
GGNGGNKHGGGGGGGGGGLYGGGGGGGGKQHGGGW
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=199
C1 MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGG---GGYGGGGGG-
C2 MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGG------GGYGGGGGG-
C3 MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGGGGGGQSGYGGGGGG-
C4 MRRAVILVFVCCLLIAVASAGLLGGGGGGGGYGGGGGGGQGGYGGGGGGG
**:*************::***** ********** .********
C1 --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
C2 --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
C3 --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
C4 GGQGGWQKNGGGGGGHGGGGHGGGGQGGYGGGSQGGHGGGGQGGWQKNGG
*.*: **** :***********.**********************
C1 G----GGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
C2 GGHGGGGKGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
C3 GGHGGGGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
C4 GGHGGGGQGGYGGGNQGGHGGQGGYGGG-QGGGGHASKSLAGNRGSSVSW
* **:******************** :********************
C1 QGGNGGNKNGGGGGGGGG-LYGGGGGGGGKQHGGGWooooooooooooo
C2 QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGWoooooooooooo-
C3 QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGWoooooo-------
C4 QGGNGGNKHGGGGGGGGGGLYGGGGGGGGKQHGGGW-------------
********:********* *****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 185 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 185 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3906]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [3906]--->[2959]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/166/CG5172-PD/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.206 Mb, Max= 30.449 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGG---GGYGGGGGG-
--QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
G----GGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKNGGGGGGGGG-LYGGGGGGGGKQHGGGWooooooooooooo
>C2
MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGG------GGYGGGGGG-
--QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGKGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGWoooooooooooo-
>C3
MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGGGGGGQSGYGGGGGG-
--QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGWoooooo-------
>C4
MRRAVILVFVCCLLIAVASAGLLGGGGGGGGYGGGGGGGQGGYGGGGGGG
GGQGGWQKNGGGGGGHGGGGHGGGGQGGYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGQGGYGGGNQGGHGGQGGYGGG-QGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGGGLYGGGGGGGGKQHGGGW-------------
FORMAT of file /tmp/tmp8540531353322025740aln Not Supported[FATAL:T-COFFEE]
>C1
MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGG---GGYGGGGGG-
--QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
G----GGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKNGGGGGGGGG-LYGGGGGGGGKQHGGGWooooooooooooo
>C2
MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGG------GGYGGGGGG-
--QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGKGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGWoooooooooooo-
>C3
MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGGGGGGQSGYGGGGGG-
--QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGWoooooo-------
>C4
MRRAVILVFVCCLLIAVASAGLLGGGGGGGGYGGGGGGGQGGYGGGGGGG
GGQGGWQKNGGGGGGHGGGGHGGGGQGGYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGQGGYGGGNQGGHGGQGGYGGG-QGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGGGLYGGGGGGGGKQHGGGW-------------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:199 S:89 BS:199
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 97.24 C1 C2 97.24
TOP 1 0 97.24 C2 C1 97.24
BOT 0 2 97.19 C1 C3 97.19
TOP 2 0 97.19 C3 C1 97.19
BOT 0 3 93.57 C1 C4 93.57
TOP 3 0 93.57 C4 C1 93.57
BOT 1 2 98.88 C2 C3 98.88
TOP 2 1 98.88 C3 C2 98.88
BOT 1 3 94.19 C2 C4 94.19
TOP 3 1 94.19 C4 C2 94.19
BOT 2 3 94.38 C3 C4 94.38
TOP 3 2 94.38 C4 C3 94.38
AVG 0 C1 * 96.00
AVG 1 C2 * 96.77
AVG 2 C3 * 96.82
AVG 3 C4 * 94.05
TOT TOT * 95.91
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCCTGCTGATCGCCTT
C2 ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCTTGCTGATCGCCGT
C3 ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCTTGCTGATCGCCGT
C4 ATGCGTCGCGCTGTAATCCTTGTGTTCGTGTGCTGCCTGCTGATCGCCGT
*******.******.******** ******** *** *********** *
C1 AACCTCAGCCGGTTTGCTGGGCGGTGGAGGCGGTGGTGGTGGCTACGGCG
C2 GGCCTCAGCCGGTTTGCTGACCGGTGGAGGTGGTGGTGGTGGCTACGGCG
C3 GGCCTCAGCCGGTTTGCTGACCGGTGGAGGTGGTGGTGGTGGCTACGGCG
C4 GGCTTCGGCTGGCTTGCTGGGCGGTGGAGGCGGTGGTGGTGGCTACGGCG
..* **.** ** ******. ********* *******************
C1 GTGGTGGTGGT---------GGTGGCTACGGCGGTGGTGGTGGTGGT---
C2 GT------------------GGTGGCTACGGCGGTGGTGGTGGTGGT---
C3 GTGGTGGTGGTGGTGGTCAGAGCGGCTACGGCGGTGGTGGTGGTGGT---
C4 GCGGTGGTGGCGGTGGTCAGGGTGGCTACGGCGGTGGTGGCGGAGGAGGC
* .* ***************** **:**:
C1 ------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAACGG
C2 ------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAATGG
C3 ------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAACGG
C4 GGTGGTCAAGGCGGCTGGCAGAAGAACGGAGGAGGCGGCGGTGGCCATGG
**..******. **.**.** *** .:.. .* **
C1 AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGAGGCGGTAGCC
C2 AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGCGGCGGTAGCC
C3 AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGCGGCGGTAGCC
C4 AGGTGGTGGTCATGGAGGTGGCGGCCAGGGAGGCTACGGCGGCGGTAGCC
***:** ** *********************.*******.**********
C1 AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA
C2 AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA
C3 AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA
C4 AAGGTGGACATGGAGGCGGGGGCCAAGGAGGCTGGCAGAAGAACGGAGGA
******************* *********** ******************
C1 GGT------------GGTGGACAAGGAGGCTATGGAGGTGGCAATCAAGG
C2 GGTGGTCATGGAGGTGGTGGAAAAGGAGGCTATGGAGGTGGAAACCAAGG
C3 GGTGGTCATGGAGGTGGTGGACAAGGAGGCTACGGAGGTGGCAACCAAGG
C4 GGCGGCCATGGAGGCGGTGGACAAGGAGGCTACGGAGGTGGCAATCAAGG
** ******.********** ********.** *****
C1 TGGCCACGGAGGACAAGGAGGTTATGGCGGCGGCGGTCATGGAGGCGGTG
C2 TGGCCACGGAGGACAAGGAGGCTATGGCGGTGGTGGCCATGGAGGCGGTG
C3 TGGCCACGGAGGACAAGGAGGCTACGGCGGTGGCGGTCATGGAGGCGGTG
C4 TGGCCACGGAGGACAAGGAGGCTATGGCGGCGGA---CAAGGAGGCGGTG
********************* ** ***** ** **:**********
C1 GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG
C2 GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG
C3 GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG
C4 GCCATGCCAGCAAGTCCTTGGCCGGCAATCGCGGCAGTTCCGTGTCCTGG
*******.************************** ***************
C1 CAGGGCGGAAATGGAGGCAACAAGAACGGAGGCGGCGGAGGAGGTGGTGG
C2 CAGGGCGGAAATGGAGGCAACAAGCACGGTGGCGGCGGAGGAGGTGGTGG
C3 CAGGGCGGAAATGGAGGCAACAAGCACGGTGGCGGCGGAGGAGGTGGTGG
C4 CAGGGCGGAAATGGAGGCAACAAGCACGGAGGCGGCGGCGGAGGAGGTGG
************************.****:********.*****:*****
C1 TGGC---CTGTACGGTGGTGGTGGCGGTGGAGGTGGCAAACAACATGGCG
C2 TGGC---CTGTACGGTGGTGGTGGCGGTGGAGGTGGCAAACAACATGGCG
C3 TGGC---CTGTACGGTGGTGGTGGCGGCGGAGGTGGCAAACAACATGGCG
C4 TGGTGGCCTGTACGGCGGTGGCGGCGGTGGAGGTGGCAAACAGCACGGCG
*** ******** ***** ***** **************.** ****
C1 GTGGCTGG---------------------------------------
C2 GTGGCTGG---------------------------------------
C3 GTGGCTGG---------------------------------------
C4 GTGGCTGG---------------------------------------
********
>C1
ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCCTGCTGATCGCCTT
AACCTCAGCCGGTTTGCTGGGCGGTGGAGGCGGTGGTGGTGGCTACGGCG
GTGGTGGTGGT---------GGTGGCTACGGCGGTGGTGGTGGTGGT---
------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAACGG
AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGAGGCGGTAGCC
AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA
GGT------------GGTGGACAAGGAGGCTATGGAGGTGGCAATCAAGG
TGGCCACGGAGGACAAGGAGGTTATGGCGGCGGCGGTCATGGAGGCGGTG
GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG
CAGGGCGGAAATGGAGGCAACAAGAACGGAGGCGGCGGAGGAGGTGGTGG
TGGC---CTGTACGGTGGTGGTGGCGGTGGAGGTGGCAAACAACATGGCG
GTGGCTGG---------------------------------------
>C2
ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCTTGCTGATCGCCGT
GGCCTCAGCCGGTTTGCTGACCGGTGGAGGTGGTGGTGGTGGCTACGGCG
GT------------------GGTGGCTACGGCGGTGGTGGTGGTGGT---
------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAATGG
AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGCGGCGGTAGCC
AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA
GGTGGTCATGGAGGTGGTGGAAAAGGAGGCTATGGAGGTGGAAACCAAGG
TGGCCACGGAGGACAAGGAGGCTATGGCGGTGGTGGCCATGGAGGCGGTG
GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG
CAGGGCGGAAATGGAGGCAACAAGCACGGTGGCGGCGGAGGAGGTGGTGG
TGGC---CTGTACGGTGGTGGTGGCGGTGGAGGTGGCAAACAACATGGCG
GTGGCTGG---------------------------------------
>C3
ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCTTGCTGATCGCCGT
GGCCTCAGCCGGTTTGCTGACCGGTGGAGGTGGTGGTGGTGGCTACGGCG
GTGGTGGTGGTGGTGGTCAGAGCGGCTACGGCGGTGGTGGTGGTGGT---
------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAACGG
AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGCGGCGGTAGCC
AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA
GGTGGTCATGGAGGTGGTGGACAAGGAGGCTACGGAGGTGGCAACCAAGG
TGGCCACGGAGGACAAGGAGGCTACGGCGGTGGCGGTCATGGAGGCGGTG
GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG
CAGGGCGGAAATGGAGGCAACAAGCACGGTGGCGGCGGAGGAGGTGGTGG
TGGC---CTGTACGGTGGTGGTGGCGGCGGAGGTGGCAAACAACATGGCG
GTGGCTGG---------------------------------------
>C4
ATGCGTCGCGCTGTAATCCTTGTGTTCGTGTGCTGCCTGCTGATCGCCGT
GGCTTCGGCTGGCTTGCTGGGCGGTGGAGGCGGTGGTGGTGGCTACGGCG
GCGGTGGTGGCGGTGGTCAGGGTGGCTACGGCGGTGGTGGCGGAGGAGGC
GGTGGTCAAGGCGGCTGGCAGAAGAACGGAGGAGGCGGCGGTGGCCATGG
AGGTGGTGGTCATGGAGGTGGCGGCCAGGGAGGCTACGGCGGCGGTAGCC
AAGGTGGACATGGAGGCGGGGGCCAAGGAGGCTGGCAGAAGAACGGAGGA
GGCGGCCATGGAGGCGGTGGACAAGGAGGCTACGGAGGTGGCAATCAAGG
TGGCCACGGAGGACAAGGAGGCTATGGCGGCGGA---CAAGGAGGCGGTG
GCCATGCCAGCAAGTCCTTGGCCGGCAATCGCGGCAGTTCCGTGTCCTGG
CAGGGCGGAAATGGAGGCAACAAGCACGGAGGCGGCGGCGGAGGAGGTGG
TGGTGGCCTGTACGGCGGTGGCGGCGGTGGAGGTGGCAAACAGCACGGCG
GTGGCTGG---------------------------------------
>C1
MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGGoooGGYGGGGGGo
ooQSGYoooGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
GooooGGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKNGGGGGGGGGoLYGGGGGGGGKQHGGGW
>C2
MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGooooooGGYGGGGGGo
ooQSGYoooGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGKGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGGoLYGGGGGGGGKQHGGGW
>C3
MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGGGGGGQSGYGGGGGGo
ooQSGYoooGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGGoLYGGGGGGGGKQHGGGW
>C4
MRRAVILVFVCCLLIAVASAGLLGGGGGGGGYGGGGGGGQGGYGGGGGGG
GGQGGWQKNGGGGGGHGGGGHGGGGQGGYGGGSQGGHGGGGQGGWQKNGG
GGHGGGGQGGYGGGNQGGHGGQGGYGGGoQGGGGHASKSLAGNRGSSVSW
QGGNGGNKHGGGGGGGGGGLYGGGGGGGGKQHGGGW
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 597 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478623594
Setting output file names to "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1064349143
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2014305490
Seed = 1673924056
Swapseed = 1478623594
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 24 unique site patterns
Division 2 has 15 unique site patterns
Division 3 has 38 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1266.605489 -- -26.620141
Chain 2 -- -1266.605489 -- -26.620141
Chain 3 -- -1281.584292 -- -26.620141
Chain 4 -- -1281.584292 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1281.584292 -- -26.620141
Chain 2 -- -1266.605489 -- -26.620141
Chain 3 -- -1281.584292 -- -26.620141
Chain 4 -- -1266.605489 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1266.605] (-1266.605) (-1281.584) (-1281.584) * [-1281.584] (-1266.605) (-1281.584) (-1266.605)
500 -- (-1104.470) [-1096.383] (-1102.901) (-1121.666) * (-1095.285) (-1100.785) (-1102.462) [-1082.372] -- 0:00:00
1000 -- (-1072.189) [-1080.356] (-1079.197) (-1075.570) * (-1085.932) (-1078.492) (-1077.184) [-1060.367] -- 0:16:39
1500 -- (-1075.455) (-1073.363) (-1068.130) [-1063.532] * (-1071.128) (-1063.154) (-1074.924) [-1054.942] -- 0:11:05
2000 -- (-1052.715) (-1074.083) [-1057.057] (-1049.473) * (-1062.464) (-1062.128) (-1064.142) [-1046.825] -- 0:08:19
2500 -- (-1050.521) (-1073.493) [-1057.704] (-1047.231) * (-1063.137) (-1059.843) (-1060.616) [-1054.222] -- 0:06:39
3000 -- (-1045.045) (-1053.229) (-1056.077) [-1043.624] * (-1046.209) (-1039.048) [-1060.817] (-1048.642) -- 0:05:32
3500 -- (-1045.413) (-1053.578) (-1051.083) [-1042.650] * [-1042.403] (-1039.684) (-1054.378) (-1047.852) -- 0:04:44
4000 -- (-1048.386) (-1046.488) [-1050.448] (-1050.650) * (-1039.306) [-1037.514] (-1041.331) (-1044.866) -- 0:04:09
4500 -- (-1044.757) (-1045.975) (-1047.725) [-1044.439] * (-1045.140) [-1035.364] (-1051.703) (-1044.664) -- 0:03:41
5000 -- (-1045.793) (-1049.411) (-1050.530) [-1037.139] * (-1036.973) [-1036.414] (-1047.334) (-1037.852) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-1045.094) (-1046.929) [-1039.609] (-1038.256) * (-1037.035) (-1034.409) [-1043.759] (-1045.402) -- 0:03:00
6000 -- (-1045.826) (-1050.361) [-1041.480] (-1040.744) * (-1038.945) [-1042.193] (-1040.446) (-1040.325) -- 0:02:45
6500 -- (-1050.125) (-1043.014) (-1040.940) [-1036.328] * [-1037.041] (-1036.187) (-1039.439) (-1044.072) -- 0:02:32
7000 -- (-1047.633) (-1044.899) (-1039.883) [-1037.691] * [-1036.528] (-1034.219) (-1036.838) (-1041.198) -- 0:02:21
7500 -- (-1049.353) (-1049.745) [-1040.240] (-1034.707) * [-1035.471] (-1041.226) (-1040.642) (-1043.847) -- 0:02:12
8000 -- (-1042.940) (-1054.601) (-1040.810) [-1035.795] * (-1034.655) [-1038.243] (-1037.865) (-1037.940) -- 0:04:08
8500 -- (-1039.712) (-1050.058) [-1037.519] (-1037.705) * (-1039.350) [-1039.048] (-1039.254) (-1037.532) -- 0:03:53
9000 -- (-1039.677) (-1043.718) (-1047.064) [-1038.265] * [-1035.394] (-1045.389) (-1038.417) (-1039.025) -- 0:03:40
9500 -- (-1044.400) (-1043.851) (-1042.354) [-1036.823] * (-1038.310) (-1044.181) (-1038.272) [-1035.716] -- 0:03:28
10000 -- (-1036.345) (-1043.452) [-1038.609] (-1039.176) * (-1033.522) [-1039.937] (-1040.229) (-1038.235) -- 0:03:18
Average standard deviation of split frequencies: 0.044194
10500 -- [-1037.244] (-1041.489) (-1044.644) (-1034.245) * [-1033.003] (-1044.578) (-1040.787) (-1038.740) -- 0:03:08
11000 -- (-1040.872) (-1040.894) (-1045.026) [-1038.189] * (-1037.548) (-1040.122) (-1050.465) [-1037.249] -- 0:02:59
11500 -- (-1037.400) (-1041.866) (-1044.204) [-1037.300] * (-1035.526) [-1035.931] (-1043.577) (-1037.346) -- 0:02:51
12000 -- (-1039.567) (-1037.955) [-1036.362] (-1035.770) * (-1038.649) (-1035.999) (-1040.081) [-1039.768] -- 0:02:44
12500 -- (-1035.803) [-1037.403] (-1035.399) (-1037.427) * (-1040.432) [-1035.122] (-1042.334) (-1039.721) -- 0:02:38
13000 -- (-1040.413) (-1035.279) (-1047.318) [-1042.162] * [-1039.278] (-1036.954) (-1038.620) (-1040.006) -- 0:02:31
13500 -- (-1037.233) (-1042.566) [-1039.897] (-1038.151) * (-1041.081) (-1038.694) (-1040.317) [-1040.733] -- 0:02:26
14000 -- (-1038.266) (-1039.307) [-1040.424] (-1039.463) * (-1045.492) [-1039.537] (-1041.469) (-1034.927) -- 0:02:20
14500 -- (-1037.272) (-1036.538) [-1043.626] (-1040.238) * (-1039.987) (-1038.707) (-1040.350) [-1038.597] -- 0:03:23
15000 -- (-1039.324) [-1036.463] (-1039.051) (-1039.999) * (-1042.203) (-1041.987) (-1035.055) [-1037.109] -- 0:03:17
Average standard deviation of split frequencies: 0.058926
15500 -- (-1035.472) (-1042.980) [-1040.369] (-1036.048) * (-1045.370) (-1044.182) (-1041.159) [-1039.280] -- 0:03:10
16000 -- (-1039.298) (-1040.672) (-1033.613) [-1038.652] * (-1042.637) [-1034.820] (-1039.203) (-1039.205) -- 0:03:04
16500 -- (-1037.825) (-1037.845) (-1039.623) [-1036.807] * (-1038.700) (-1038.669) (-1035.278) [-1040.209] -- 0:02:58
17000 -- (-1036.175) (-1038.504) (-1043.332) [-1037.309] * (-1037.890) (-1042.481) [-1035.510] (-1037.824) -- 0:02:53
17500 -- (-1042.026) [-1037.197] (-1039.430) (-1039.455) * [-1037.687] (-1041.295) (-1035.506) (-1038.773) -- 0:02:48
18000 -- [-1037.301] (-1036.886) (-1042.643) (-1034.802) * (-1040.497) (-1039.523) [-1042.989] (-1036.971) -- 0:02:43
18500 -- (-1036.554) (-1040.873) [-1036.542] (-1036.074) * [-1044.006] (-1042.265) (-1040.389) (-1034.711) -- 0:02:39
19000 -- [-1036.983] (-1043.484) (-1042.573) (-1043.801) * (-1048.704) [-1033.969] (-1041.095) (-1037.925) -- 0:02:34
19500 -- (-1040.868) (-1038.989) (-1036.943) [-1039.208] * (-1044.816) (-1036.973) [-1039.621] (-1035.468) -- 0:02:30
20000 -- (-1037.486) (-1035.880) (-1043.310) [-1035.416] * (-1040.452) (-1037.660) (-1045.026) [-1037.174] -- 0:02:27
Average standard deviation of split frequencies: 0.079835
20500 -- (-1035.275) (-1036.532) (-1038.647) [-1037.497] * (-1042.867) [-1041.427] (-1042.969) (-1040.186) -- 0:02:23
21000 -- (-1037.063) (-1045.018) [-1039.517] (-1035.250) * [-1038.565] (-1037.842) (-1041.728) (-1035.490) -- 0:02:19
21500 -- [-1040.462] (-1042.679) (-1043.851) (-1036.096) * [-1037.882] (-1040.915) (-1037.030) (-1036.048) -- 0:03:02
22000 -- (-1039.106) (-1037.102) [-1045.708] (-1035.336) * (-1034.536) (-1044.580) [-1038.902] (-1039.151) -- 0:02:57
22500 -- (-1043.078) (-1035.638) (-1037.623) [-1035.522] * (-1040.887) [-1037.480] (-1038.251) (-1040.479) -- 0:02:53
23000 -- (-1039.469) (-1035.902) (-1041.163) [-1036.866] * (-1032.710) (-1034.356) (-1043.058) [-1036.232] -- 0:02:49
23500 -- (-1038.632) (-1034.916) [-1040.539] (-1039.301) * (-1038.632) (-1038.761) (-1042.018) [-1036.181] -- 0:02:46
24000 -- (-1040.005) (-1039.314) [-1043.640] (-1039.447) * [-1035.425] (-1038.428) (-1038.136) (-1034.141) -- 0:02:42
24500 -- (-1039.048) [-1043.700] (-1035.526) (-1035.655) * (-1044.230) (-1035.509) [-1038.013] (-1041.725) -- 0:02:39
25000 -- (-1040.780) (-1039.112) (-1037.915) [-1037.065] * (-1036.281) (-1039.702) [-1040.170] (-1041.946) -- 0:02:36
Average standard deviation of split frequencies: 0.027196
25500 -- (-1040.680) (-1039.028) [-1039.099] (-1036.825) * (-1034.683) (-1037.105) (-1036.627) [-1039.515] -- 0:02:32
26000 -- (-1040.278) (-1040.804) [-1042.154] (-1035.081) * (-1037.801) (-1037.065) [-1036.621] (-1041.132) -- 0:02:29
26500 -- (-1037.906) (-1037.397) [-1039.268] (-1036.001) * (-1037.309) (-1036.100) [-1042.477] (-1040.203) -- 0:02:26
27000 -- (-1044.960) (-1038.505) (-1034.143) [-1035.955] * [-1035.504] (-1038.174) (-1043.316) (-1039.601) -- 0:02:24
27500 -- (-1041.205) [-1036.291] (-1037.004) (-1036.658) * [-1039.023] (-1041.146) (-1042.609) (-1047.609) -- 0:02:21
28000 -- (-1038.999) (-1043.710) [-1041.219] (-1037.071) * (-1039.304) (-1036.030) (-1040.970) [-1041.509] -- 0:02:18
28500 -- (-1038.442) (-1040.229) [-1041.149] (-1042.018) * (-1039.308) (-1038.461) (-1040.388) [-1040.212] -- 0:02:16
29000 -- (-1039.840) [-1037.516] (-1038.303) (-1048.922) * (-1038.838) (-1042.200) [-1042.125] (-1039.763) -- 0:02:47
29500 -- (-1036.169) [-1041.985] (-1047.546) (-1041.269) * (-1047.065) (-1036.109) [-1035.127] (-1043.260) -- 0:02:44
30000 -- (-1044.267) (-1039.040) (-1045.377) [-1036.749] * [-1039.761] (-1040.377) (-1040.110) (-1043.953) -- 0:02:41
Average standard deviation of split frequencies: 0.030744
30500 -- (-1039.926) [-1041.152] (-1050.526) (-1037.895) * (-1046.027) (-1038.120) [-1036.565] (-1041.164) -- 0:02:38
31000 -- (-1041.085) (-1042.805) (-1049.055) [-1037.575] * (-1040.633) (-1046.084) [-1042.306] (-1037.770) -- 0:02:36
31500 -- (-1037.054) (-1038.878) (-1044.590) [-1034.483] * (-1040.046) [-1046.380] (-1045.379) (-1038.729) -- 0:02:33
32000 -- (-1040.247) (-1039.927) (-1040.423) [-1038.013] * (-1037.454) [-1048.157] (-1040.054) (-1039.138) -- 0:02:31
32500 -- (-1042.511) (-1038.117) (-1040.307) [-1037.910] * (-1042.233) (-1041.681) [-1036.095] (-1042.231) -- 0:02:28
33000 -- [-1037.769] (-1041.632) (-1041.941) (-1037.321) * (-1039.895) (-1048.720) (-1040.913) [-1035.714] -- 0:02:26
33500 -- (-1035.902) [-1041.855] (-1052.047) (-1040.481) * [-1042.703] (-1042.926) (-1038.591) (-1042.577) -- 0:02:24
34000 -- (-1035.600) (-1034.490) [-1043.456] (-1039.048) * (-1042.648) (-1038.854) [-1043.973] (-1041.611) -- 0:02:22
34500 -- (-1042.148) (-1044.165) (-1041.532) [-1039.629] * [-1042.967] (-1039.128) (-1041.722) (-1043.873) -- 0:02:19
35000 -- [-1042.992] (-1040.291) (-1042.628) (-1047.092) * (-1049.039) (-1035.103) (-1038.565) [-1039.426] -- 0:02:17
Average standard deviation of split frequencies: 0.013095
35500 -- (-1041.324) (-1040.240) [-1035.560] (-1044.294) * (-1040.125) [-1040.122] (-1041.970) (-1038.913) -- 0:02:15
36000 -- (-1034.669) (-1038.728) [-1039.726] (-1040.164) * (-1045.439) (-1037.705) (-1044.295) [-1034.117] -- 0:02:13
36500 -- (-1036.500) (-1035.038) [-1045.063] (-1037.359) * (-1040.924) (-1039.096) (-1039.692) [-1035.118] -- 0:02:38
37000 -- [-1036.995] (-1037.209) (-1036.207) (-1037.787) * (-1047.709) (-1042.532) [-1037.892] (-1040.689) -- 0:02:36
37500 -- [-1036.464] (-1034.726) (-1041.141) (-1040.331) * (-1041.216) (-1042.893) [-1036.460] (-1039.317) -- 0:02:34
38000 -- [-1039.837] (-1038.388) (-1043.166) (-1040.808) * (-1046.981) (-1036.404) (-1039.636) [-1036.051] -- 0:02:31
38500 -- (-1046.646) [-1035.223] (-1042.138) (-1036.376) * [-1052.974] (-1038.919) (-1041.927) (-1038.353) -- 0:02:29
39000 -- (-1039.488) [-1040.899] (-1040.305) (-1039.794) * (-1046.697) (-1038.181) [-1040.343] (-1043.005) -- 0:02:27
39500 -- (-1039.196) (-1037.779) (-1043.210) [-1039.157] * [-1046.187] (-1043.063) (-1038.501) (-1034.238) -- 0:02:25
40000 -- [-1035.816] (-1033.971) (-1035.777) (-1037.454) * (-1045.313) (-1037.870) [-1039.681] (-1036.045) -- 0:02:24
Average standard deviation of split frequencies: 0.011592
40500 -- (-1040.585) (-1033.386) (-1037.520) [-1037.096] * (-1042.879) (-1035.445) (-1040.547) [-1039.031] -- 0:02:22
41000 -- [-1040.372] (-1034.808) (-1037.237) (-1038.704) * [-1039.427] (-1039.468) (-1035.668) (-1043.003) -- 0:02:20
41500 -- (-1039.193) (-1041.972) (-1042.202) [-1039.800] * (-1039.115) (-1036.883) [-1040.711] (-1038.428) -- 0:02:18
42000 -- (-1037.736) (-1035.204) (-1046.274) [-1043.285] * (-1041.131) (-1038.353) (-1037.200) [-1038.773] -- 0:02:16
42500 -- (-1036.064) (-1040.529) (-1043.780) [-1039.019] * (-1040.441) (-1042.372) [-1035.307] (-1039.249) -- 0:02:15
43000 -- [-1042.137] (-1037.167) (-1047.677) (-1044.127) * [-1042.356] (-1039.374) (-1035.811) (-1036.716) -- 0:02:13
43500 -- (-1037.027) [-1033.279] (-1045.660) (-1045.824) * (-1041.790) (-1051.715) (-1036.611) [-1032.951] -- 0:02:11
44000 -- (-1044.138) [-1044.328] (-1044.695) (-1041.770) * [-1039.183] (-1038.344) (-1034.553) (-1034.515) -- 0:02:32
44500 -- (-1042.153) [-1038.410] (-1037.788) (-1036.441) * (-1048.448) (-1036.948) (-1034.029) [-1038.833] -- 0:02:30
45000 -- (-1035.123) (-1038.288) [-1037.116] (-1035.589) * (-1046.505) (-1044.612) [-1037.938] (-1042.311) -- 0:02:28
Average standard deviation of split frequencies: 0.020496
45500 -- (-1042.015) [-1038.346] (-1043.992) (-1038.325) * (-1046.124) [-1041.628] (-1037.268) (-1037.841) -- 0:02:26
46000 -- (-1036.306) (-1042.063) (-1039.916) [-1041.630] * (-1043.917) (-1039.941) [-1040.205] (-1038.560) -- 0:02:25
46500 -- (-1037.558) [-1038.508] (-1039.210) (-1038.381) * (-1037.255) (-1044.879) (-1038.028) [-1035.096] -- 0:02:23
47000 -- (-1038.718) [-1045.570] (-1042.029) (-1036.927) * (-1038.031) (-1036.219) [-1038.439] (-1037.583) -- 0:02:21
47500 -- (-1038.690) (-1042.995) (-1040.478) [-1038.459] * (-1036.406) (-1039.093) (-1039.753) [-1037.660] -- 0:02:20
48000 -- (-1034.980) (-1039.537) (-1038.319) [-1040.869] * [-1040.808] (-1041.345) (-1038.629) (-1043.463) -- 0:02:18
48500 -- (-1042.336) (-1039.277) (-1047.411) [-1037.306] * (-1044.093) (-1040.563) [-1038.967] (-1035.227) -- 0:02:17
49000 -- (-1041.500) [-1043.100] (-1046.023) (-1038.101) * (-1039.432) (-1039.773) [-1038.153] (-1039.427) -- 0:02:15
49500 -- (-1047.867) [-1038.969] (-1039.540) (-1043.279) * (-1033.418) [-1037.509] (-1038.053) (-1035.072) -- 0:02:14
50000 -- (-1039.571) (-1033.831) [-1036.877] (-1039.950) * (-1040.456) (-1038.449) [-1033.834] (-1048.249) -- 0:02:13
Average standard deviation of split frequencies: 0.023260
50500 -- [-1039.550] (-1035.332) (-1040.291) (-1037.220) * [-1033.412] (-1038.507) (-1040.221) (-1041.193) -- 0:02:11
51000 -- (-1032.766) [-1038.782] (-1043.654) (-1039.805) * (-1042.104) (-1038.931) [-1038.795] (-1043.424) -- 0:02:28
51500 -- (-1039.123) [-1034.264] (-1043.341) (-1043.725) * (-1039.740) [-1039.500] (-1039.962) (-1038.847) -- 0:02:27
52000 -- (-1041.823) (-1034.757) (-1042.080) [-1042.124] * (-1032.688) [-1043.148] (-1041.395) (-1043.069) -- 0:02:25
52500 -- (-1034.269) [-1037.348] (-1042.358) (-1043.887) * (-1038.052) [-1040.137] (-1035.156) (-1037.653) -- 0:02:24
53000 -- (-1038.743) [-1033.541] (-1037.631) (-1039.049) * (-1037.553) [-1039.753] (-1038.874) (-1042.233) -- 0:02:22
53500 -- (-1040.056) [-1040.537] (-1039.251) (-1040.049) * [-1037.928] (-1046.892) (-1040.677) (-1037.420) -- 0:02:21
54000 -- (-1038.242) (-1035.079) (-1040.650) [-1038.116] * [-1037.237] (-1038.884) (-1040.873) (-1036.753) -- 0:02:20
54500 -- [-1037.718] (-1034.618) (-1044.573) (-1038.640) * (-1036.935) (-1040.456) (-1042.659) [-1033.014] -- 0:02:18
55000 -- (-1038.477) [-1035.019] (-1044.687) (-1040.417) * (-1035.029) (-1039.020) (-1036.853) [-1039.285] -- 0:02:17
Average standard deviation of split frequencies: 0.016836
55500 -- [-1037.282] (-1035.570) (-1037.935) (-1038.014) * [-1033.375] (-1038.825) (-1037.909) (-1034.887) -- 0:02:16
56000 -- [-1035.237] (-1040.321) (-1039.032) (-1036.340) * (-1034.955) (-1036.853) (-1037.217) [-1039.809] -- 0:02:14
56500 -- (-1044.838) (-1038.187) [-1039.664] (-1037.837) * (-1040.996) (-1033.484) (-1037.521) [-1041.683] -- 0:02:13
57000 -- (-1042.613) (-1044.981) [-1040.439] (-1040.806) * (-1040.401) [-1036.921] (-1039.312) (-1042.877) -- 0:02:12
57500 -- (-1042.853) (-1044.801) (-1040.551) [-1042.563] * (-1036.514) (-1038.977) [-1036.398] (-1044.317) -- 0:02:11
58000 -- (-1036.629) (-1051.421) (-1043.072) [-1041.846] * (-1035.886) (-1038.783) [-1036.410] (-1041.276) -- 0:02:09
58500 -- (-1039.128) (-1040.510) (-1035.428) [-1035.802] * [-1036.656] (-1043.761) (-1038.501) (-1052.017) -- 0:02:24
59000 -- [-1036.299] (-1043.956) (-1036.562) (-1039.149) * (-1040.871) (-1041.304) (-1040.168) [-1042.051] -- 0:02:23
59500 -- (-1038.331) (-1043.574) [-1036.887] (-1038.667) * (-1040.452) (-1042.919) (-1037.637) [-1041.836] -- 0:02:22
60000 -- (-1034.759) (-1038.649) (-1035.983) [-1037.561] * (-1035.813) (-1034.424) [-1038.431] (-1037.557) -- 0:02:21
Average standard deviation of split frequencies: 0.031082
60500 -- (-1038.058) (-1040.243) (-1045.572) [-1044.633] * (-1040.224) (-1036.890) (-1040.652) [-1037.396] -- 0:02:19
61000 -- (-1038.629) [-1037.740] (-1041.885) (-1042.657) * (-1041.949) [-1036.961] (-1042.183) (-1041.853) -- 0:02:18
61500 -- (-1041.011) [-1038.524] (-1045.192) (-1036.930) * (-1036.201) (-1036.860) (-1044.171) [-1037.532] -- 0:02:17
62000 -- (-1040.973) [-1034.397] (-1038.205) (-1038.484) * (-1037.470) (-1045.358) (-1041.487) [-1042.564] -- 0:02:16
62500 -- [-1044.110] (-1035.066) (-1037.988) (-1035.330) * (-1039.518) [-1037.154] (-1042.034) (-1046.023) -- 0:02:15
63000 -- (-1049.441) [-1037.011] (-1040.360) (-1047.339) * (-1040.742) [-1039.536] (-1040.992) (-1039.432) -- 0:02:13
63500 -- (-1044.727) [-1036.037] (-1033.860) (-1042.605) * (-1039.193) (-1039.084) [-1040.346] (-1041.028) -- 0:02:12
64000 -- (-1042.130) (-1041.000) [-1036.483] (-1053.552) * (-1040.068) (-1035.662) [-1039.637] (-1038.628) -- 0:02:11
64500 -- (-1038.883) [-1041.590] (-1036.933) (-1036.908) * (-1044.483) (-1037.511) (-1037.435) [-1035.426] -- 0:02:10
65000 -- (-1037.920) (-1036.085) (-1035.788) [-1040.660] * (-1042.383) [-1037.943] (-1040.378) (-1038.377) -- 0:02:09
Average standard deviation of split frequencies: 0.032141
65500 -- (-1043.277) (-1036.810) (-1037.566) [-1043.651] * (-1038.122) (-1043.858) [-1039.872] (-1043.024) -- 0:02:08
66000 -- (-1036.908) (-1036.484) (-1035.517) [-1039.064] * (-1036.920) (-1043.963) (-1040.870) [-1039.927] -- 0:02:21
66500 -- (-1038.379) (-1042.144) (-1036.021) [-1036.141] * [-1036.454] (-1040.366) (-1041.957) (-1040.373) -- 0:02:20
67000 -- (-1037.359) (-1035.370) [-1036.744] (-1038.341) * (-1038.033) [-1040.667] (-1035.966) (-1040.960) -- 0:02:19
67500 -- (-1035.593) (-1038.947) [-1037.742] (-1037.325) * (-1036.429) [-1039.214] (-1039.888) (-1039.331) -- 0:02:18
68000 -- (-1039.575) [-1038.645] (-1038.807) (-1041.306) * (-1039.021) (-1038.653) [-1037.641] (-1036.225) -- 0:02:17
68500 -- (-1045.308) (-1035.508) [-1037.112] (-1034.902) * [-1037.717] (-1044.647) (-1038.563) (-1043.045) -- 0:02:15
69000 -- [-1038.756] (-1035.810) (-1038.262) (-1036.963) * (-1034.846) (-1045.516) [-1038.932] (-1039.576) -- 0:02:14
69500 -- (-1041.757) (-1041.169) [-1038.609] (-1037.382) * (-1041.705) (-1054.567) (-1036.987) [-1034.884] -- 0:02:13
70000 -- (-1038.548) [-1039.061] (-1040.317) (-1035.088) * (-1038.181) (-1043.672) (-1033.979) [-1042.285] -- 0:02:12
Average standard deviation of split frequencies: 0.030019
70500 -- (-1039.722) (-1038.376) [-1035.420] (-1041.775) * [-1035.142] (-1048.979) (-1039.097) (-1037.955) -- 0:02:11
71000 -- (-1038.083) (-1048.515) [-1038.028] (-1032.105) * (-1038.605) (-1046.095) (-1035.279) [-1039.709] -- 0:02:10
71500 -- [-1039.713] (-1038.815) (-1033.642) (-1037.480) * (-1037.277) (-1050.158) (-1042.645) [-1035.624] -- 0:02:09
72000 -- [-1035.666] (-1041.189) (-1036.810) (-1036.526) * (-1038.937) (-1041.440) (-1041.781) [-1036.054] -- 0:02:08
72500 -- (-1045.073) (-1040.530) [-1045.994] (-1038.497) * (-1038.934) (-1041.196) (-1044.195) [-1034.831] -- 0:02:07
73000 -- (-1040.983) (-1043.529) [-1037.608] (-1041.190) * (-1042.763) (-1039.461) (-1043.044) [-1036.343] -- 0:02:06
73500 -- (-1045.270) (-1042.747) (-1036.238) [-1041.671] * (-1038.548) (-1036.847) [-1039.291] (-1038.727) -- 0:02:18
74000 -- (-1041.237) (-1035.298) [-1036.064] (-1041.510) * [-1039.739] (-1047.343) (-1035.146) (-1038.838) -- 0:02:17
74500 -- (-1035.045) [-1038.883] (-1043.847) (-1038.179) * (-1036.975) (-1042.232) (-1037.978) [-1033.731] -- 0:02:16
75000 -- (-1039.456) (-1041.126) [-1040.674] (-1043.442) * (-1039.318) (-1040.808) (-1039.716) [-1038.648] -- 0:02:15
Average standard deviation of split frequencies: 0.012405
75500 -- [-1036.790] (-1040.907) (-1037.131) (-1048.644) * [-1041.176] (-1042.356) (-1039.417) (-1041.041) -- 0:02:14
76000 -- [-1036.589] (-1041.427) (-1041.411) (-1047.197) * (-1038.491) (-1035.155) (-1039.974) [-1036.187] -- 0:02:13
76500 -- (-1038.983) [-1036.212] (-1039.576) (-1047.546) * (-1044.557) [-1037.931] (-1042.262) (-1037.851) -- 0:02:12
77000 -- [-1034.133] (-1038.575) (-1042.290) (-1040.880) * (-1036.973) [-1037.314] (-1041.088) (-1040.782) -- 0:02:11
77500 -- (-1035.789) [-1037.179] (-1037.549) (-1046.558) * (-1036.942) [-1040.973] (-1039.510) (-1038.182) -- 0:02:10
78000 -- (-1037.053) (-1037.001) (-1043.289) [-1041.989] * (-1037.715) [-1040.826] (-1047.558) (-1039.636) -- 0:02:10
78500 -- [-1037.534] (-1036.595) (-1035.714) (-1044.513) * [-1037.302] (-1044.680) (-1040.522) (-1036.494) -- 0:02:09
79000 -- [-1035.288] (-1049.508) (-1043.075) (-1042.676) * (-1034.598) (-1043.812) [-1039.084] (-1043.851) -- 0:02:08
79500 -- [-1036.208] (-1052.590) (-1037.625) (-1045.450) * (-1038.781) [-1039.422] (-1035.345) (-1038.000) -- 0:02:07
80000 -- (-1035.201) (-1046.452) [-1035.745] (-1038.226) * (-1036.993) (-1045.802) (-1043.069) [-1034.824] -- 0:02:06
Average standard deviation of split frequencies: 0.017532
80500 -- [-1042.794] (-1046.552) (-1040.021) (-1033.987) * [-1037.596] (-1040.667) (-1042.697) (-1037.336) -- 0:02:17
81000 -- (-1037.396) (-1038.605) [-1038.083] (-1045.020) * [-1037.676] (-1048.182) (-1038.412) (-1041.403) -- 0:02:16
81500 -- (-1039.174) (-1039.931) (-1033.158) [-1037.282] * (-1038.960) (-1034.589) [-1041.597] (-1039.185) -- 0:02:15
82000 -- [-1040.833] (-1033.817) (-1041.141) (-1036.627) * (-1049.258) [-1036.112] (-1038.454) (-1038.443) -- 0:02:14
82500 -- (-1045.542) [-1038.888] (-1041.065) (-1043.391) * (-1040.124) (-1037.143) (-1040.295) [-1037.851] -- 0:02:13
83000 -- (-1039.597) [-1034.105] (-1038.129) (-1037.602) * (-1042.355) [-1032.520] (-1044.932) (-1039.616) -- 0:02:12
83500 -- (-1035.105) (-1036.804) [-1042.346] (-1040.430) * [-1037.808] (-1039.270) (-1037.821) (-1039.431) -- 0:02:11
84000 -- (-1035.639) [-1039.214] (-1033.308) (-1037.804) * [-1036.456] (-1036.828) (-1036.846) (-1039.383) -- 0:02:10
84500 -- (-1037.698) (-1042.921) [-1036.267] (-1039.451) * (-1039.815) [-1033.634] (-1038.215) (-1041.535) -- 0:02:10
85000 -- [-1045.246] (-1038.888) (-1036.917) (-1038.993) * (-1036.305) [-1037.498] (-1040.452) (-1040.789) -- 0:02:09
Average standard deviation of split frequencies: 0.000000
85500 -- [-1036.353] (-1035.326) (-1043.043) (-1035.756) * (-1034.159) (-1041.078) [-1033.881] (-1043.802) -- 0:02:08
86000 -- (-1039.660) (-1033.821) [-1037.175] (-1035.627) * (-1037.920) (-1041.482) (-1037.698) [-1037.598] -- 0:02:07
86500 -- (-1040.296) (-1038.561) [-1033.473] (-1034.619) * (-1035.015) (-1038.326) [-1040.546] (-1041.179) -- 0:02:06
87000 -- (-1041.397) (-1040.231) (-1035.226) [-1039.142] * [-1038.911] (-1044.027) (-1039.709) (-1037.300) -- 0:02:05
87500 -- (-1039.415) [-1039.474] (-1037.579) (-1035.548) * (-1043.263) [-1041.722] (-1039.606) (-1038.346) -- 0:02:05
88000 -- [-1045.100] (-1044.593) (-1044.829) (-1037.872) * [-1035.457] (-1042.275) (-1047.858) (-1036.747) -- 0:02:14
88500 -- (-1046.593) (-1037.594) [-1034.838] (-1042.292) * [-1037.283] (-1039.865) (-1036.328) (-1046.083) -- 0:02:13
89000 -- (-1047.163) [-1045.173] (-1037.842) (-1036.136) * (-1036.660) (-1045.322) (-1038.812) [-1036.800] -- 0:02:13
89500 -- (-1047.112) [-1035.808] (-1040.047) (-1036.693) * (-1041.328) (-1034.813) (-1039.009) [-1038.708] -- 0:02:12
90000 -- [-1039.007] (-1038.408) (-1046.628) (-1039.176) * (-1043.576) (-1037.073) (-1034.537) [-1036.288] -- 0:02:11
Average standard deviation of split frequencies: 0.005199
90500 -- (-1038.976) [-1039.182] (-1037.141) (-1041.814) * (-1040.858) (-1034.116) (-1035.891) [-1041.612] -- 0:02:10
91000 -- (-1040.092) (-1038.075) (-1040.071) [-1037.183] * (-1046.192) [-1037.632] (-1036.515) (-1039.987) -- 0:02:09
91500 -- (-1039.619) (-1038.900) [-1042.183] (-1036.406) * (-1040.554) (-1037.088) [-1040.859] (-1038.917) -- 0:02:09
92000 -- (-1044.794) [-1038.506] (-1041.829) (-1036.888) * (-1041.684) [-1039.957] (-1034.047) (-1037.853) -- 0:02:08
92500 -- (-1042.660) [-1035.261] (-1037.858) (-1038.098) * [-1041.066] (-1032.645) (-1037.727) (-1041.572) -- 0:02:07
93000 -- (-1037.581) (-1036.749) (-1042.195) [-1036.023] * [-1043.847] (-1036.031) (-1037.952) (-1042.102) -- 0:02:06
93500 -- (-1037.420) (-1042.090) (-1036.301) [-1041.151] * (-1046.278) (-1039.314) [-1036.678] (-1037.372) -- 0:02:06
94000 -- (-1039.074) (-1039.243) [-1038.690] (-1034.419) * (-1040.284) (-1036.133) [-1034.679] (-1040.207) -- 0:02:05
94500 -- [-1040.424] (-1043.849) (-1037.633) (-1041.593) * (-1042.411) [-1035.234] (-1040.373) (-1036.044) -- 0:02:04
95000 -- (-1040.625) (-1038.659) [-1038.834] (-1035.669) * [-1040.433] (-1033.670) (-1035.131) (-1038.643) -- 0:02:03
Average standard deviation of split frequencies: 0.000000
95500 -- (-1044.007) [-1043.538] (-1037.748) (-1039.181) * (-1043.769) [-1040.112] (-1042.536) (-1043.397) -- 0:02:12
96000 -- [-1036.840] (-1038.695) (-1035.065) (-1042.539) * (-1042.617) (-1037.263) [-1044.964] (-1040.908) -- 0:02:11
96500 -- [-1034.802] (-1039.893) (-1036.728) (-1039.771) * (-1041.055) (-1042.309) (-1042.868) [-1035.809] -- 0:02:11
97000 -- (-1043.574) [-1035.516] (-1039.863) (-1041.337) * (-1036.908) (-1042.329) (-1035.487) [-1038.695] -- 0:02:10
97500 -- (-1043.222) (-1039.384) [-1039.081] (-1045.254) * (-1039.171) (-1042.188) (-1043.514) [-1042.514] -- 0:02:09
98000 -- (-1049.704) (-1040.996) (-1035.520) [-1041.032] * (-1041.154) (-1041.788) (-1041.580) [-1041.841] -- 0:02:08
98500 -- (-1044.116) (-1038.380) (-1037.917) [-1037.711] * (-1038.738) (-1035.663) (-1041.162) [-1036.237] -- 0:02:08
99000 -- (-1046.125) (-1038.626) [-1037.829] (-1039.038) * (-1034.241) [-1038.681] (-1042.797) (-1037.782) -- 0:02:07
99500 -- (-1049.038) (-1033.034) [-1037.859] (-1039.870) * (-1039.931) (-1046.379) [-1037.483] (-1036.344) -- 0:02:06
100000 -- (-1050.565) (-1039.693) (-1037.585) [-1037.971] * [-1038.231] (-1045.698) (-1035.754) (-1039.853) -- 0:02:05
Average standard deviation of split frequencies: 0.000000
100500 -- (-1039.318) (-1039.580) [-1036.160] (-1034.171) * [-1039.600] (-1036.232) (-1038.518) (-1035.728) -- 0:02:05
101000 -- (-1037.597) (-1041.017) (-1038.752) [-1034.261] * (-1038.954) (-1045.208) [-1037.508] (-1035.028) -- 0:02:04
101500 -- (-1043.167) (-1041.806) [-1041.395] (-1037.716) * (-1039.747) (-1040.452) [-1040.343] (-1037.018) -- 0:02:03
102000 -- (-1043.421) [-1037.378] (-1039.565) (-1037.025) * (-1036.686) (-1040.546) (-1055.887) [-1037.199] -- 0:02:03
102500 -- (-1040.312) (-1040.938) [-1038.401] (-1040.605) * [-1034.562] (-1036.339) (-1042.370) (-1036.671) -- 0:02:02
103000 -- [-1040.564] (-1043.760) (-1039.010) (-1039.249) * (-1039.791) [-1036.280] (-1038.759) (-1034.799) -- 0:02:10
103500 -- [-1045.925] (-1042.625) (-1041.715) (-1037.667) * (-1045.851) (-1039.644) (-1043.642) [-1037.473] -- 0:02:09
104000 -- (-1038.972) (-1040.076) (-1042.315) [-1040.920] * (-1042.816) (-1040.893) (-1040.725) [-1038.311] -- 0:02:09
104500 -- [-1033.871] (-1036.241) (-1037.781) (-1039.201) * (-1037.109) (-1042.010) (-1047.607) [-1045.866] -- 0:02:08
105000 -- (-1037.529) [-1037.739] (-1037.852) (-1036.906) * (-1035.782) (-1043.647) [-1037.762] (-1037.116) -- 0:02:07
Average standard deviation of split frequencies: 0.004447
105500 -- (-1041.989) (-1038.063) [-1038.667] (-1038.792) * (-1036.739) (-1039.067) (-1042.960) [-1038.731] -- 0:02:07
106000 -- (-1045.957) (-1039.216) [-1035.387] (-1044.384) * (-1037.359) (-1037.821) [-1036.925] (-1043.497) -- 0:02:06
106500 -- (-1044.782) [-1042.891] (-1034.550) (-1034.971) * (-1038.611) [-1041.221] (-1040.904) (-1046.676) -- 0:02:05
107000 -- [-1037.011] (-1043.118) (-1037.644) (-1039.908) * [-1035.678] (-1036.052) (-1039.745) (-1040.706) -- 0:02:05
107500 -- (-1034.691) (-1042.121) [-1038.199] (-1039.699) * (-1037.608) [-1038.033] (-1041.800) (-1042.937) -- 0:02:04
108000 -- [-1034.703] (-1043.659) (-1038.222) (-1044.304) * (-1036.392) (-1040.633) [-1044.016] (-1049.210) -- 0:02:03
108500 -- [-1036.033] (-1044.681) (-1040.465) (-1039.951) * (-1035.840) (-1042.184) (-1037.247) [-1041.937] -- 0:02:03
109000 -- (-1039.025) (-1042.637) [-1035.402] (-1043.442) * (-1037.144) [-1037.308] (-1037.717) (-1033.696) -- 0:02:02
109500 -- [-1037.368] (-1049.623) (-1037.070) (-1037.387) * (-1040.687) (-1036.413) [-1038.480] (-1034.002) -- 0:02:01
110000 -- [-1038.427] (-1042.286) (-1044.957) (-1036.362) * [-1039.903] (-1035.970) (-1040.895) (-1034.091) -- 0:02:01
Average standard deviation of split frequencies: 0.004260
110500 -- [-1036.662] (-1038.971) (-1039.757) (-1037.186) * (-1043.861) [-1035.640] (-1036.797) (-1036.687) -- 0:02:08
111000 -- (-1034.162) (-1038.718) (-1038.379) [-1036.300] * (-1046.052) [-1035.537] (-1045.752) (-1033.450) -- 0:02:08
111500 -- (-1037.716) (-1038.388) [-1036.255] (-1035.638) * (-1038.019) (-1038.084) [-1035.686] (-1045.455) -- 0:02:07
112000 -- (-1041.855) [-1037.019] (-1035.122) (-1035.793) * (-1040.631) (-1039.901) (-1041.749) [-1043.137] -- 0:02:06
112500 -- (-1045.348) (-1034.973) (-1034.828) [-1034.168] * (-1039.376) (-1039.492) [-1039.101] (-1038.799) -- 0:02:06
113000 -- (-1042.764) (-1034.137) [-1039.760] (-1040.571) * (-1037.265) [-1040.876] (-1041.654) (-1045.530) -- 0:02:05
113500 -- (-1039.181) (-1040.786) [-1046.065] (-1042.077) * (-1043.737) (-1034.457) [-1033.374] (-1038.930) -- 0:02:04
114000 -- (-1036.843) [-1037.410] (-1041.427) (-1042.185) * (-1043.791) [-1035.583] (-1046.885) (-1040.415) -- 0:02:04
114500 -- [-1038.484] (-1038.262) (-1040.915) (-1044.982) * (-1043.455) (-1034.897) (-1040.145) [-1035.932] -- 0:02:03
115000 -- (-1035.412) [-1038.389] (-1038.928) (-1040.939) * (-1040.949) [-1035.470] (-1037.240) (-1036.350) -- 0:02:03
Average standard deviation of split frequencies: 0.008128
115500 -- (-1036.782) (-1042.122) [-1035.472] (-1038.967) * (-1044.925) (-1041.828) [-1039.119] (-1038.945) -- 0:02:02
116000 -- (-1037.130) (-1043.103) [-1036.545] (-1036.928) * (-1045.562) (-1036.233) [-1039.094] (-1034.754) -- 0:02:01
116500 -- (-1037.394) (-1038.803) (-1036.250) [-1040.532] * (-1038.944) (-1037.628) (-1038.432) [-1038.108] -- 0:02:01
117000 -- [-1033.293] (-1037.776) (-1038.482) (-1043.526) * (-1040.174) [-1038.152] (-1038.529) (-1036.158) -- 0:02:00
117500 -- (-1042.599) (-1041.523) (-1040.610) [-1040.226] * (-1039.945) (-1038.045) (-1033.970) [-1037.961] -- 0:02:00
118000 -- [-1037.307] (-1037.442) (-1043.379) (-1047.444) * (-1040.004) [-1035.168] (-1037.672) (-1042.687) -- 0:02:07
118500 -- (-1033.596) (-1042.874) (-1035.448) [-1039.767] * (-1047.938) (-1034.060) (-1039.861) [-1039.419] -- 0:02:06
119000 -- (-1046.837) (-1039.739) [-1041.032] (-1037.542) * (-1042.822) [-1039.661] (-1039.437) (-1037.965) -- 0:02:05
119500 -- [-1036.486] (-1039.749) (-1039.986) (-1038.742) * (-1043.111) (-1040.763) [-1036.530] (-1033.356) -- 0:02:05
120000 -- (-1039.354) [-1034.218] (-1034.731) (-1034.339) * (-1046.775) (-1035.547) [-1037.807] (-1035.424) -- 0:02:04
Average standard deviation of split frequencies: 0.011720
120500 -- (-1041.967) (-1037.712) [-1035.669] (-1039.475) * (-1035.857) (-1035.838) (-1038.533) [-1033.763] -- 0:02:04
121000 -- (-1037.984) (-1039.069) (-1039.715) [-1034.611] * (-1037.935) (-1033.752) (-1041.314) [-1034.398] -- 0:02:03
121500 -- (-1038.502) (-1036.790) [-1037.567] (-1038.188) * (-1037.092) (-1037.230) (-1042.738) [-1037.917] -- 0:02:02
122000 -- (-1034.283) (-1039.548) [-1038.766] (-1041.710) * (-1037.730) (-1035.189) [-1040.405] (-1034.760) -- 0:02:02
122500 -- [-1035.335] (-1045.410) (-1043.453) (-1043.195) * (-1042.159) (-1037.930) [-1036.530] (-1034.855) -- 0:02:01
123000 -- (-1036.567) (-1044.382) (-1039.434) [-1037.540] * (-1038.847) [-1038.544] (-1041.130) (-1038.552) -- 0:02:01
123500 -- (-1038.875) (-1038.483) (-1043.673) [-1032.731] * (-1042.373) (-1036.540) [-1037.183] (-1040.183) -- 0:02:00
124000 -- (-1039.793) (-1037.812) [-1036.081] (-1040.080) * [-1036.300] (-1046.019) (-1040.697) (-1041.126) -- 0:02:00
124500 -- (-1041.734) (-1037.937) (-1039.621) [-1036.952] * (-1033.575) [-1036.314] (-1037.553) (-1035.594) -- 0:01:59
125000 -- [-1038.379] (-1039.426) (-1038.409) (-1037.906) * (-1037.218) (-1038.208) (-1036.792) [-1034.539] -- 0:02:06
Average standard deviation of split frequencies: 0.014965
125500 -- (-1034.882) [-1036.777] (-1033.845) (-1041.281) * [-1035.438] (-1043.289) (-1038.690) (-1039.006) -- 0:02:05
126000 -- (-1040.971) (-1042.206) [-1035.565] (-1045.386) * (-1034.742) [-1038.321] (-1039.548) (-1039.483) -- 0:02:04
126500 -- (-1037.396) (-1038.598) (-1036.053) [-1039.585] * [-1039.092] (-1038.511) (-1039.149) (-1041.129) -- 0:02:04
127000 -- (-1042.907) (-1040.570) [-1038.564] (-1049.625) * [-1042.275] (-1037.427) (-1042.123) (-1041.247) -- 0:02:03
127500 -- (-1042.388) (-1038.299) [-1038.484] (-1038.363) * (-1038.018) (-1040.067) [-1038.965] (-1047.059) -- 0:02:03
128000 -- (-1036.624) (-1035.050) [-1039.971] (-1042.038) * (-1050.984) (-1043.638) (-1035.806) [-1044.165] -- 0:02:02
128500 -- (-1040.939) (-1041.602) (-1043.907) [-1040.132] * (-1044.282) (-1046.777) [-1038.808] (-1039.355) -- 0:02:02
129000 -- (-1040.607) (-1040.236) (-1040.646) [-1036.126] * (-1039.065) (-1041.528) [-1037.703] (-1038.831) -- 0:02:01
129500 -- [-1034.797] (-1041.064) (-1039.587) (-1040.153) * [-1038.557] (-1038.351) (-1036.951) (-1041.045) -- 0:02:00
130000 -- (-1036.536) (-1046.393) (-1039.130) [-1042.595] * (-1038.855) [-1039.519] (-1038.343) (-1040.029) -- 0:02:00
Average standard deviation of split frequencies: 0.010823
130500 -- (-1039.430) (-1036.246) [-1044.700] (-1038.850) * [-1042.126] (-1038.248) (-1040.580) (-1042.172) -- 0:01:59
131000 -- (-1040.748) (-1038.800) (-1042.401) [-1034.366] * [-1040.659] (-1039.237) (-1036.895) (-1039.781) -- 0:01:59
131500 -- [-1035.327] (-1036.922) (-1041.552) (-1038.017) * [-1040.282] (-1043.191) (-1036.718) (-1040.456) -- 0:01:58
132000 -- [-1036.543] (-1040.611) (-1041.782) (-1037.296) * [-1041.001] (-1043.125) (-1036.961) (-1038.785) -- 0:01:58
132500 -- (-1041.160) (-1036.372) [-1040.342] (-1045.500) * (-1042.347) [-1039.618] (-1045.407) (-1039.862) -- 0:02:04
133000 -- (-1043.159) (-1039.721) (-1041.085) [-1038.977] * [-1036.718] (-1038.519) (-1040.996) (-1042.260) -- 0:02:03
133500 -- (-1043.785) (-1039.132) (-1035.881) [-1038.111] * (-1036.643) (-1041.735) (-1034.945) [-1042.057] -- 0:02:03
134000 -- (-1038.688) (-1042.195) (-1037.192) [-1039.346] * (-1038.384) (-1042.857) (-1037.933) [-1037.577] -- 0:02:02
134500 -- (-1037.508) [-1044.556] (-1035.765) (-1041.364) * (-1036.423) [-1041.013] (-1039.907) (-1041.363) -- 0:02:02
135000 -- (-1044.440) (-1043.369) (-1044.687) [-1038.043] * [-1035.779] (-1039.203) (-1040.457) (-1041.227) -- 0:02:01
Average standard deviation of split frequencies: 0.010399
135500 -- (-1037.943) (-1043.003) (-1036.397) [-1036.133] * (-1039.669) (-1042.016) (-1042.089) [-1036.928] -- 0:02:01
136000 -- [-1037.442] (-1040.501) (-1038.259) (-1039.443) * (-1043.948) (-1037.345) (-1040.856) [-1037.011] -- 0:02:00
136500 -- (-1040.505) [-1037.825] (-1039.978) (-1037.272) * [-1034.141] (-1043.232) (-1038.946) (-1039.298) -- 0:02:00
137000 -- (-1037.933) [-1036.716] (-1036.979) (-1038.056) * (-1038.276) (-1043.015) (-1040.975) [-1037.263] -- 0:01:59
137500 -- (-1035.195) (-1039.737) (-1041.263) [-1042.820] * (-1036.121) (-1044.218) (-1037.429) [-1035.357] -- 0:01:59
138000 -- (-1039.470) (-1034.930) (-1043.809) [-1035.919] * (-1034.178) [-1045.094] (-1036.883) (-1035.899) -- 0:01:58
138500 -- (-1040.979) (-1038.030) [-1037.432] (-1038.651) * [-1034.569] (-1048.901) (-1037.395) (-1037.492) -- 0:01:58
139000 -- [-1037.587] (-1037.965) (-1046.277) (-1036.212) * (-1037.853) (-1041.278) (-1034.262) [-1038.353] -- 0:01:57
139500 -- (-1034.303) (-1037.865) (-1036.234) [-1041.755] * (-1039.395) (-1042.217) (-1037.526) [-1038.650] -- 0:01:57
140000 -- [-1035.497] (-1037.767) (-1035.346) (-1035.339) * (-1041.552) (-1040.134) [-1040.248] (-1039.380) -- 0:02:02
Average standard deviation of split frequencies: 0.006702
140500 -- [-1033.319] (-1035.099) (-1037.982) (-1035.945) * (-1042.624) [-1037.881] (-1035.890) (-1038.287) -- 0:02:02
141000 -- [-1036.435] (-1036.667) (-1035.347) (-1033.902) * (-1043.670) (-1040.160) [-1037.307] (-1044.462) -- 0:02:01
141500 -- (-1036.068) (-1044.873) (-1045.763) [-1041.755] * (-1039.499) [-1042.012] (-1038.433) (-1039.563) -- 0:02:01
142000 -- (-1033.983) (-1037.834) (-1044.680) [-1045.496] * (-1043.524) (-1043.145) [-1035.071] (-1040.934) -- 0:02:00
142500 -- (-1033.717) [-1037.497] (-1044.364) (-1039.119) * (-1037.562) (-1040.703) [-1032.980] (-1041.741) -- 0:02:00
143000 -- [-1039.519] (-1037.634) (-1046.007) (-1038.856) * [-1040.714] (-1041.499) (-1038.991) (-1037.239) -- 0:01:59
143500 -- [-1039.274] (-1041.679) (-1039.856) (-1036.146) * [-1038.519] (-1048.787) (-1041.621) (-1038.524) -- 0:01:59
144000 -- (-1036.485) (-1039.909) [-1040.168] (-1041.874) * (-1043.790) (-1042.088) (-1044.665) [-1035.796] -- 0:01:58
144500 -- (-1039.600) (-1032.878) [-1038.039] (-1039.073) * (-1042.142) (-1036.803) [-1043.329] (-1035.658) -- 0:01:58
145000 -- (-1047.452) (-1040.050) (-1037.321) [-1038.970] * (-1034.946) [-1038.519] (-1042.521) (-1037.593) -- 0:01:57
Average standard deviation of split frequencies: 0.003229
145500 -- (-1040.857) (-1039.646) (-1038.132) [-1038.337] * (-1042.700) [-1043.275] (-1044.279) (-1033.704) -- 0:01:57
146000 -- (-1047.541) [-1039.872] (-1040.277) (-1042.864) * (-1045.387) (-1038.164) (-1047.937) [-1039.877] -- 0:01:56
146500 -- (-1041.220) [-1044.535] (-1038.635) (-1041.325) * (-1037.985) (-1038.054) [-1039.827] (-1039.357) -- 0:01:56
147000 -- (-1041.153) (-1036.220) [-1034.907] (-1040.657) * (-1039.389) (-1038.354) (-1035.603) [-1037.739] -- 0:01:56
147500 -- (-1040.719) (-1038.618) [-1040.248] (-1047.460) * [-1041.992] (-1036.425) (-1034.495) (-1037.114) -- 0:02:01
148000 -- (-1042.341) [-1038.798] (-1042.406) (-1048.425) * (-1038.743) (-1042.358) [-1034.286] (-1040.562) -- 0:02:00
148500 -- (-1036.456) (-1034.513) [-1034.218] (-1038.475) * [-1038.310] (-1045.137) (-1038.008) (-1041.714) -- 0:02:00
149000 -- (-1041.895) (-1047.531) [-1044.278] (-1045.995) * [-1034.702] (-1039.915) (-1040.934) (-1038.111) -- 0:01:59
149500 -- (-1038.271) [-1035.519] (-1039.615) (-1041.854) * (-1038.144) (-1043.004) [-1038.013] (-1042.851) -- 0:01:59
150000 -- (-1034.862) [-1037.735] (-1038.605) (-1040.568) * (-1041.861) (-1041.143) (-1042.993) [-1038.530] -- 0:01:58
Average standard deviation of split frequencies: 0.006258
150500 -- (-1040.883) (-1040.161) (-1037.774) [-1038.612] * [-1034.231] (-1043.493) (-1037.797) (-1036.975) -- 0:01:58
151000 -- (-1033.274) [-1041.807] (-1042.470) (-1037.065) * [-1037.523] (-1038.716) (-1039.787) (-1036.920) -- 0:01:58
151500 -- [-1038.209] (-1035.752) (-1043.146) (-1034.103) * (-1035.156) (-1040.198) (-1044.384) [-1034.512] -- 0:01:57
152000 -- [-1036.285] (-1041.362) (-1041.632) (-1037.073) * (-1037.474) (-1036.964) [-1040.971] (-1045.586) -- 0:01:57
152500 -- (-1035.738) (-1042.277) [-1037.655] (-1040.170) * [-1034.926] (-1040.768) (-1038.437) (-1042.767) -- 0:01:56
153000 -- (-1038.889) (-1043.567) [-1036.441] (-1046.224) * (-1051.633) [-1035.811] (-1034.990) (-1040.162) -- 0:01:56
153500 -- (-1036.040) (-1046.954) [-1036.814] (-1037.806) * [-1041.854] (-1039.085) (-1043.152) (-1046.933) -- 0:01:55
154000 -- [-1040.858] (-1041.749) (-1042.852) (-1038.493) * [-1034.449] (-1042.510) (-1037.293) (-1040.224) -- 0:01:55
154500 -- (-1043.325) (-1042.505) (-1036.485) [-1039.022] * [-1038.058] (-1044.893) (-1046.657) (-1043.379) -- 0:02:00
155000 -- (-1042.872) (-1038.859) [-1044.580] (-1035.820) * [-1036.440] (-1046.096) (-1044.451) (-1042.346) -- 0:01:59
Average standard deviation of split frequencies: 0.006044
155500 -- (-1039.835) (-1039.659) (-1042.552) [-1036.643] * (-1036.173) (-1039.322) (-1040.929) [-1041.410] -- 0:01:59
156000 -- [-1044.149] (-1037.844) (-1041.898) (-1047.476) * (-1035.869) [-1039.907] (-1045.938) (-1057.689) -- 0:01:59
156500 -- [-1048.992] (-1040.860) (-1037.252) (-1038.949) * (-1038.463) [-1041.974] (-1042.053) (-1037.307) -- 0:01:58
157000 -- (-1045.233) (-1044.190) (-1037.613) [-1038.100] * (-1040.352) (-1036.558) [-1036.322] (-1035.910) -- 0:01:58
157500 -- (-1041.076) (-1037.003) (-1033.909) [-1036.533] * (-1036.152) (-1036.759) [-1041.038] (-1036.205) -- 0:01:57
158000 -- [-1038.919] (-1037.141) (-1040.608) (-1037.220) * (-1035.052) [-1042.804] (-1041.241) (-1036.831) -- 0:01:57
158500 -- (-1040.005) [-1037.286] (-1038.063) (-1033.217) * [-1037.237] (-1048.427) (-1039.432) (-1038.752) -- 0:01:56
159000 -- (-1039.171) (-1039.375) [-1038.490] (-1039.274) * (-1041.401) (-1043.415) (-1034.469) [-1036.684] -- 0:01:56
159500 -- [-1039.927] (-1036.977) (-1036.011) (-1037.212) * (-1034.841) [-1043.237] (-1040.857) (-1042.825) -- 0:01:55
160000 -- (-1038.793) [-1034.110] (-1038.479) (-1036.573) * (-1034.642) (-1044.675) [-1035.079] (-1046.306) -- 0:01:55
Average standard deviation of split frequencies: 0.005868
160500 -- (-1038.525) (-1034.911) (-1038.129) [-1038.241] * (-1037.924) (-1038.678) [-1046.636] (-1044.611) -- 0:01:55
161000 -- (-1039.658) (-1036.296) (-1038.293) [-1035.128] * [-1039.558] (-1038.814) (-1033.119) (-1043.683) -- 0:01:54
161500 -- (-1036.638) [-1035.493] (-1039.859) (-1036.057) * (-1040.814) (-1038.661) (-1034.962) [-1041.060] -- 0:01:54
162000 -- (-1040.719) [-1040.360] (-1038.600) (-1038.160) * [-1044.706] (-1036.988) (-1036.689) (-1042.040) -- 0:01:58
162500 -- (-1038.167) [-1035.689] (-1035.061) (-1037.360) * (-1049.737) [-1036.042] (-1037.607) (-1045.056) -- 0:01:58
163000 -- (-1041.298) (-1043.293) [-1040.554] (-1038.387) * (-1048.900) [-1035.864] (-1037.718) (-1047.223) -- 0:01:58
163500 -- (-1033.880) (-1040.898) (-1040.498) [-1039.983] * (-1040.341) (-1045.132) [-1037.784] (-1039.037) -- 0:01:57
164000 -- [-1038.383] (-1038.934) (-1040.963) (-1039.652) * (-1037.732) [-1046.582] (-1037.144) (-1037.654) -- 0:01:57
164500 -- [-1039.755] (-1034.664) (-1042.602) (-1035.360) * [-1035.973] (-1038.339) (-1039.329) (-1042.473) -- 0:01:56
165000 -- (-1039.482) (-1041.316) [-1042.923] (-1040.829) * (-1035.214) (-1047.741) (-1039.034) [-1034.459] -- 0:01:56
Average standard deviation of split frequencies: 0.000000
165500 -- (-1039.181) (-1042.052) [-1039.537] (-1038.828) * [-1035.054] (-1041.316) (-1037.466) (-1033.119) -- 0:01:55
166000 -- (-1038.208) (-1039.414) [-1035.649] (-1044.627) * [-1041.049] (-1040.972) (-1038.336) (-1036.319) -- 0:01:55
166500 -- (-1036.680) [-1035.950] (-1035.984) (-1043.613) * (-1035.260) [-1040.036] (-1040.441) (-1034.089) -- 0:01:55
167000 -- [-1039.153] (-1038.128) (-1038.324) (-1039.344) * (-1035.963) (-1037.895) (-1039.475) [-1040.286] -- 0:01:54
167500 -- [-1038.041] (-1042.840) (-1038.310) (-1038.723) * (-1034.926) (-1039.274) (-1037.992) [-1035.351] -- 0:01:54
168000 -- (-1036.188) [-1038.729] (-1042.523) (-1039.143) * (-1037.990) [-1043.255] (-1042.388) (-1037.153) -- 0:01:53
168500 -- (-1039.544) (-1039.602) (-1046.804) [-1032.670] * (-1040.336) [-1040.783] (-1037.815) (-1036.241) -- 0:01:53
169000 -- (-1038.854) (-1042.895) [-1039.451] (-1038.748) * (-1038.831) (-1043.654) [-1041.064] (-1038.332) -- 0:01:53
169500 -- (-1041.213) (-1036.744) [-1036.362] (-1038.679) * (-1037.224) [-1040.759] (-1038.688) (-1042.326) -- 0:01:57
170000 -- (-1036.863) [-1035.502] (-1035.870) (-1043.852) * [-1043.089] (-1040.596) (-1046.008) (-1036.666) -- 0:01:57
Average standard deviation of split frequencies: 0.002762
170500 -- (-1041.118) (-1035.723) (-1043.569) [-1040.923] * (-1043.423) (-1046.284) (-1050.338) [-1038.052] -- 0:01:56
171000 -- (-1038.441) (-1042.316) (-1035.318) [-1041.663] * (-1038.087) [-1043.112] (-1052.033) (-1041.035) -- 0:01:56
171500 -- [-1038.731] (-1040.141) (-1042.937) (-1041.960) * (-1045.482) (-1044.295) [-1042.735] (-1045.599) -- 0:01:55
172000 -- (-1041.470) (-1035.596) (-1038.274) [-1037.773] * [-1042.968] (-1051.505) (-1040.516) (-1038.647) -- 0:01:55
172500 -- (-1040.289) [-1038.078] (-1037.785) (-1043.752) * (-1037.327) (-1045.506) (-1046.599) [-1037.042] -- 0:01:55
173000 -- [-1038.926] (-1036.094) (-1040.425) (-1039.901) * (-1042.577) (-1041.591) (-1046.391) [-1037.448] -- 0:01:54
173500 -- (-1036.462) (-1040.461) [-1035.705] (-1036.313) * (-1039.433) (-1037.164) [-1036.678] (-1037.089) -- 0:01:54
174000 -- (-1045.857) [-1036.532] (-1042.409) (-1038.300) * (-1041.733) (-1041.314) (-1034.735) [-1034.410] -- 0:01:53
174500 -- (-1038.027) [-1039.198] (-1035.791) (-1037.707) * (-1041.135) (-1041.323) (-1035.721) [-1039.804] -- 0:01:53
175000 -- [-1039.785] (-1038.434) (-1034.130) (-1039.971) * (-1039.581) [-1037.443] (-1038.059) (-1042.856) -- 0:01:53
Average standard deviation of split frequencies: 0.000000
175500 -- [-1038.006] (-1037.840) (-1043.564) (-1035.324) * [-1040.656] (-1035.960) (-1037.633) (-1045.853) -- 0:01:52
176000 -- (-1035.502) (-1039.059) (-1037.927) [-1043.265] * (-1039.714) [-1035.021] (-1039.242) (-1040.012) -- 0:01:52
176500 -- (-1036.003) (-1042.959) [-1036.436] (-1044.455) * (-1035.175) [-1037.762] (-1040.920) (-1042.261) -- 0:01:51
177000 -- [-1035.813] (-1039.540) (-1035.053) (-1038.980) * (-1036.405) [-1036.046] (-1040.429) (-1037.748) -- 0:01:56
177500 -- (-1038.884) (-1040.982) [-1038.503] (-1036.603) * [-1035.739] (-1038.885) (-1041.673) (-1034.579) -- 0:01:55
178000 -- [-1038.560] (-1042.571) (-1038.228) (-1040.415) * (-1041.052) [-1036.041] (-1038.415) (-1035.617) -- 0:01:55
178500 -- (-1040.456) (-1035.209) (-1042.695) [-1037.208] * (-1040.875) (-1037.919) (-1044.698) [-1038.670] -- 0:01:55
179000 -- (-1040.320) (-1037.562) [-1037.015] (-1038.464) * (-1043.558) (-1043.268) [-1044.640] (-1036.247) -- 0:01:54
179500 -- (-1050.381) (-1036.539) [-1037.857] (-1038.008) * (-1039.712) [-1039.764] (-1039.676) (-1036.646) -- 0:01:54
180000 -- (-1041.681) (-1039.147) [-1037.106] (-1038.329) * (-1035.662) (-1036.462) [-1037.958] (-1041.334) -- 0:01:53
Average standard deviation of split frequencies: 0.000000
180500 -- [-1036.983] (-1045.428) (-1039.177) (-1038.055) * [-1038.216] (-1042.567) (-1039.655) (-1047.659) -- 0:01:53
181000 -- (-1037.937) [-1041.600] (-1044.353) (-1035.555) * (-1035.332) [-1044.759] (-1038.752) (-1040.378) -- 0:01:53
181500 -- (-1038.719) (-1038.785) [-1039.186] (-1037.554) * (-1038.985) (-1039.199) (-1035.171) [-1039.782] -- 0:01:52
182000 -- [-1039.037] (-1037.298) (-1043.812) (-1044.732) * (-1041.492) (-1036.693) (-1037.329) [-1040.555] -- 0:01:52
182500 -- (-1039.473) (-1035.396) (-1044.787) [-1039.251] * (-1035.328) [-1042.876] (-1038.342) (-1038.817) -- 0:01:51
183000 -- (-1037.815) (-1036.532) [-1041.396] (-1034.322) * (-1037.596) (-1039.984) [-1039.499] (-1034.042) -- 0:01:51
183500 -- [-1039.485] (-1037.650) (-1042.329) (-1037.729) * [-1036.159] (-1040.152) (-1039.628) (-1042.888) -- 0:01:51
184000 -- (-1037.035) (-1043.412) [-1041.872] (-1036.799) * (-1040.636) [-1041.208] (-1040.910) (-1042.546) -- 0:01:50
184500 -- (-1040.357) (-1041.677) [-1039.843] (-1042.833) * (-1040.581) (-1045.086) (-1038.180) [-1042.327] -- 0:01:54
185000 -- (-1041.191) (-1038.547) (-1041.475) [-1041.681] * [-1039.425] (-1041.699) (-1034.909) (-1039.361) -- 0:01:54
Average standard deviation of split frequencies: 0.005069
185500 -- (-1045.153) [-1043.235] (-1043.436) (-1043.778) * (-1040.083) (-1041.521) (-1036.927) [-1041.530] -- 0:01:54
186000 -- (-1038.091) (-1041.866) (-1043.773) [-1039.101] * (-1045.778) (-1043.358) [-1034.705] (-1040.120) -- 0:01:53
186500 -- (-1037.177) (-1039.583) (-1038.156) [-1041.845] * (-1042.317) [-1041.195] (-1035.770) (-1035.184) -- 0:01:53
187000 -- (-1038.571) (-1033.769) (-1037.817) [-1039.207] * (-1046.167) (-1044.421) (-1043.219) [-1041.465] -- 0:01:53
187500 -- [-1037.177] (-1044.409) (-1038.895) (-1037.903) * (-1039.066) (-1046.073) [-1038.858] (-1038.052) -- 0:01:52
188000 -- (-1040.944) (-1041.063) (-1042.634) [-1036.978] * (-1037.697) (-1044.383) [-1037.000] (-1041.861) -- 0:01:52
188500 -- (-1036.108) (-1042.327) (-1042.313) [-1037.801] * (-1041.081) (-1035.868) [-1032.322] (-1039.547) -- 0:01:51
189000 -- (-1044.120) (-1036.354) [-1047.634] (-1036.118) * [-1041.394] (-1040.983) (-1037.471) (-1041.710) -- 0:01:51
189500 -- (-1043.401) (-1039.520) [-1041.925] (-1035.780) * (-1039.675) (-1042.649) [-1035.235] (-1037.812) -- 0:01:51
190000 -- (-1037.919) (-1039.272) (-1047.435) [-1040.925] * (-1035.664) (-1038.504) [-1033.694] (-1036.291) -- 0:01:50
Average standard deviation of split frequencies: 0.002472
190500 -- (-1036.479) [-1036.200] (-1039.695) (-1036.413) * [-1035.462] (-1039.586) (-1036.231) (-1047.274) -- 0:01:50
191000 -- (-1037.474) (-1037.778) (-1036.768) [-1033.914] * (-1041.027) (-1041.421) [-1034.985] (-1047.115) -- 0:01:50
191500 -- (-1036.397) (-1042.935) (-1036.290) [-1036.507] * (-1040.249) (-1034.866) (-1037.592) [-1038.252] -- 0:01:49
192000 -- (-1039.928) (-1040.287) (-1044.988) [-1036.468] * [-1034.861] (-1036.874) (-1040.450) (-1039.854) -- 0:01:53
192500 -- (-1038.950) (-1042.255) (-1041.850) [-1035.748] * (-1041.071) (-1036.034) (-1036.633) [-1038.232] -- 0:01:53
193000 -- (-1038.549) (-1039.528) (-1049.335) [-1036.074] * (-1043.072) (-1038.924) (-1040.758) [-1039.776] -- 0:01:52
193500 -- (-1047.105) [-1036.710] (-1039.022) (-1041.805) * (-1038.560) [-1037.172] (-1036.270) (-1039.403) -- 0:01:52
194000 -- (-1038.974) [-1037.578] (-1041.628) (-1042.401) * [-1038.354] (-1042.552) (-1037.592) (-1038.000) -- 0:01:52
194500 -- (-1037.033) [-1037.529] (-1042.168) (-1039.241) * (-1042.295) (-1037.834) (-1045.796) [-1038.074] -- 0:01:51
195000 -- (-1037.249) [-1033.869] (-1041.270) (-1043.020) * [-1035.670] (-1036.959) (-1039.985) (-1040.100) -- 0:01:51
Average standard deviation of split frequencies: 0.002405
195500 -- [-1037.499] (-1043.143) (-1048.735) (-1039.422) * (-1037.949) (-1041.845) [-1039.394] (-1039.674) -- 0:01:51
196000 -- (-1038.059) [-1036.907] (-1040.703) (-1036.855) * [-1035.751] (-1036.218) (-1042.061) (-1037.235) -- 0:01:50
196500 -- (-1047.326) (-1037.379) (-1037.580) [-1034.718] * (-1038.999) (-1040.249) (-1043.153) [-1039.232] -- 0:01:50
197000 -- (-1039.156) (-1044.242) (-1041.384) [-1037.904] * [-1036.440] (-1040.001) (-1037.572) (-1036.631) -- 0:01:50
197500 -- (-1040.478) [-1039.119] (-1040.654) (-1039.413) * (-1047.356) [-1039.523] (-1040.037) (-1041.938) -- 0:01:49
198000 -- [-1035.664] (-1037.049) (-1042.120) (-1037.462) * (-1038.465) (-1038.045) (-1041.217) [-1039.567] -- 0:01:49
198500 -- [-1036.985] (-1041.059) (-1039.318) (-1034.458) * (-1039.668) [-1041.164] (-1040.227) (-1038.223) -- 0:01:49
199000 -- (-1036.342) (-1040.270) (-1043.850) [-1038.847] * (-1037.158) [-1033.622] (-1042.718) (-1033.737) -- 0:01:52
199500 -- (-1040.132) (-1041.609) [-1041.435] (-1034.983) * (-1035.990) (-1036.926) (-1038.185) [-1040.828] -- 0:01:52
200000 -- (-1039.429) (-1041.167) [-1034.353] (-1038.044) * (-1044.909) (-1040.475) [-1036.098] (-1051.331) -- 0:01:51
Average standard deviation of split frequencies: 0.007048
200500 -- (-1034.333) (-1034.604) [-1040.458] (-1040.585) * (-1037.230) (-1038.262) [-1038.487] (-1039.986) -- 0:01:51
201000 -- (-1035.736) (-1042.997) [-1037.415] (-1038.975) * (-1042.671) (-1041.612) (-1039.895) [-1037.038] -- 0:01:51
201500 -- (-1038.195) (-1040.325) (-1036.604) [-1040.635] * (-1041.731) [-1036.015] (-1042.601) (-1035.568) -- 0:01:50
202000 -- [-1035.099] (-1042.920) (-1043.532) (-1038.414) * [-1038.611] (-1038.562) (-1041.633) (-1035.825) -- 0:01:50
202500 -- (-1041.394) (-1041.004) (-1037.824) [-1035.138] * [-1037.538] (-1035.364) (-1041.354) (-1037.887) -- 0:01:50
203000 -- (-1039.694) (-1033.604) [-1037.782] (-1041.036) * (-1037.040) [-1039.271] (-1041.596) (-1042.055) -- 0:01:49
203500 -- [-1038.314] (-1038.272) (-1049.815) (-1038.156) * [-1042.468] (-1048.649) (-1040.278) (-1036.774) -- 0:01:49
204000 -- (-1038.682) (-1038.982) [-1037.730] (-1039.899) * [-1037.312] (-1053.152) (-1034.832) (-1040.330) -- 0:01:49
204500 -- (-1037.305) [-1038.363] (-1043.096) (-1037.450) * (-1039.690) (-1041.802) [-1033.791] (-1042.818) -- 0:01:48
205000 -- (-1034.569) (-1035.308) [-1041.155] (-1038.808) * (-1042.997) (-1038.496) [-1039.924] (-1044.816) -- 0:01:48
Average standard deviation of split frequencies: 0.006865
205500 -- [-1042.688] (-1039.542) (-1036.378) (-1038.444) * [-1039.197] (-1043.465) (-1039.871) (-1045.318) -- 0:01:48
206000 -- (-1045.179) [-1037.412] (-1037.607) (-1038.239) * (-1039.081) (-1039.197) [-1033.851] (-1039.754) -- 0:01:47
206500 -- (-1045.622) (-1038.292) [-1039.890] (-1035.637) * [-1041.239] (-1040.711) (-1036.990) (-1048.161) -- 0:01:51
207000 -- (-1039.262) [-1040.350] (-1041.896) (-1035.212) * (-1043.052) (-1039.182) (-1035.075) [-1036.310] -- 0:01:51
207500 -- [-1038.708] (-1042.955) (-1035.663) (-1036.598) * (-1041.016) (-1040.860) (-1038.801) [-1041.609] -- 0:01:50
208000 -- [-1040.476] (-1041.544) (-1038.557) (-1041.150) * (-1038.128) [-1040.361] (-1041.026) (-1040.820) -- 0:01:50
208500 -- (-1035.122) (-1043.060) [-1036.250] (-1037.830) * (-1038.070) [-1041.675] (-1043.165) (-1038.027) -- 0:01:50
209000 -- (-1036.845) (-1046.158) (-1037.111) [-1036.016] * (-1038.591) (-1038.351) (-1039.588) [-1038.917] -- 0:01:49
209500 -- [-1039.652] (-1046.777) (-1040.903) (-1039.158) * (-1036.232) [-1033.758] (-1042.280) (-1037.285) -- 0:01:49
210000 -- [-1037.023] (-1041.226) (-1038.768) (-1037.765) * (-1037.666) (-1032.447) (-1041.133) [-1042.305] -- 0:01:49
Average standard deviation of split frequencies: 0.006713
210500 -- (-1041.820) (-1039.914) (-1038.609) [-1036.290] * (-1040.018) (-1036.850) (-1044.337) [-1037.231] -- 0:01:48
211000 -- (-1038.163) (-1039.983) [-1038.309] (-1038.274) * (-1038.002) (-1035.245) (-1041.874) [-1034.262] -- 0:01:48
211500 -- (-1038.447) (-1040.089) (-1038.633) [-1036.365] * [-1039.422] (-1045.014) (-1036.079) (-1038.794) -- 0:01:48
212000 -- (-1038.743) (-1042.974) [-1041.772] (-1039.012) * [-1035.704] (-1039.355) (-1046.779) (-1037.760) -- 0:01:47
212500 -- (-1039.971) [-1038.488] (-1039.497) (-1040.485) * (-1038.351) [-1038.614] (-1048.636) (-1036.383) -- 0:01:47
213000 -- (-1038.651) [-1036.823] (-1034.672) (-1042.990) * (-1038.040) (-1039.511) (-1047.104) [-1038.604] -- 0:01:47
213500 -- (-1037.162) (-1042.611) (-1034.223) [-1036.451] * (-1040.990) (-1035.802) [-1035.228] (-1039.956) -- 0:01:46
214000 -- [-1038.106] (-1037.129) (-1041.177) (-1041.041) * (-1038.438) (-1037.307) (-1038.338) [-1038.153] -- 0:01:50
214500 -- (-1035.670) (-1035.979) (-1037.431) [-1038.543] * (-1037.693) (-1037.910) [-1034.034] (-1037.595) -- 0:01:49
215000 -- [-1037.951] (-1040.954) (-1039.327) (-1043.955) * (-1039.431) [-1035.755] (-1040.018) (-1040.455) -- 0:01:49
Average standard deviation of split frequencies: 0.008730
215500 -- (-1043.403) (-1039.073) [-1036.308] (-1036.287) * (-1042.318) (-1040.436) (-1035.621) [-1037.101] -- 0:01:49
216000 -- (-1037.585) (-1046.163) (-1041.308) [-1034.960] * (-1039.047) (-1036.294) (-1038.430) [-1040.933] -- 0:01:48
216500 -- [-1035.739] (-1046.069) (-1040.807) (-1039.324) * (-1036.419) (-1036.570) [-1036.552] (-1034.933) -- 0:01:48
217000 -- (-1037.840) (-1041.916) (-1034.774) [-1036.066] * (-1036.286) (-1036.478) [-1033.613] (-1038.999) -- 0:01:48
217500 -- (-1035.975) (-1036.801) (-1041.719) [-1035.792] * [-1037.828] (-1036.121) (-1039.957) (-1036.084) -- 0:01:47
218000 -- (-1040.374) (-1042.002) [-1038.228] (-1035.909) * (-1040.010) (-1039.978) [-1041.822] (-1034.713) -- 0:01:47
218500 -- [-1035.969] (-1043.605) (-1041.583) (-1035.092) * (-1039.748) (-1037.229) (-1042.339) [-1039.283] -- 0:01:47
219000 -- (-1037.419) (-1035.517) (-1037.059) [-1034.898] * [-1039.198] (-1038.278) (-1043.169) (-1040.622) -- 0:01:46
219500 -- (-1041.759) (-1035.655) (-1039.845) [-1039.152] * [-1039.992] (-1037.371) (-1039.903) (-1044.395) -- 0:01:46
220000 -- (-1039.292) (-1043.208) [-1040.200] (-1039.746) * (-1040.492) (-1039.090) (-1040.725) [-1036.686] -- 0:01:46
Average standard deviation of split frequencies: 0.010681
220500 -- (-1036.141) (-1041.191) [-1036.766] (-1040.219) * [-1039.960] (-1040.140) (-1037.508) (-1039.224) -- 0:01:46
221000 -- [-1042.392] (-1039.481) (-1044.489) (-1032.829) * (-1037.697) [-1038.245] (-1039.374) (-1038.653) -- 0:01:45
221500 -- (-1043.751) [-1040.492] (-1040.050) (-1038.076) * (-1037.769) (-1036.561) (-1042.741) [-1040.303] -- 0:01:48
222000 -- [-1042.752] (-1036.175) (-1039.361) (-1038.549) * [-1036.785] (-1040.728) (-1042.688) (-1035.446) -- 0:01:48
222500 -- [-1038.898] (-1037.098) (-1036.379) (-1041.755) * (-1035.511) [-1034.533] (-1039.398) (-1036.409) -- 0:01:48
223000 -- [-1040.509] (-1044.545) (-1040.323) (-1046.389) * (-1037.186) (-1045.018) [-1040.722] (-1038.584) -- 0:01:48
223500 -- (-1039.428) [-1038.357] (-1036.013) (-1043.710) * (-1039.911) (-1039.743) [-1039.324] (-1043.397) -- 0:01:47
224000 -- (-1040.768) (-1043.222) [-1035.909] (-1038.954) * (-1037.950) [-1042.205] (-1039.519) (-1035.953) -- 0:01:47
224500 -- (-1039.763) (-1044.308) (-1041.671) [-1038.543] * [-1041.459] (-1039.616) (-1048.325) (-1038.693) -- 0:01:47
225000 -- (-1037.784) (-1042.623) (-1042.123) [-1039.490] * (-1050.741) (-1044.361) (-1043.348) [-1042.041] -- 0:01:46
Average standard deviation of split frequencies: 0.010429
225500 -- (-1040.691) (-1049.544) (-1038.901) [-1039.796] * (-1044.029) [-1037.608] (-1041.516) (-1042.923) -- 0:01:46
226000 -- [-1038.722] (-1041.567) (-1033.452) (-1040.313) * (-1044.160) (-1038.944) [-1037.799] (-1034.890) -- 0:01:46
226500 -- (-1037.159) (-1042.514) [-1040.887] (-1039.866) * [-1042.931] (-1042.792) (-1039.957) (-1038.351) -- 0:01:45
227000 -- (-1033.983) (-1041.508) [-1039.232] (-1039.382) * [-1037.209] (-1038.507) (-1039.271) (-1036.682) -- 0:01:45
227500 -- (-1037.829) (-1039.105) [-1036.517] (-1039.053) * (-1040.284) (-1042.359) [-1036.434] (-1040.295) -- 0:01:45
228000 -- (-1047.048) (-1038.574) (-1037.966) [-1038.293] * (-1044.300) (-1046.404) [-1034.043] (-1038.290) -- 0:01:44
228500 -- (-1049.243) (-1044.532) (-1038.124) [-1037.575] * (-1043.575) (-1041.720) [-1035.722] (-1039.995) -- 0:01:44
229000 -- (-1048.070) (-1044.506) (-1044.300) [-1038.099] * (-1037.298) [-1035.452] (-1039.667) (-1046.760) -- 0:01:47
229500 -- (-1041.327) [-1039.162] (-1040.430) (-1045.783) * (-1037.135) (-1037.550) (-1037.505) [-1040.756] -- 0:01:47
230000 -- [-1038.034] (-1040.771) (-1044.074) (-1047.080) * (-1047.330) (-1036.482) (-1042.896) [-1040.872] -- 0:01:47
Average standard deviation of split frequencies: 0.012262
230500 -- (-1040.204) [-1045.932] (-1041.801) (-1037.069) * [-1036.998] (-1037.900) (-1041.443) (-1056.157) -- 0:01:46
231000 -- (-1036.855) (-1040.478) [-1036.785] (-1038.496) * (-1037.587) (-1040.908) (-1039.008) [-1042.788] -- 0:01:46
231500 -- (-1035.729) (-1036.264) (-1043.745) [-1043.040] * (-1039.379) (-1035.751) [-1035.220] (-1044.816) -- 0:01:46
232000 -- (-1041.981) [-1037.454] (-1035.962) (-1037.343) * (-1034.886) (-1035.188) (-1039.654) [-1039.443] -- 0:01:45
232500 -- (-1038.213) (-1036.071) [-1033.819] (-1040.861) * (-1044.593) (-1035.963) (-1042.025) [-1037.381] -- 0:01:45
233000 -- (-1039.858) (-1037.383) (-1036.617) [-1034.042] * [-1041.974] (-1038.002) (-1039.518) (-1039.468) -- 0:01:45
233500 -- (-1044.953) (-1041.350) [-1034.250] (-1040.255) * (-1038.666) (-1038.303) (-1041.852) [-1041.493] -- 0:01:45
234000 -- [-1043.798] (-1041.510) (-1035.727) (-1039.482) * (-1037.177) (-1039.757) [-1038.090] (-1042.499) -- 0:01:44
234500 -- (-1039.605) (-1039.419) (-1039.235) [-1038.805] * [-1037.961] (-1041.940) (-1041.514) (-1039.056) -- 0:01:44
235000 -- [-1035.300] (-1037.829) (-1033.643) (-1033.702) * [-1037.731] (-1038.292) (-1052.008) (-1040.089) -- 0:01:44
Average standard deviation of split frequencies: 0.009987
235500 -- (-1038.245) (-1036.795) (-1038.535) [-1035.885] * (-1040.923) (-1036.861) (-1046.715) [-1041.258] -- 0:01:43
236000 -- (-1042.212) (-1037.793) (-1039.069) [-1036.823] * (-1041.058) [-1034.109] (-1040.625) (-1044.431) -- 0:01:46
236500 -- [-1036.773] (-1039.366) (-1037.657) (-1035.654) * (-1039.095) [-1038.881] (-1039.012) (-1040.285) -- 0:01:46
237000 -- (-1035.799) (-1036.862) [-1039.146] (-1034.852) * (-1042.179) [-1035.449] (-1043.777) (-1041.730) -- 0:01:46
237500 -- (-1040.600) (-1043.246) [-1042.740] (-1036.430) * (-1041.593) [-1033.304] (-1040.449) (-1039.713) -- 0:01:45
238000 -- (-1040.737) (-1045.035) [-1037.393] (-1039.083) * (-1036.628) (-1036.757) (-1041.050) [-1042.721] -- 0:01:45
238500 -- (-1045.113) [-1038.109] (-1036.302) (-1037.614) * (-1038.708) (-1035.036) (-1042.825) [-1037.808] -- 0:01:45
239000 -- [-1041.855] (-1038.532) (-1041.008) (-1035.528) * (-1039.703) (-1041.682) [-1041.070] (-1035.018) -- 0:01:45
239500 -- (-1038.734) [-1036.296] (-1039.676) (-1034.183) * (-1036.362) (-1040.322) [-1040.274] (-1034.495) -- 0:01:44
240000 -- [-1041.586] (-1041.012) (-1037.027) (-1034.413) * (-1046.404) (-1043.668) (-1039.882) [-1036.481] -- 0:01:44
Average standard deviation of split frequencies: 0.003917
240500 -- (-1041.175) (-1040.203) [-1038.147] (-1037.354) * (-1036.104) [-1036.528] (-1035.191) (-1033.891) -- 0:01:44
241000 -- (-1037.439) [-1038.534] (-1036.857) (-1039.931) * (-1039.716) (-1036.260) (-1036.955) [-1035.694] -- 0:01:43
241500 -- (-1039.493) (-1040.178) (-1035.718) [-1037.856] * (-1044.286) (-1037.588) [-1037.449] (-1037.544) -- 0:01:43
242000 -- (-1036.776) (-1041.908) [-1037.962] (-1035.298) * (-1044.867) (-1037.490) (-1038.630) [-1034.671] -- 0:01:43
242500 -- (-1039.753) (-1040.096) (-1040.281) [-1037.255] * (-1035.832) (-1041.936) [-1038.416] (-1043.008) -- 0:01:43
243000 -- (-1037.231) (-1032.995) (-1044.486) [-1039.822] * [-1037.615] (-1039.920) (-1039.110) (-1039.787) -- 0:01:42
243500 -- (-1038.748) (-1043.037) (-1046.087) [-1037.112] * (-1037.607) (-1038.730) (-1038.969) [-1032.929] -- 0:01:45
244000 -- (-1035.234) [-1034.405] (-1043.049) (-1039.931) * [-1038.191] (-1036.835) (-1041.977) (-1037.568) -- 0:01:45
244500 -- [-1042.324] (-1036.946) (-1051.530) (-1041.290) * [-1037.282] (-1044.404) (-1038.636) (-1035.415) -- 0:01:45
245000 -- (-1040.762) (-1037.695) (-1048.282) [-1040.013] * (-1037.385) (-1036.376) [-1034.204] (-1039.849) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
245500 -- (-1040.666) [-1041.098] (-1040.714) (-1037.112) * (-1036.751) (-1046.828) (-1041.690) [-1037.510] -- 0:01:44
246000 -- (-1043.471) (-1037.769) (-1047.024) [-1035.815] * (-1042.759) (-1039.788) [-1037.320] (-1041.355) -- 0:01:44
246500 -- (-1045.063) (-1036.230) [-1046.514] (-1035.116) * (-1045.468) (-1046.001) (-1037.789) [-1037.765] -- 0:01:43
247000 -- [-1040.167] (-1044.030) (-1045.364) (-1035.245) * [-1038.279] (-1048.880) (-1037.229) (-1051.736) -- 0:01:43
247500 -- (-1034.570) (-1041.193) (-1039.899) [-1034.990] * (-1042.443) (-1047.885) [-1035.941] (-1037.460) -- 0:01:43
248000 -- (-1033.560) (-1042.857) [-1039.749] (-1039.947) * (-1041.330) [-1042.091] (-1034.485) (-1034.711) -- 0:01:43
248500 -- (-1036.214) (-1038.768) (-1043.160) [-1041.659] * (-1043.281) (-1038.566) [-1036.964] (-1039.183) -- 0:01:42
249000 -- [-1035.792] (-1037.481) (-1041.732) (-1037.905) * (-1036.980) [-1036.942] (-1035.379) (-1040.269) -- 0:01:42
249500 -- (-1042.112) (-1041.331) [-1044.976] (-1046.361) * (-1035.240) (-1037.187) (-1043.884) [-1034.605] -- 0:01:42
250000 -- (-1039.208) (-1041.401) (-1042.315) [-1036.642] * (-1039.280) [-1041.355] (-1039.799) (-1032.929) -- 0:01:42
Average standard deviation of split frequencies: 0.000000
250500 -- [-1038.021] (-1041.429) (-1037.630) (-1036.963) * (-1034.637) [-1041.054] (-1041.258) (-1037.009) -- 0:01:41
251000 -- (-1036.602) (-1035.923) (-1037.996) [-1038.650] * (-1042.531) [-1044.274] (-1039.041) (-1045.441) -- 0:01:44
251500 -- [-1045.936] (-1038.447) (-1042.831) (-1035.538) * (-1040.045) (-1037.142) [-1038.297] (-1038.396) -- 0:01:44
252000 -- [-1038.861] (-1035.686) (-1044.073) (-1034.435) * (-1039.284) [-1040.371] (-1036.825) (-1035.677) -- 0:01:43
252500 -- (-1037.681) [-1038.748] (-1044.088) (-1035.476) * [-1038.580] (-1039.730) (-1041.624) (-1039.381) -- 0:01:43
253000 -- (-1036.894) (-1042.068) [-1038.148] (-1041.321) * (-1039.500) [-1036.021] (-1042.459) (-1040.787) -- 0:01:43
253500 -- (-1036.599) [-1034.047] (-1042.273) (-1042.686) * [-1042.802] (-1044.141) (-1042.619) (-1043.163) -- 0:01:43
254000 -- [-1038.145] (-1039.999) (-1046.703) (-1040.506) * [-1038.467] (-1040.526) (-1041.638) (-1037.149) -- 0:01:42
254500 -- (-1039.943) (-1038.108) [-1043.233] (-1045.567) * (-1037.014) [-1040.263] (-1039.026) (-1034.324) -- 0:01:42
255000 -- (-1039.270) (-1038.169) [-1045.492] (-1046.379) * [-1035.926] (-1040.298) (-1041.808) (-1040.851) -- 0:01:42
Average standard deviation of split frequencies: 0.001841
255500 -- (-1034.749) (-1036.941) [-1044.914] (-1044.738) * (-1034.361) [-1044.835] (-1036.946) (-1040.195) -- 0:01:41
256000 -- [-1035.390] (-1047.848) (-1048.224) (-1045.797) * (-1035.302) (-1047.384) [-1037.159] (-1035.019) -- 0:01:41
256500 -- (-1041.653) (-1046.489) (-1040.195) [-1042.091] * [-1038.780] (-1042.169) (-1040.008) (-1033.962) -- 0:01:41
257000 -- (-1035.494) [-1034.752] (-1039.822) (-1042.423) * (-1041.945) (-1042.107) [-1038.435] (-1037.043) -- 0:01:41
257500 -- (-1037.687) (-1039.249) [-1039.632] (-1045.461) * [-1034.162] (-1039.717) (-1040.144) (-1039.921) -- 0:01:40
258000 -- [-1034.351] (-1034.870) (-1035.075) (-1045.719) * (-1038.930) (-1040.413) [-1037.621] (-1036.213) -- 0:01:43
258500 -- [-1039.128] (-1035.449) (-1034.384) (-1042.379) * (-1047.543) [-1040.804] (-1037.453) (-1039.496) -- 0:01:43
259000 -- (-1037.437) [-1033.735] (-1039.548) (-1042.638) * (-1036.207) (-1042.678) (-1040.579) [-1041.411] -- 0:01:42
259500 -- (-1038.662) [-1033.348] (-1046.655) (-1039.007) * (-1039.728) (-1040.093) (-1040.772) [-1040.142] -- 0:01:42
260000 -- [-1043.407] (-1040.234) (-1038.666) (-1034.055) * (-1042.613) (-1045.928) [-1043.008] (-1050.189) -- 0:01:42
Average standard deviation of split frequencies: 0.005425
260500 -- (-1036.653) (-1038.269) [-1038.958] (-1039.452) * (-1038.795) (-1039.260) [-1039.240] (-1038.311) -- 0:01:42
261000 -- (-1036.614) (-1043.018) (-1054.164) [-1044.364] * [-1037.325] (-1038.373) (-1041.743) (-1042.476) -- 0:01:41
261500 -- [-1039.118] (-1046.669) (-1043.781) (-1043.860) * (-1044.570) (-1036.474) (-1041.671) [-1035.063] -- 0:01:41
262000 -- (-1037.008) (-1045.786) (-1042.942) [-1041.339] * (-1044.963) (-1043.037) (-1038.499) [-1035.833] -- 0:01:41
262500 -- (-1035.394) (-1039.059) [-1037.476] (-1039.132) * (-1051.204) [-1037.826] (-1039.718) (-1039.953) -- 0:01:41
263000 -- (-1034.690) (-1036.462) (-1037.369) [-1037.323] * (-1045.109) (-1041.225) (-1038.243) [-1040.809] -- 0:01:40
263500 -- (-1040.065) (-1036.941) [-1038.455] (-1036.327) * (-1044.013) (-1043.014) [-1042.659] (-1053.884) -- 0:01:40
264000 -- [-1037.560] (-1039.184) (-1035.332) (-1050.493) * (-1041.914) (-1038.700) [-1041.384] (-1037.055) -- 0:01:40
264500 -- (-1036.299) (-1038.485) [-1038.921] (-1041.463) * [-1038.695] (-1035.931) (-1046.331) (-1038.016) -- 0:01:40
265000 -- (-1047.236) (-1040.704) (-1040.166) [-1043.473] * (-1033.929) (-1035.907) [-1037.915] (-1037.522) -- 0:01:39
Average standard deviation of split frequencies: 0.008861
265500 -- (-1036.135) [-1043.691] (-1040.277) (-1040.598) * (-1036.746) (-1041.996) [-1036.658] (-1041.078) -- 0:01:42
266000 -- (-1035.345) [-1040.897] (-1035.740) (-1039.986) * [-1037.027] (-1040.451) (-1035.274) (-1036.516) -- 0:01:42
266500 -- [-1039.821] (-1044.745) (-1035.721) (-1036.989) * (-1036.708) (-1039.902) (-1039.125) [-1035.849] -- 0:01:41
267000 -- (-1041.298) (-1040.570) (-1037.232) [-1041.055] * [-1034.083] (-1041.879) (-1037.777) (-1040.072) -- 0:01:41
267500 -- (-1036.061) (-1036.533) (-1037.683) [-1038.201] * (-1040.503) (-1035.653) [-1036.789] (-1048.223) -- 0:01:41
268000 -- [-1036.009] (-1038.245) (-1041.654) (-1036.982) * [-1035.129] (-1037.417) (-1039.872) (-1045.072) -- 0:01:41
268500 -- (-1039.177) (-1039.634) (-1043.903) [-1041.166] * [-1036.884] (-1039.941) (-1045.269) (-1044.067) -- 0:01:40
269000 -- (-1041.071) (-1037.284) [-1038.022] (-1034.194) * (-1039.439) (-1039.918) (-1044.650) [-1039.898] -- 0:01:40
269500 -- (-1045.926) [-1035.312] (-1042.162) (-1034.577) * (-1034.864) (-1041.740) (-1042.800) [-1047.171] -- 0:01:40
270000 -- [-1049.000] (-1037.596) (-1046.975) (-1038.158) * (-1038.702) (-1035.655) [-1041.605] (-1039.742) -- 0:01:40
Average standard deviation of split frequencies: 0.013933
270500 -- (-1048.129) (-1034.674) [-1036.861] (-1036.433) * (-1043.474) (-1039.178) [-1038.636] (-1037.653) -- 0:01:39
271000 -- (-1050.200) (-1041.962) [-1036.653] (-1035.429) * (-1042.371) (-1037.886) [-1045.365] (-1041.201) -- 0:01:39
271500 -- [-1044.596] (-1039.323) (-1047.295) (-1037.953) * (-1040.357) (-1037.937) (-1042.729) [-1036.188] -- 0:01:39
272000 -- (-1037.429) (-1040.372) [-1038.792] (-1034.954) * (-1037.004) (-1041.058) (-1038.278) [-1037.407] -- 0:01:39
272500 -- (-1043.734) (-1037.117) [-1040.886] (-1034.687) * (-1039.203) (-1039.480) [-1039.847] (-1039.274) -- 0:01:38
273000 -- [-1035.913] (-1039.134) (-1043.876) (-1039.595) * (-1041.019) (-1043.188) (-1038.715) [-1031.761] -- 0:01:41
273500 -- [-1040.995] (-1040.196) (-1050.422) (-1040.578) * [-1042.436] (-1045.853) (-1040.247) (-1034.850) -- 0:01:40
274000 -- (-1036.744) (-1043.702) (-1038.595) [-1036.133] * (-1037.369) (-1043.378) (-1040.551) [-1040.476] -- 0:01:40
274500 -- (-1038.401) [-1037.041] (-1035.927) (-1036.487) * (-1043.229) (-1040.228) (-1038.180) [-1037.372] -- 0:01:40
275000 -- [-1039.776] (-1040.978) (-1039.869) (-1041.424) * (-1035.855) (-1042.955) (-1035.818) [-1039.609] -- 0:01:40
Average standard deviation of split frequencies: 0.013664
275500 -- (-1037.127) (-1042.172) (-1040.812) [-1036.612] * (-1038.663) [-1038.146] (-1037.092) (-1039.304) -- 0:01:39
276000 -- (-1036.323) [-1045.899] (-1041.151) (-1041.705) * (-1043.140) (-1038.705) (-1039.971) [-1033.839] -- 0:01:39
276500 -- (-1036.449) [-1034.956] (-1038.167) (-1036.314) * (-1039.561) (-1041.005) [-1037.036] (-1040.450) -- 0:01:39
277000 -- (-1041.212) (-1035.979) (-1039.432) [-1040.568] * (-1043.477) (-1038.948) (-1040.684) [-1040.030] -- 0:01:39
277500 -- (-1042.820) (-1038.992) (-1039.511) [-1034.134] * (-1037.511) [-1036.517] (-1047.670) (-1038.974) -- 0:01:38
278000 -- (-1043.607) (-1034.132) (-1036.976) [-1042.939] * (-1042.345) (-1036.472) (-1041.444) [-1033.192] -- 0:01:38
278500 -- (-1035.055) (-1043.695) [-1032.667] (-1036.806) * [-1041.697] (-1040.880) (-1041.190) (-1039.383) -- 0:01:38
279000 -- [-1046.329] (-1035.419) (-1035.222) (-1034.993) * (-1037.242) (-1037.322) [-1034.458] (-1032.753) -- 0:01:38
279500 -- (-1039.891) (-1039.993) [-1038.708] (-1040.600) * (-1040.870) (-1041.537) (-1035.515) [-1037.304] -- 0:01:37
280000 -- (-1037.466) (-1038.811) [-1035.117] (-1040.124) * (-1036.231) (-1041.805) (-1037.356) [-1044.914] -- 0:01:37
Average standard deviation of split frequencies: 0.013437
280500 -- (-1038.002) [-1039.233] (-1045.811) (-1034.570) * (-1042.187) [-1037.614] (-1036.367) (-1035.895) -- 0:01:40
281000 -- [-1039.151] (-1039.527) (-1040.712) (-1039.196) * (-1040.521) (-1038.469) [-1038.120] (-1036.536) -- 0:01:39
281500 -- [-1038.213] (-1040.725) (-1041.579) (-1036.559) * (-1043.762) (-1035.858) [-1039.848] (-1037.443) -- 0:01:39
282000 -- (-1041.758) (-1037.299) (-1041.303) [-1039.026] * (-1045.340) [-1036.580] (-1040.392) (-1034.513) -- 0:01:39
282500 -- [-1039.923] (-1039.955) (-1038.659) (-1040.286) * (-1036.532) (-1041.337) [-1038.772] (-1038.051) -- 0:01:39
283000 -- [-1037.762] (-1039.435) (-1040.260) (-1037.320) * (-1035.695) (-1036.521) (-1038.451) [-1036.326] -- 0:01:38
283500 -- [-1039.606] (-1034.350) (-1036.815) (-1038.393) * [-1040.477] (-1039.876) (-1041.835) (-1035.772) -- 0:01:38
284000 -- (-1038.095) [-1037.192] (-1037.517) (-1040.679) * (-1039.053) (-1040.939) [-1036.940] (-1041.473) -- 0:01:38
284500 -- [-1038.980] (-1037.052) (-1037.214) (-1036.576) * (-1043.506) (-1034.805) (-1046.723) [-1036.435] -- 0:01:38
285000 -- (-1035.838) [-1038.420] (-1037.425) (-1035.470) * (-1040.106) (-1038.606) [-1041.151] (-1037.914) -- 0:01:37
Average standard deviation of split frequencies: 0.013186
285500 -- (-1034.029) (-1039.369) [-1037.440] (-1042.809) * (-1038.101) [-1041.451] (-1039.856) (-1047.665) -- 0:01:37
286000 -- (-1036.644) [-1035.931] (-1041.462) (-1037.397) * (-1044.268) [-1045.149] (-1040.330) (-1036.009) -- 0:01:37
286500 -- (-1042.785) [-1034.591] (-1037.719) (-1038.765) * (-1038.203) (-1042.259) (-1042.556) [-1034.931] -- 0:01:37
287000 -- (-1039.159) (-1044.839) (-1039.181) [-1038.089] * (-1043.917) (-1038.087) [-1035.058] (-1041.523) -- 0:01:36
287500 -- (-1039.396) [-1034.811] (-1036.264) (-1036.891) * (-1037.283) [-1039.141] (-1034.326) (-1035.883) -- 0:01:39
288000 -- (-1035.870) (-1035.419) (-1037.677) [-1037.494] * [-1041.010] (-1036.119) (-1039.611) (-1039.784) -- 0:01:38
288500 -- (-1036.921) [-1041.534] (-1038.375) (-1038.373) * (-1038.273) (-1043.602) [-1038.430] (-1041.957) -- 0:01:38
289000 -- (-1039.011) (-1037.574) (-1044.873) [-1039.491] * [-1040.541] (-1042.184) (-1036.650) (-1046.193) -- 0:01:38
289500 -- (-1034.472) (-1041.395) [-1034.246] (-1043.868) * (-1038.417) (-1054.163) [-1034.165] (-1044.558) -- 0:01:38
290000 -- (-1039.753) (-1042.540) [-1031.667] (-1039.309) * [-1033.721] (-1043.170) (-1038.538) (-1038.668) -- 0:01:37
Average standard deviation of split frequencies: 0.014596
290500 -- (-1038.399) (-1041.729) [-1035.955] (-1036.099) * (-1038.224) (-1041.773) (-1038.333) [-1035.474] -- 0:01:37
291000 -- [-1043.376] (-1048.717) (-1033.489) (-1042.206) * (-1038.079) (-1043.906) (-1037.211) [-1040.524] -- 0:01:37
291500 -- [-1041.223] (-1047.620) (-1040.687) (-1038.898) * [-1037.219] (-1037.942) (-1045.664) (-1049.253) -- 0:01:37
292000 -- [-1038.085] (-1049.332) (-1038.781) (-1041.868) * [-1037.656] (-1046.891) (-1038.262) (-1040.167) -- 0:01:36
292500 -- [-1037.672] (-1055.020) (-1036.198) (-1043.691) * (-1034.400) (-1041.019) [-1037.655] (-1041.195) -- 0:01:36
293000 -- (-1039.895) (-1043.456) (-1038.865) [-1036.223] * [-1034.574] (-1040.458) (-1037.616) (-1041.373) -- 0:01:36
293500 -- [-1037.949] (-1043.812) (-1036.474) (-1047.197) * (-1035.643) (-1034.581) [-1045.225] (-1036.637) -- 0:01:36
294000 -- (-1037.647) (-1038.088) [-1036.082] (-1042.690) * (-1035.873) (-1035.520) (-1039.720) [-1039.068] -- 0:01:36
294500 -- [-1038.489] (-1035.129) (-1040.121) (-1046.656) * (-1035.395) (-1045.053) [-1036.169] (-1038.206) -- 0:01:35
295000 -- [-1034.782] (-1037.602) (-1037.790) (-1042.305) * (-1039.282) (-1037.681) [-1034.619] (-1042.043) -- 0:01:37
Average standard deviation of split frequencies: 0.009555
295500 -- (-1040.120) (-1036.974) [-1035.424] (-1037.271) * (-1038.772) (-1041.097) [-1033.413] (-1034.203) -- 0:01:37
296000 -- [-1042.728] (-1044.368) (-1036.857) (-1045.617) * (-1039.656) (-1037.192) [-1041.201] (-1036.422) -- 0:01:37
296500 -- (-1044.113) (-1038.681) (-1040.450) [-1036.230] * (-1036.359) [-1037.795] (-1037.565) (-1035.382) -- 0:01:37
297000 -- (-1040.520) (-1034.508) [-1038.110] (-1033.145) * (-1038.600) (-1039.253) (-1048.259) [-1037.974] -- 0:01:37
297500 -- (-1041.793) (-1043.680) [-1038.341] (-1032.340) * (-1039.592) (-1043.784) (-1038.642) [-1037.358] -- 0:01:36
298000 -- (-1036.619) (-1038.787) [-1040.461] (-1040.462) * (-1039.192) [-1036.638] (-1037.238) (-1035.989) -- 0:01:36
298500 -- (-1039.887) [-1037.991] (-1040.743) (-1041.858) * (-1035.824) [-1036.002] (-1041.844) (-1045.275) -- 0:01:36
299000 -- (-1039.068) (-1034.510) [-1046.109] (-1035.404) * (-1038.932) (-1039.420) (-1035.698) [-1035.453] -- 0:01:36
299500 -- (-1036.723) (-1036.928) (-1041.335) [-1035.888] * (-1039.022) (-1041.429) [-1034.291] (-1040.298) -- 0:01:35
300000 -- (-1039.298) [-1043.636] (-1041.185) (-1041.640) * [-1039.755] (-1042.156) (-1037.129) (-1038.721) -- 0:01:35
Average standard deviation of split frequencies: 0.009407
300500 -- [-1040.715] (-1038.476) (-1038.210) (-1039.154) * (-1036.275) (-1044.752) (-1034.819) [-1032.832] -- 0:01:35
301000 -- (-1047.060) (-1042.755) (-1042.637) [-1037.497] * [-1034.707] (-1045.596) (-1041.149) (-1040.055) -- 0:01:35
301500 -- (-1040.688) (-1044.180) [-1044.348] (-1040.411) * [-1041.425] (-1036.634) (-1037.835) (-1034.100) -- 0:01:34
302000 -- (-1037.440) [-1035.239] (-1040.102) (-1045.872) * (-1038.396) (-1045.593) (-1036.153) [-1037.845] -- 0:01:34
302500 -- [-1038.259] (-1040.247) (-1042.636) (-1040.910) * (-1041.403) (-1045.338) [-1034.477] (-1038.712) -- 0:01:36
303000 -- [-1040.113] (-1039.389) (-1043.185) (-1035.459) * (-1045.562) (-1039.115) (-1037.151) [-1038.184] -- 0:01:36
303500 -- [-1039.636] (-1039.825) (-1037.784) (-1037.314) * (-1040.528) [-1043.220] (-1040.114) (-1032.912) -- 0:01:36
304000 -- (-1037.434) (-1035.749) [-1032.877] (-1039.989) * (-1044.276) [-1044.929] (-1042.611) (-1036.772) -- 0:01:36
304500 -- (-1039.332) (-1040.323) (-1036.997) [-1037.276] * [-1042.342] (-1040.651) (-1040.764) (-1038.790) -- 0:01:35
305000 -- [-1035.721] (-1040.106) (-1041.413) (-1044.093) * (-1044.397) (-1043.313) (-1041.455) [-1036.676] -- 0:01:35
Average standard deviation of split frequencies: 0.009243
305500 -- (-1038.277) (-1044.627) (-1046.550) [-1041.403] * (-1045.394) (-1046.086) (-1036.599) [-1036.298] -- 0:01:35
306000 -- (-1041.470) [-1033.041] (-1039.958) (-1038.518) * (-1042.449) (-1037.163) (-1036.072) [-1034.051] -- 0:01:35
306500 -- (-1040.337) (-1039.581) [-1046.017] (-1037.060) * (-1038.936) [-1037.943] (-1034.971) (-1036.443) -- 0:01:35
307000 -- (-1043.320) (-1035.400) (-1044.737) [-1038.561] * [-1038.514] (-1036.380) (-1038.249) (-1036.204) -- 0:01:34
307500 -- (-1039.129) [-1038.351] (-1050.340) (-1048.954) * (-1039.260) (-1037.296) [-1039.042] (-1036.161) -- 0:01:34
308000 -- (-1046.111) (-1038.755) (-1050.071) [-1046.184] * (-1050.430) [-1033.043] (-1038.679) (-1032.263) -- 0:01:34
308500 -- [-1040.049] (-1036.277) (-1050.558) (-1035.957) * (-1039.500) (-1035.362) [-1039.045] (-1035.266) -- 0:01:34
309000 -- (-1041.986) (-1037.912) (-1039.458) [-1042.557] * (-1037.354) (-1035.073) [-1039.299] (-1045.059) -- 0:01:33
309500 -- (-1035.065) (-1037.179) [-1040.683] (-1039.350) * [-1033.159] (-1036.916) (-1036.690) (-1040.953) -- 0:01:33
310000 -- (-1044.309) (-1039.247) [-1042.379] (-1037.964) * (-1040.402) (-1040.246) (-1040.989) [-1037.188] -- 0:01:35
Average standard deviation of split frequencies: 0.009104
310500 -- (-1039.021) (-1042.963) [-1036.260] (-1039.950) * (-1038.329) (-1042.851) (-1046.169) [-1046.701] -- 0:01:35
311000 -- [-1036.474] (-1038.946) (-1036.313) (-1034.712) * (-1038.199) (-1037.349) (-1039.491) [-1037.306] -- 0:01:35
311500 -- (-1037.415) (-1039.691) (-1040.811) [-1035.273] * (-1043.150) (-1039.960) (-1040.494) [-1037.048] -- 0:01:35
312000 -- (-1035.641) [-1040.032] (-1040.136) (-1038.390) * (-1038.905) (-1042.744) (-1034.438) [-1042.481] -- 0:01:34
312500 -- (-1039.632) (-1038.109) (-1045.359) [-1044.579] * (-1048.605) (-1043.082) [-1039.264] (-1037.901) -- 0:01:34
313000 -- [-1037.658] (-1040.638) (-1035.599) (-1045.349) * (-1034.425) (-1044.471) [-1040.087] (-1041.398) -- 0:01:34
313500 -- (-1036.173) [-1050.261] (-1035.239) (-1039.993) * (-1037.173) (-1042.291) [-1035.880] (-1033.853) -- 0:01:34
314000 -- [-1034.249] (-1035.757) (-1039.180) (-1044.717) * (-1037.227) (-1042.595) (-1036.068) [-1034.668] -- 0:01:33
314500 -- (-1037.605) [-1036.968] (-1038.087) (-1040.173) * (-1037.728) (-1042.533) (-1036.200) [-1035.478] -- 0:01:33
315000 -- (-1047.535) [-1037.855] (-1036.718) (-1035.568) * (-1044.028) (-1040.101) (-1036.012) [-1039.924] -- 0:01:33
Average standard deviation of split frequencies: 0.005967
315500 -- [-1035.644] (-1041.672) (-1038.405) (-1038.634) * [-1037.392] (-1036.673) (-1044.240) (-1036.397) -- 0:01:33
316000 -- [-1035.579] (-1039.863) (-1034.527) (-1037.552) * [-1039.459] (-1043.157) (-1037.914) (-1037.658) -- 0:01:33
316500 -- (-1036.510) (-1037.136) (-1036.545) [-1034.542] * (-1036.247) (-1046.713) (-1039.594) [-1035.426] -- 0:01:32
317000 -- (-1041.785) (-1037.179) [-1039.202] (-1039.532) * (-1038.753) [-1041.334] (-1037.643) (-1040.123) -- 0:01:34
317500 -- (-1035.824) [-1044.287] (-1045.194) (-1037.281) * (-1041.925) [-1035.897] (-1033.272) (-1044.808) -- 0:01:34
318000 -- (-1037.358) (-1046.888) [-1037.374] (-1036.446) * (-1040.082) [-1040.789] (-1037.944) (-1034.078) -- 0:01:34
318500 -- (-1036.603) (-1042.243) (-1036.909) [-1039.617] * (-1046.899) (-1039.633) (-1037.680) [-1035.276] -- 0:01:34
319000 -- [-1034.569] (-1039.108) (-1037.724) (-1037.865) * (-1047.359) (-1044.241) (-1039.659) [-1035.086] -- 0:01:33
319500 -- (-1038.626) (-1042.800) [-1039.116] (-1039.066) * (-1044.172) (-1040.057) [-1035.131] (-1042.459) -- 0:01:33
320000 -- (-1040.580) (-1038.031) [-1043.534] (-1043.347) * (-1042.946) (-1040.823) (-1039.723) [-1042.092] -- 0:01:33
Average standard deviation of split frequencies: 0.005880
320500 -- (-1044.365) (-1039.302) [-1040.548] (-1033.963) * [-1041.417] (-1041.972) (-1040.213) (-1037.284) -- 0:01:33
321000 -- [-1036.608] (-1046.645) (-1041.154) (-1041.673) * (-1036.511) [-1036.291] (-1042.718) (-1040.372) -- 0:01:33
321500 -- (-1041.362) (-1038.808) [-1035.899] (-1035.565) * [-1035.548] (-1047.258) (-1043.102) (-1041.909) -- 0:01:32
322000 -- (-1038.764) (-1043.218) (-1044.273) [-1039.171] * (-1037.993) (-1035.676) [-1033.135] (-1040.346) -- 0:01:32
322500 -- [-1035.240] (-1042.245) (-1035.218) (-1042.139) * [-1038.620] (-1036.905) (-1042.440) (-1036.504) -- 0:01:32
323000 -- [-1039.143] (-1049.560) (-1039.958) (-1046.865) * (-1037.977) [-1040.031] (-1047.524) (-1038.827) -- 0:01:32
323500 -- (-1038.699) (-1048.622) [-1035.066] (-1034.906) * (-1040.244) (-1044.337) (-1037.912) [-1038.033] -- 0:01:32
324000 -- [-1033.670] (-1037.106) (-1034.051) (-1036.054) * (-1044.996) [-1035.391] (-1041.654) (-1046.777) -- 0:01:31
324500 -- (-1040.922) (-1037.536) [-1034.649] (-1034.020) * (-1036.641) [-1042.063] (-1049.575) (-1038.078) -- 0:01:33
325000 -- (-1038.926) [-1034.198] (-1043.363) (-1035.201) * [-1048.115] (-1035.409) (-1039.927) (-1040.508) -- 0:01:33
Average standard deviation of split frequencies: 0.001446
325500 -- (-1048.431) (-1040.076) [-1041.959] (-1039.170) * [-1036.625] (-1034.057) (-1038.000) (-1040.195) -- 0:01:33
326000 -- [-1037.938] (-1037.650) (-1039.780) (-1046.895) * [-1036.768] (-1039.945) (-1039.735) (-1038.342) -- 0:01:33
326500 -- [-1038.672] (-1036.065) (-1034.592) (-1044.722) * (-1040.697) (-1039.159) [-1038.627] (-1035.687) -- 0:01:32
327000 -- [-1036.231] (-1038.538) (-1038.589) (-1049.018) * [-1036.307] (-1041.732) (-1042.807) (-1044.388) -- 0:01:32
327500 -- (-1036.605) (-1044.466) [-1039.151] (-1042.271) * [-1038.746] (-1047.969) (-1042.936) (-1036.612) -- 0:01:32
328000 -- (-1046.043) (-1043.813) [-1036.116] (-1037.148) * [-1040.706] (-1041.217) (-1047.578) (-1039.579) -- 0:01:32
328500 -- (-1035.723) (-1039.066) [-1034.491] (-1032.716) * (-1035.995) [-1040.476] (-1043.799) (-1035.375) -- 0:01:31
329000 -- (-1040.919) (-1038.267) [-1036.205] (-1033.547) * (-1042.476) (-1040.164) (-1040.786) [-1036.655] -- 0:01:31
329500 -- (-1035.605) (-1036.251) (-1042.310) [-1036.036] * (-1038.449) [-1041.604] (-1040.109) (-1042.451) -- 0:01:31
330000 -- (-1042.694) (-1039.187) (-1040.990) [-1037.063] * (-1035.594) (-1042.306) [-1043.287] (-1037.358) -- 0:01:31
Average standard deviation of split frequencies: 0.004277
330500 -- (-1036.083) [-1037.721] (-1039.284) (-1035.398) * (-1034.854) (-1036.560) [-1037.987] (-1041.259) -- 0:01:31
331000 -- (-1036.113) (-1047.543) (-1038.498) [-1040.243] * (-1035.868) [-1040.306] (-1040.534) (-1040.564) -- 0:01:30
331500 -- [-1037.865] (-1042.037) (-1036.984) (-1036.841) * (-1038.520) (-1038.179) [-1037.337] (-1044.842) -- 0:01:30
332000 -- (-1037.230) (-1040.796) (-1042.649) [-1039.189] * (-1037.777) (-1040.542) [-1039.834] (-1044.044) -- 0:01:32
332500 -- [-1037.832] (-1036.614) (-1037.035) (-1038.809) * [-1043.233] (-1041.208) (-1037.203) (-1044.512) -- 0:01:32
333000 -- (-1042.605) (-1037.314) (-1035.799) [-1032.426] * (-1042.719) (-1040.303) (-1044.914) [-1042.227] -- 0:01:32
333500 -- (-1046.116) (-1040.641) [-1036.005] (-1033.253) * [-1037.361] (-1042.575) (-1042.816) (-1045.497) -- 0:01:31
334000 -- (-1045.325) (-1043.328) (-1037.909) [-1037.232] * (-1041.078) [-1040.659] (-1040.936) (-1038.199) -- 0:01:31
334500 -- (-1040.551) (-1042.249) (-1039.324) [-1036.569] * (-1034.009) (-1036.607) [-1042.903] (-1039.881) -- 0:01:31
335000 -- (-1040.908) [-1043.129] (-1036.781) (-1041.961) * (-1041.076) [-1039.233] (-1041.626) (-1042.822) -- 0:01:31
Average standard deviation of split frequencies: 0.002806
335500 -- (-1032.808) (-1039.899) (-1037.836) [-1039.543] * [-1038.513] (-1037.297) (-1042.403) (-1036.748) -- 0:01:31
336000 -- (-1034.906) [-1036.385] (-1041.706) (-1037.683) * [-1041.076] (-1040.071) (-1047.748) (-1046.899) -- 0:01:30
336500 -- [-1033.238] (-1035.706) (-1039.640) (-1046.619) * (-1036.257) (-1039.660) [-1035.859] (-1045.169) -- 0:01:30
337000 -- [-1035.995] (-1037.307) (-1037.731) (-1041.406) * [-1039.433] (-1039.901) (-1041.911) (-1039.658) -- 0:01:30
337500 -- [-1035.059] (-1038.413) (-1043.181) (-1038.321) * (-1038.953) (-1040.080) (-1037.912) [-1040.719] -- 0:01:30
338000 -- [-1040.521] (-1046.987) (-1033.830) (-1037.852) * (-1043.895) (-1039.736) (-1041.260) [-1040.587] -- 0:01:30
338500 -- (-1041.371) [-1037.461] (-1039.091) (-1038.097) * [-1037.245] (-1040.099) (-1033.760) (-1037.400) -- 0:01:29
339000 -- [-1036.852] (-1039.618) (-1044.752) (-1040.581) * (-1044.287) [-1042.081] (-1040.511) (-1042.727) -- 0:01:29
339500 -- (-1034.645) [-1042.551] (-1041.893) (-1040.400) * [-1035.266] (-1039.808) (-1050.238) (-1043.830) -- 0:01:31
340000 -- [-1039.839] (-1037.195) (-1037.166) (-1038.363) * [-1035.096] (-1037.715) (-1040.398) (-1046.769) -- 0:01:31
Average standard deviation of split frequencies: 0.001384
340500 -- [-1035.774] (-1038.251) (-1037.349) (-1047.688) * (-1038.915) (-1044.524) [-1038.822] (-1044.092) -- 0:01:31
341000 -- (-1037.068) [-1038.432] (-1033.655) (-1043.414) * (-1039.028) [-1033.622] (-1047.736) (-1038.890) -- 0:01:30
341500 -- (-1036.862) (-1037.612) [-1031.640] (-1037.695) * [-1035.334] (-1038.750) (-1037.593) (-1044.156) -- 0:01:30
342000 -- (-1036.882) (-1042.898) (-1042.265) [-1035.547] * [-1036.575] (-1039.485) (-1038.426) (-1043.347) -- 0:01:30
342500 -- (-1033.863) (-1037.493) [-1041.198] (-1038.181) * (-1039.204) (-1040.339) (-1035.035) [-1038.840] -- 0:01:30
343000 -- (-1035.735) (-1041.777) (-1038.641) [-1039.813] * [-1045.747] (-1039.851) (-1037.846) (-1040.852) -- 0:01:30
343500 -- (-1041.186) [-1038.969] (-1037.657) (-1038.738) * [-1038.742] (-1036.583) (-1041.977) (-1038.638) -- 0:01:29
344000 -- (-1036.511) [-1034.757] (-1035.920) (-1039.868) * (-1040.368) (-1036.630) (-1039.053) [-1040.251] -- 0:01:29
344500 -- (-1034.915) [-1035.562] (-1037.703) (-1040.794) * (-1040.600) [-1042.219] (-1042.514) (-1039.733) -- 0:01:29
345000 -- (-1039.758) [-1036.366] (-1041.375) (-1036.079) * [-1037.416] (-1041.022) (-1040.339) (-1036.235) -- 0:01:29
Average standard deviation of split frequencies: 0.000000
345500 -- (-1038.293) (-1036.588) [-1035.402] (-1043.740) * [-1044.613] (-1037.892) (-1039.044) (-1035.079) -- 0:01:29
346000 -- (-1039.714) (-1043.353) [-1038.356] (-1038.746) * (-1049.510) (-1040.011) (-1032.740) [-1037.807] -- 0:01:28
346500 -- (-1035.308) (-1042.872) (-1038.122) [-1034.837] * (-1042.903) (-1043.391) [-1040.886] (-1042.070) -- 0:01:28
347000 -- (-1045.920) (-1044.463) (-1041.588) [-1035.521] * (-1042.807) (-1041.380) [-1036.969] (-1047.353) -- 0:01:30
347500 -- (-1035.241) (-1038.524) (-1046.794) [-1035.632] * (-1038.985) (-1039.821) (-1032.448) [-1041.484] -- 0:01:30
348000 -- (-1037.927) (-1039.634) (-1039.854) [-1035.578] * [-1037.545] (-1042.561) (-1038.614) (-1038.085) -- 0:01:29
348500 -- [-1038.773] (-1043.774) (-1035.317) (-1035.731) * [-1038.610] (-1043.820) (-1037.107) (-1036.196) -- 0:01:29
349000 -- (-1040.866) [-1038.000] (-1042.719) (-1036.712) * (-1041.503) (-1042.838) [-1038.446] (-1036.604) -- 0:01:29
349500 -- (-1035.749) (-1044.520) [-1036.822] (-1036.996) * (-1036.776) (-1049.612) (-1040.461) [-1034.658] -- 0:01:29
350000 -- (-1035.501) (-1043.896) (-1046.812) [-1039.925] * [-1042.411] (-1039.388) (-1045.306) (-1043.499) -- 0:01:29
Average standard deviation of split frequencies: 0.002689
350500 -- (-1036.592) (-1047.567) [-1045.644] (-1042.121) * (-1044.004) (-1040.669) [-1035.869] (-1045.252) -- 0:01:28
351000 -- (-1039.607) (-1041.231) [-1041.692] (-1048.258) * (-1038.015) [-1038.106] (-1037.722) (-1038.970) -- 0:01:28
351500 -- (-1044.629) [-1038.824] (-1038.214) (-1049.701) * (-1042.425) (-1044.412) [-1036.855] (-1044.737) -- 0:01:28
352000 -- (-1040.933) (-1038.156) [-1037.683] (-1040.642) * (-1038.808) [-1039.690] (-1038.536) (-1036.734) -- 0:01:28
352500 -- (-1034.604) (-1040.798) (-1041.763) [-1039.667] * (-1042.782) (-1044.850) (-1039.583) [-1040.774] -- 0:01:28
353000 -- (-1040.250) (-1037.310) (-1040.122) [-1036.086] * (-1037.287) (-1040.541) (-1035.933) [-1034.885] -- 0:01:27
353500 -- (-1042.906) [-1044.213] (-1039.678) (-1044.137) * (-1035.308) (-1041.062) (-1035.171) [-1045.034] -- 0:01:27
354000 -- (-1037.282) (-1034.509) [-1039.301] (-1033.750) * (-1048.993) (-1038.009) [-1038.862] (-1049.626) -- 0:01:29
354500 -- (-1038.481) [-1037.960] (-1040.488) (-1034.427) * [-1036.953] (-1035.349) (-1038.128) (-1042.140) -- 0:01:29
355000 -- [-1045.588] (-1040.509) (-1036.311) (-1039.012) * [-1039.549] (-1038.899) (-1040.684) (-1044.444) -- 0:01:29
Average standard deviation of split frequencies: 0.001324
355500 -- [-1039.264] (-1037.964) (-1037.484) (-1039.624) * [-1035.527] (-1041.028) (-1040.615) (-1038.571) -- 0:01:28
356000 -- (-1044.363) (-1037.826) (-1036.690) [-1043.454] * [-1038.884] (-1039.318) (-1044.498) (-1042.463) -- 0:01:28
356500 -- (-1039.161) [-1035.542] (-1037.774) (-1041.997) * [-1032.798] (-1041.792) (-1043.371) (-1038.698) -- 0:01:28
357000 -- [-1037.149] (-1046.623) (-1035.615) (-1045.459) * [-1039.013] (-1040.574) (-1038.875) (-1041.719) -- 0:01:28
357500 -- (-1037.962) (-1041.374) [-1035.806] (-1041.724) * (-1040.448) (-1038.124) [-1038.216] (-1046.175) -- 0:01:28
358000 -- (-1039.704) [-1046.965] (-1037.624) (-1040.098) * [-1041.049] (-1038.776) (-1037.200) (-1044.773) -- 0:01:27
358500 -- (-1037.333) (-1052.622) [-1035.453] (-1046.028) * (-1046.102) (-1036.162) (-1039.526) [-1038.407] -- 0:01:27
359000 -- (-1042.798) (-1040.076) [-1040.542] (-1038.115) * [-1037.365] (-1039.623) (-1034.201) (-1036.820) -- 0:01:27
359500 -- (-1040.636) (-1042.403) (-1038.056) [-1039.509] * [-1041.029] (-1035.856) (-1041.569) (-1044.802) -- 0:01:27
360000 -- [-1042.038] (-1038.631) (-1039.586) (-1039.689) * [-1037.300] (-1037.527) (-1038.343) (-1041.048) -- 0:01:27
Average standard deviation of split frequencies: 0.001307
360500 -- (-1041.129) [-1039.122] (-1040.720) (-1039.901) * (-1042.607) (-1035.115) [-1038.998] (-1035.785) -- 0:01:26
361000 -- [-1033.389] (-1034.066) (-1038.165) (-1037.034) * (-1040.263) [-1037.485] (-1037.877) (-1035.942) -- 0:01:26
361500 -- [-1035.630] (-1038.586) (-1037.925) (-1040.244) * [-1035.341] (-1040.366) (-1046.630) (-1036.221) -- 0:01:28
362000 -- (-1039.467) (-1046.723) [-1038.409] (-1037.453) * [-1037.227] (-1036.622) (-1040.273) (-1041.127) -- 0:01:28
362500 -- [-1041.745] (-1043.433) (-1040.123) (-1036.957) * [-1042.049] (-1042.855) (-1041.313) (-1040.857) -- 0:01:27
363000 -- [-1043.994] (-1045.312) (-1039.502) (-1037.493) * [-1038.003] (-1039.948) (-1045.589) (-1039.748) -- 0:01:27
363500 -- (-1037.436) (-1039.965) [-1045.580] (-1037.893) * [-1035.956] (-1035.518) (-1037.530) (-1043.161) -- 0:01:27
364000 -- (-1044.003) [-1033.384] (-1043.923) (-1038.615) * (-1040.801) [-1038.686] (-1036.597) (-1043.765) -- 0:01:27
364500 -- (-1036.541) (-1040.781) [-1039.278] (-1037.050) * (-1037.557) [-1036.351] (-1044.011) (-1037.713) -- 0:01:27
365000 -- (-1042.857) (-1041.055) (-1038.247) [-1038.201] * (-1038.873) (-1037.473) [-1039.164] (-1041.334) -- 0:01:26
Average standard deviation of split frequencies: 0.003864
365500 -- (-1037.252) (-1039.021) [-1035.704] (-1038.152) * [-1036.941] (-1039.287) (-1048.615) (-1039.283) -- 0:01:26
366000 -- (-1038.046) (-1036.339) (-1037.992) [-1040.341] * [-1037.852] (-1034.470) (-1041.259) (-1040.730) -- 0:01:26
366500 -- [-1042.742] (-1037.217) (-1036.874) (-1043.204) * (-1047.633) (-1040.609) [-1037.320] (-1040.205) -- 0:01:26
367000 -- [-1041.473] (-1042.478) (-1034.243) (-1037.391) * (-1035.501) (-1036.441) (-1044.903) [-1035.563] -- 0:01:26
367500 -- (-1042.631) (-1040.637) [-1037.157] (-1038.474) * (-1040.629) (-1038.779) (-1046.528) [-1034.422] -- 0:01:26
368000 -- (-1036.502) (-1045.566) [-1037.082] (-1046.654) * (-1041.604) (-1043.788) [-1038.913] (-1039.960) -- 0:01:25
368500 -- (-1041.493) (-1037.408) [-1036.937] (-1046.292) * [-1034.754] (-1042.965) (-1040.141) (-1041.447) -- 0:01:25
369000 -- [-1039.823] (-1040.326) (-1036.261) (-1038.785) * [-1034.726] (-1040.173) (-1036.591) (-1042.500) -- 0:01:27
369500 -- [-1037.826] (-1037.027) (-1039.196) (-1040.928) * (-1038.881) [-1034.002] (-1034.851) (-1039.240) -- 0:01:27
370000 -- [-1038.980] (-1043.409) (-1045.408) (-1039.732) * [-1041.500] (-1046.018) (-1037.617) (-1041.177) -- 0:01:26
Average standard deviation of split frequencies: 0.003815
370500 -- (-1034.446) [-1040.164] (-1039.790) (-1037.253) * (-1039.298) (-1036.914) [-1048.767] (-1039.655) -- 0:01:26
371000 -- (-1037.824) [-1037.459] (-1036.962) (-1037.369) * (-1039.313) [-1037.674] (-1041.267) (-1040.851) -- 0:01:26
371500 -- (-1040.034) [-1036.314] (-1038.910) (-1039.323) * (-1042.009) [-1040.373] (-1034.273) (-1042.714) -- 0:01:26
372000 -- (-1043.388) [-1034.948] (-1039.099) (-1045.146) * (-1038.500) [-1040.072] (-1038.074) (-1039.696) -- 0:01:26
372500 -- (-1043.875) [-1036.125] (-1035.450) (-1046.164) * (-1048.690) [-1033.613] (-1040.742) (-1040.819) -- 0:01:25
373000 -- (-1041.257) [-1034.095] (-1043.848) (-1041.210) * [-1037.425] (-1038.678) (-1038.689) (-1044.793) -- 0:01:25
373500 -- (-1048.165) (-1035.909) (-1035.534) [-1047.896] * [-1047.379] (-1038.476) (-1038.124) (-1040.472) -- 0:01:25
374000 -- [-1042.960] (-1039.887) (-1044.301) (-1049.975) * (-1046.357) [-1042.872] (-1035.629) (-1036.270) -- 0:01:25
374500 -- (-1048.797) [-1038.438] (-1036.493) (-1049.520) * (-1040.155) (-1048.135) [-1035.216] (-1039.692) -- 0:01:25
375000 -- (-1037.521) [-1036.513] (-1042.979) (-1042.783) * (-1047.007) (-1047.010) (-1038.114) [-1035.903] -- 0:01:25
Average standard deviation of split frequencies: 0.006269
375500 -- (-1040.022) (-1035.388) [-1040.484] (-1042.398) * (-1039.666) (-1040.384) [-1036.573] (-1040.027) -- 0:01:24
376000 -- (-1041.688) (-1038.840) [-1036.279] (-1041.692) * (-1039.559) (-1041.849) (-1036.835) [-1034.470] -- 0:01:26
376500 -- (-1038.536) [-1043.144] (-1041.522) (-1039.452) * (-1037.941) (-1043.740) [-1037.897] (-1038.428) -- 0:01:26
377000 -- (-1039.915) (-1035.871) [-1041.863] (-1042.290) * [-1044.622] (-1046.082) (-1041.201) (-1035.156) -- 0:01:25
377500 -- (-1035.612) (-1033.789) (-1042.299) [-1039.644] * (-1046.889) (-1043.756) [-1038.200] (-1039.562) -- 0:01:25
378000 -- (-1036.549) (-1040.802) (-1038.902) [-1037.197] * (-1038.754) (-1045.759) [-1049.298] (-1036.747) -- 0:01:25
378500 -- (-1038.906) (-1039.181) (-1038.380) [-1037.626] * [-1038.712] (-1042.494) (-1041.055) (-1040.162) -- 0:01:25
379000 -- (-1035.869) (-1037.160) [-1038.238] (-1051.545) * (-1038.324) (-1041.760) (-1041.890) [-1043.678] -- 0:01:25
379500 -- (-1037.169) [-1038.776] (-1042.764) (-1041.127) * [-1036.466] (-1043.346) (-1042.387) (-1036.890) -- 0:01:25
380000 -- (-1038.152) (-1042.520) (-1041.151) [-1034.056] * (-1041.121) (-1045.575) [-1040.520] (-1042.851) -- 0:01:24
Average standard deviation of split frequencies: 0.008669
380500 -- (-1044.263) [-1041.088] (-1049.272) (-1039.070) * (-1037.709) (-1047.301) [-1045.581] (-1036.844) -- 0:01:24
381000 -- (-1041.256) (-1049.172) (-1043.245) [-1043.762] * [-1037.814] (-1035.753) (-1038.386) (-1037.610) -- 0:01:24
381500 -- (-1035.635) (-1041.006) [-1037.328] (-1044.928) * [-1037.879] (-1038.104) (-1035.282) (-1040.751) -- 0:01:24
382000 -- (-1043.994) (-1037.987) [-1035.819] (-1042.896) * (-1041.005) [-1041.013] (-1040.456) (-1049.741) -- 0:01:24
382500 -- (-1041.579) [-1036.174] (-1040.103) (-1041.609) * (-1047.136) (-1046.498) [-1038.814] (-1045.936) -- 0:01:23
383000 -- (-1042.278) (-1047.141) [-1037.815] (-1040.628) * [-1046.126] (-1049.921) (-1037.141) (-1040.109) -- 0:01:23
383500 -- (-1048.431) (-1036.790) [-1033.622] (-1037.209) * (-1045.712) (-1045.754) [-1039.073] (-1040.357) -- 0:01:25
384000 -- (-1039.315) (-1034.520) [-1037.858] (-1048.372) * (-1041.041) (-1048.514) [-1040.122] (-1038.492) -- 0:01:25
384500 -- (-1036.795) [-1038.974] (-1039.378) (-1041.349) * (-1041.903) (-1044.214) (-1038.722) [-1038.734] -- 0:01:24
385000 -- (-1037.455) (-1038.059) (-1035.767) [-1038.821] * (-1036.586) (-1047.065) (-1037.291) [-1041.378] -- 0:01:24
Average standard deviation of split frequencies: 0.008549
385500 -- (-1035.778) (-1038.415) [-1033.444] (-1035.867) * (-1033.804) (-1041.534) [-1037.276] (-1039.259) -- 0:01:24
386000 -- [-1033.426] (-1043.094) (-1038.200) (-1038.104) * (-1035.069) (-1042.348) [-1037.202] (-1039.880) -- 0:01:24
386500 -- (-1033.553) (-1036.325) (-1045.243) [-1040.396] * (-1035.010) (-1034.559) [-1035.338] (-1037.389) -- 0:01:24
387000 -- [-1033.945] (-1036.103) (-1054.239) (-1037.659) * (-1039.010) [-1036.048] (-1034.334) (-1037.657) -- 0:01:23
387500 -- (-1042.159) (-1039.413) [-1047.941] (-1046.282) * (-1040.549) (-1040.710) [-1035.742] (-1040.706) -- 0:01:23
388000 -- (-1039.427) (-1041.681) (-1048.416) [-1034.839] * (-1038.920) [-1037.694] (-1041.425) (-1036.655) -- 0:01:23
388500 -- (-1040.438) (-1038.586) (-1044.506) [-1035.905] * (-1044.452) (-1039.313) (-1040.353) [-1040.370] -- 0:01:23
389000 -- [-1037.589] (-1039.617) (-1044.107) (-1037.795) * (-1043.682) (-1043.471) [-1038.453] (-1038.522) -- 0:01:23
389500 -- (-1036.105) (-1037.402) [-1043.683] (-1034.886) * (-1042.407) (-1038.057) [-1041.158] (-1035.437) -- 0:01:24
390000 -- (-1038.316) [-1039.998] (-1039.829) (-1036.326) * [-1038.137] (-1039.347) (-1036.688) (-1037.686) -- 0:01:24
Average standard deviation of split frequencies: 0.006033
390500 -- [-1037.744] (-1033.726) (-1037.405) (-1036.039) * [-1037.867] (-1036.203) (-1037.344) (-1038.736) -- 0:01:24
391000 -- (-1039.727) (-1040.663) [-1036.967] (-1035.922) * (-1043.566) [-1036.309] (-1041.142) (-1039.786) -- 0:01:24
391500 -- (-1040.143) (-1041.682) [-1040.191] (-1036.237) * (-1042.639) (-1032.080) (-1039.758) [-1037.374] -- 0:01:23
392000 -- [-1037.395] (-1039.642) (-1041.441) (-1038.447) * (-1044.518) (-1037.116) [-1037.469] (-1036.737) -- 0:01:23
392500 -- [-1036.777] (-1038.712) (-1036.891) (-1050.343) * (-1043.061) [-1039.400] (-1038.845) (-1043.470) -- 0:01:23
393000 -- (-1036.527) [-1035.806] (-1038.929) (-1050.450) * (-1037.344) (-1043.713) (-1037.933) [-1040.282] -- 0:01:23
393500 -- (-1043.235) [-1038.387] (-1036.336) (-1053.946) * (-1038.351) (-1037.483) [-1036.558] (-1044.108) -- 0:01:23
394000 -- (-1048.085) (-1037.391) [-1037.618] (-1050.565) * (-1040.934) (-1042.016) [-1039.461] (-1043.511) -- 0:01:23
394500 -- (-1044.365) (-1034.299) (-1037.655) [-1038.484] * (-1037.665) (-1042.008) [-1040.870] (-1040.181) -- 0:01:22
395000 -- (-1047.866) [-1033.772] (-1037.119) (-1040.385) * [-1036.646] (-1038.655) (-1037.532) (-1039.134) -- 0:01:22
Average standard deviation of split frequencies: 0.004762
395500 -- (-1050.198) (-1041.636) [-1035.812] (-1039.953) * (-1037.994) (-1042.170) (-1041.178) [-1038.444] -- 0:01:22
396000 -- [-1041.870] (-1038.819) (-1035.485) (-1037.500) * (-1037.269) [-1040.005] (-1035.718) (-1038.754) -- 0:01:22
396500 -- (-1042.752) (-1041.111) (-1033.442) [-1035.124] * (-1039.882) [-1039.668] (-1040.941) (-1043.061) -- 0:01:22
397000 -- (-1045.942) [-1035.967] (-1040.252) (-1036.735) * (-1033.765) (-1035.858) (-1041.620) [-1038.352] -- 0:01:23
397500 -- (-1047.137) (-1046.072) (-1041.282) [-1034.931] * (-1035.693) (-1038.935) [-1036.619] (-1038.016) -- 0:01:23
398000 -- (-1038.226) (-1042.614) (-1041.417) [-1036.894] * (-1034.481) (-1045.162) (-1035.668) [-1034.130] -- 0:01:23
398500 -- (-1038.526) (-1045.693) (-1041.882) [-1041.067] * (-1040.777) [-1039.470] (-1038.830) (-1034.609) -- 0:01:23
399000 -- (-1039.218) (-1040.199) [-1039.166] (-1037.814) * [-1040.985] (-1045.300) (-1038.496) (-1036.596) -- 0:01:22
399500 -- (-1042.793) (-1038.673) [-1038.041] (-1046.395) * (-1040.966) [-1037.474] (-1039.343) (-1040.589) -- 0:01:22
400000 -- (-1035.325) (-1036.549) (-1044.938) [-1043.451] * [-1035.118] (-1042.291) (-1044.221) (-1037.610) -- 0:01:22
Average standard deviation of split frequencies: 0.003530
400500 -- (-1039.492) (-1039.200) [-1041.002] (-1035.608) * (-1039.307) (-1040.506) (-1037.325) [-1034.651] -- 0:01:22
401000 -- (-1033.858) (-1039.998) [-1036.632] (-1038.621) * (-1042.060) (-1038.575) [-1038.795] (-1041.231) -- 0:01:22
401500 -- (-1042.866) [-1035.363] (-1036.297) (-1043.827) * (-1038.328) (-1036.362) (-1039.388) [-1036.018] -- 0:01:21
402000 -- (-1038.878) (-1037.576) [-1044.119] (-1038.015) * [-1040.220] (-1039.362) (-1038.551) (-1040.433) -- 0:01:21
402500 -- (-1038.205) (-1037.988) (-1037.260) [-1038.702] * (-1040.606) [-1035.759] (-1043.265) (-1040.198) -- 0:01:21
403000 -- (-1040.907) (-1037.500) (-1038.939) [-1043.086] * (-1039.369) (-1041.771) (-1041.690) [-1036.111] -- 0:01:21
403500 -- [-1044.939] (-1038.132) (-1039.191) (-1040.958) * (-1039.151) (-1042.672) [-1041.958] (-1039.358) -- 0:01:21
404000 -- (-1045.202) [-1038.605] (-1036.065) (-1040.010) * (-1039.420) (-1050.881) (-1039.376) [-1036.992] -- 0:01:22
404500 -- (-1038.683) (-1039.826) (-1038.183) [-1041.995] * [-1037.287] (-1046.710) (-1039.354) (-1042.721) -- 0:01:22
405000 -- (-1040.978) (-1037.652) (-1035.447) [-1037.615] * (-1045.218) [-1039.726] (-1039.751) (-1038.306) -- 0:01:22
Average standard deviation of split frequencies: 0.004644
405500 -- (-1039.741) (-1044.664) [-1032.531] (-1037.761) * (-1042.141) [-1043.042] (-1037.940) (-1038.351) -- 0:01:22
406000 -- (-1038.552) [-1038.263] (-1038.696) (-1045.585) * (-1034.222) (-1040.512) (-1033.822) [-1035.662] -- 0:01:21
406500 -- (-1042.050) (-1042.255) [-1037.364] (-1046.990) * [-1040.044] (-1043.254) (-1038.068) (-1044.687) -- 0:01:21
407000 -- (-1042.899) (-1039.037) (-1034.818) [-1038.598] * [-1037.195] (-1042.625) (-1040.169) (-1040.028) -- 0:01:21
407500 -- [-1037.951] (-1036.817) (-1039.057) (-1037.485) * (-1036.785) (-1041.759) [-1036.645] (-1036.256) -- 0:01:21
408000 -- [-1037.506] (-1038.391) (-1040.063) (-1037.742) * [-1036.535] (-1041.335) (-1036.225) (-1038.443) -- 0:01:21
408500 -- (-1041.866) [-1036.604] (-1043.229) (-1040.744) * (-1038.002) [-1042.317] (-1035.201) (-1040.160) -- 0:01:21
409000 -- (-1037.626) [-1036.084] (-1039.718) (-1037.140) * [-1036.807] (-1037.109) (-1039.407) (-1040.495) -- 0:01:20
409500 -- (-1042.299) (-1039.595) [-1035.208] (-1040.883) * (-1049.416) [-1036.957] (-1040.548) (-1039.553) -- 0:01:20
410000 -- [-1038.219] (-1036.455) (-1035.216) (-1041.721) * (-1036.471) (-1040.467) (-1036.657) [-1037.199] -- 0:01:20
Average standard deviation of split frequencies: 0.004592
410500 -- [-1039.359] (-1039.004) (-1042.020) (-1041.873) * (-1036.258) [-1036.155] (-1035.796) (-1047.498) -- 0:01:20
411000 -- (-1039.729) [-1035.859] (-1040.219) (-1043.690) * (-1040.737) (-1040.434) (-1039.914) [-1037.181] -- 0:01:20
411500 -- [-1033.816] (-1038.154) (-1041.837) (-1040.418) * (-1039.330) (-1037.212) (-1035.789) [-1035.141] -- 0:01:21
412000 -- [-1039.851] (-1040.832) (-1045.071) (-1037.014) * (-1036.682) [-1041.133] (-1052.400) (-1036.737) -- 0:01:21
412500 -- (-1038.260) (-1038.075) [-1039.427] (-1041.711) * [-1039.373] (-1045.286) (-1041.365) (-1036.430) -- 0:01:21
413000 -- (-1042.643) (-1044.971) [-1036.962] (-1038.029) * (-1042.882) [-1036.884] (-1041.553) (-1037.576) -- 0:01:21
413500 -- (-1034.708) (-1050.480) (-1035.728) [-1039.567] * (-1045.138) (-1038.925) (-1044.276) [-1037.821] -- 0:01:20
414000 -- [-1039.650] (-1043.412) (-1041.005) (-1034.673) * (-1046.336) (-1038.669) [-1041.826] (-1036.856) -- 0:01:20
414500 -- (-1038.883) (-1041.397) (-1046.342) [-1038.850] * (-1036.078) (-1043.676) (-1043.472) [-1039.316] -- 0:01:20
415000 -- (-1033.770) (-1043.084) (-1040.566) [-1037.651] * (-1040.260) (-1043.457) (-1037.952) [-1039.697] -- 0:01:20
Average standard deviation of split frequencies: 0.005666
415500 -- (-1035.406) (-1044.219) [-1037.969] (-1039.360) * (-1039.501) [-1039.915] (-1037.346) (-1045.104) -- 0:01:20
416000 -- (-1040.424) (-1039.480) [-1039.350] (-1044.319) * (-1041.106) (-1046.120) [-1038.460] (-1038.003) -- 0:01:20
416500 -- (-1041.274) (-1041.786) [-1040.353] (-1040.634) * (-1038.660) (-1042.236) [-1038.465] (-1036.005) -- 0:01:19
417000 -- (-1040.555) (-1044.159) (-1045.753) [-1038.120] * (-1043.147) [-1038.430] (-1034.729) (-1037.400) -- 0:01:19
417500 -- [-1036.994] (-1040.179) (-1036.895) (-1037.976) * (-1039.804) [-1037.156] (-1042.761) (-1041.847) -- 0:01:19
418000 -- (-1039.119) [-1036.685] (-1040.835) (-1042.141) * (-1037.869) (-1036.353) (-1038.072) [-1037.096] -- 0:01:19
418500 -- [-1038.379] (-1038.909) (-1041.312) (-1038.328) * (-1034.892) (-1039.334) [-1040.708] (-1039.071) -- 0:01:19
419000 -- (-1040.613) (-1038.715) (-1038.599) [-1039.008] * (-1042.288) (-1036.121) [-1035.947] (-1037.136) -- 0:01:20
419500 -- [-1034.803] (-1036.750) (-1041.643) (-1042.747) * (-1035.842) (-1038.978) (-1042.958) [-1036.799] -- 0:01:20
420000 -- (-1038.182) (-1037.724) (-1043.195) [-1036.753] * [-1034.031] (-1038.722) (-1036.129) (-1052.039) -- 0:01:20
Average standard deviation of split frequencies: 0.006724
420500 -- (-1036.298) (-1045.682) (-1046.204) [-1033.965] * (-1035.272) (-1037.958) [-1032.547] (-1041.876) -- 0:01:19
421000 -- (-1038.806) [-1045.218] (-1036.729) (-1034.988) * [-1039.987] (-1042.326) (-1036.903) (-1037.280) -- 0:01:19
421500 -- (-1039.684) (-1043.445) [-1039.379] (-1036.684) * (-1039.035) [-1041.090] (-1044.587) (-1036.852) -- 0:01:19
422000 -- [-1035.416] (-1038.802) (-1041.946) (-1039.824) * (-1042.762) (-1038.779) (-1043.720) [-1042.993] -- 0:01:19
422500 -- (-1039.271) (-1037.309) (-1046.864) [-1036.380] * [-1040.917] (-1035.858) (-1039.644) (-1039.349) -- 0:01:19
423000 -- (-1045.372) (-1040.208) [-1034.882] (-1037.244) * (-1035.462) (-1043.966) [-1037.405] (-1035.362) -- 0:01:19
423500 -- (-1037.046) (-1042.186) [-1036.019] (-1036.840) * (-1041.370) (-1036.204) [-1039.233] (-1036.827) -- 0:01:18
424000 -- (-1039.826) (-1039.364) [-1035.655] (-1040.721) * [-1035.515] (-1039.822) (-1038.071) (-1037.048) -- 0:01:18
424500 -- [-1035.786] (-1039.688) (-1040.908) (-1037.282) * [-1034.806] (-1035.966) (-1040.640) (-1042.024) -- 0:01:18
425000 -- (-1041.860) (-1034.228) (-1037.925) [-1038.508] * (-1038.923) [-1039.358] (-1042.989) (-1040.562) -- 0:01:18
Average standard deviation of split frequencies: 0.006640
425500 -- (-1041.948) [-1035.545] (-1035.435) (-1042.021) * (-1042.222) (-1044.463) (-1039.276) [-1035.365] -- 0:01:18
426000 -- (-1041.014) (-1042.156) [-1038.773] (-1043.592) * [-1037.975] (-1043.995) (-1040.763) (-1038.060) -- 0:01:18
426500 -- (-1043.534) (-1040.537) [-1038.596] (-1047.695) * (-1042.871) (-1039.132) (-1044.440) [-1038.452] -- 0:01:19
427000 -- (-1037.852) (-1033.371) [-1034.918] (-1040.071) * (-1045.861) (-1043.436) [-1042.192] (-1037.496) -- 0:01:19
427500 -- (-1046.207) [-1034.510] (-1040.016) (-1037.284) * (-1039.197) (-1043.221) (-1048.557) [-1035.659] -- 0:01:19
428000 -- (-1041.722) (-1039.673) [-1039.419] (-1037.887) * (-1049.404) [-1038.087] (-1042.462) (-1039.275) -- 0:01:18
428500 -- (-1040.614) (-1046.063) (-1038.439) [-1039.571] * [-1041.389] (-1039.032) (-1039.386) (-1040.614) -- 0:01:18
429000 -- (-1036.475) [-1047.484] (-1044.384) (-1036.186) * (-1041.754) [-1040.376] (-1039.823) (-1043.067) -- 0:01:18
429500 -- (-1041.241) [-1038.788] (-1035.638) (-1038.192) * (-1040.098) (-1039.682) [-1042.290] (-1044.576) -- 0:01:18
430000 -- [-1037.927] (-1036.706) (-1040.566) (-1036.567) * [-1039.470] (-1039.995) (-1036.667) (-1045.993) -- 0:01:18
Average standard deviation of split frequencies: 0.007662
430500 -- (-1038.806) (-1039.509) (-1046.547) [-1036.821] * (-1041.482) (-1043.418) (-1041.737) [-1034.416] -- 0:01:18
431000 -- (-1040.448) (-1044.631) (-1040.610) [-1048.839] * (-1044.087) (-1038.324) [-1037.361] (-1038.157) -- 0:01:17
431500 -- [-1040.976] (-1046.110) (-1036.424) (-1042.167) * (-1036.325) (-1042.279) (-1033.845) [-1038.055] -- 0:01:17
432000 -- [-1042.644] (-1037.183) (-1042.880) (-1033.924) * (-1038.152) [-1039.986] (-1035.281) (-1040.070) -- 0:01:17
432500 -- [-1037.140] (-1041.925) (-1036.191) (-1039.629) * (-1047.328) (-1035.795) [-1039.301] (-1036.174) -- 0:01:17
433000 -- [-1036.350] (-1041.463) (-1040.142) (-1041.736) * (-1038.487) (-1038.471) (-1036.617) [-1040.460] -- 0:01:17
433500 -- (-1040.913) (-1038.830) [-1038.158] (-1035.312) * (-1038.243) (-1037.183) (-1040.375) [-1044.020] -- 0:01:17
434000 -- (-1039.959) (-1044.974) [-1041.511] (-1040.467) * [-1035.277] (-1039.983) (-1036.064) (-1042.654) -- 0:01:18
434500 -- (-1038.723) (-1038.197) (-1044.504) [-1031.809] * (-1040.995) (-1042.895) (-1036.648) [-1037.059] -- 0:01:18
435000 -- (-1041.445) [-1044.729] (-1040.351) (-1038.641) * (-1038.338) (-1037.507) [-1035.991] (-1041.214) -- 0:01:17
Average standard deviation of split frequencies: 0.007568
435500 -- (-1040.248) [-1035.608] (-1036.364) (-1039.895) * [-1048.390] (-1043.567) (-1040.127) (-1039.845) -- 0:01:17
436000 -- (-1036.826) (-1034.306) [-1037.370] (-1034.914) * [-1038.095] (-1037.772) (-1035.583) (-1041.001) -- 0:01:17
436500 -- (-1034.868) (-1033.892) (-1042.304) [-1035.872] * (-1040.846) (-1037.526) (-1037.775) [-1036.360] -- 0:01:17
437000 -- (-1044.849) (-1037.165) [-1040.169] (-1036.384) * (-1041.143) [-1036.719] (-1046.328) (-1039.701) -- 0:01:17
437500 -- (-1041.797) [-1042.275] (-1040.751) (-1041.950) * (-1040.964) [-1036.274] (-1040.243) (-1040.383) -- 0:01:17
438000 -- [-1043.135] (-1040.016) (-1041.332) (-1035.398) * (-1037.372) (-1038.724) (-1041.598) [-1039.236] -- 0:01:16
438500 -- (-1042.995) (-1040.191) (-1043.043) [-1039.201] * (-1038.987) (-1043.178) (-1037.703) [-1037.700] -- 0:01:16
439000 -- [-1038.461] (-1037.606) (-1041.653) (-1038.621) * (-1042.209) (-1045.640) [-1035.172] (-1036.837) -- 0:01:16
439500 -- (-1039.576) [-1037.010] (-1037.115) (-1033.969) * [-1037.893] (-1039.632) (-1039.024) (-1043.681) -- 0:01:16
440000 -- (-1041.662) [-1038.985] (-1046.286) (-1035.282) * (-1039.035) (-1040.351) [-1036.336] (-1043.674) -- 0:01:16
Average standard deviation of split frequencies: 0.008558
440500 -- [-1042.357] (-1038.799) (-1043.748) (-1037.779) * [-1041.648] (-1036.693) (-1034.230) (-1042.170) -- 0:01:16
441000 -- (-1042.321) (-1040.317) (-1040.489) [-1039.636] * (-1035.178) (-1050.429) (-1039.166) [-1045.127] -- 0:01:17
441500 -- (-1034.097) (-1039.751) [-1036.101] (-1040.749) * [-1035.982] (-1039.919) (-1042.036) (-1038.230) -- 0:01:17
442000 -- (-1037.178) (-1045.761) [-1036.527] (-1043.801) * (-1038.864) (-1042.077) (-1037.738) [-1039.830] -- 0:01:17
442500 -- (-1039.712) (-1038.416) (-1039.583) [-1042.127] * [-1038.238] (-1040.819) (-1039.459) (-1040.486) -- 0:01:16
443000 -- (-1042.661) (-1041.464) [-1036.429] (-1041.107) * [-1038.396] (-1042.245) (-1041.756) (-1037.334) -- 0:01:16
443500 -- [-1037.519] (-1041.635) (-1035.841) (-1036.951) * [-1035.458] (-1037.847) (-1043.339) (-1044.356) -- 0:01:16
444000 -- (-1038.469) [-1035.194] (-1040.698) (-1038.581) * (-1038.046) [-1035.966] (-1039.287) (-1039.720) -- 0:01:16
444500 -- (-1041.761) [-1039.415] (-1039.266) (-1042.980) * (-1035.818) [-1035.312] (-1040.490) (-1035.229) -- 0:01:16
445000 -- (-1035.456) (-1039.773) (-1037.721) [-1043.080] * [-1036.716] (-1037.028) (-1040.300) (-1039.758) -- 0:01:16
Average standard deviation of split frequencies: 0.009513
445500 -- (-1037.820) (-1046.453) [-1033.268] (-1048.015) * (-1038.253) (-1041.925) (-1041.152) [-1044.826] -- 0:01:15
446000 -- [-1040.762] (-1042.987) (-1038.214) (-1047.107) * (-1042.902) (-1040.100) (-1041.216) [-1039.467] -- 0:01:15
446500 -- [-1038.391] (-1040.120) (-1048.864) (-1040.292) * (-1042.660) (-1043.027) (-1042.084) [-1043.306] -- 0:01:15
447000 -- (-1043.517) [-1038.395] (-1036.393) (-1042.859) * (-1038.916) (-1049.561) [-1041.123] (-1045.399) -- 0:01:15
447500 -- (-1039.093) (-1033.104) (-1037.730) [-1038.846] * (-1041.249) (-1049.561) [-1038.353] (-1039.067) -- 0:01:15
448000 -- (-1036.379) (-1039.814) (-1039.612) [-1040.065] * [-1036.580] (-1042.106) (-1040.873) (-1037.591) -- 0:01:15
448500 -- (-1037.307) [-1037.841] (-1035.364) (-1041.195) * (-1035.883) [-1040.442] (-1043.966) (-1042.164) -- 0:01:16
449000 -- (-1036.655) [-1034.014] (-1044.782) (-1041.004) * (-1037.714) (-1045.382) [-1036.943] (-1039.302) -- 0:01:16
449500 -- (-1035.237) [-1036.191] (-1042.730) (-1043.853) * [-1033.754] (-1044.455) (-1040.747) (-1040.259) -- 0:01:15
450000 -- (-1036.592) (-1042.791) [-1039.060] (-1040.908) * [-1033.809] (-1038.525) (-1040.733) (-1036.627) -- 0:01:15
Average standard deviation of split frequencies: 0.010460
450500 -- (-1035.345) (-1040.241) [-1034.915] (-1040.673) * [-1034.790] (-1047.008) (-1038.755) (-1037.778) -- 0:01:15
451000 -- [-1037.220] (-1041.177) (-1041.592) (-1037.572) * (-1038.486) (-1046.214) [-1036.318] (-1036.406) -- 0:01:15
451500 -- (-1037.497) (-1042.510) (-1040.332) [-1033.616] * (-1040.483) [-1036.686] (-1038.283) (-1034.057) -- 0:01:15
452000 -- (-1039.174) [-1043.380] (-1043.140) (-1034.602) * (-1043.330) [-1035.066] (-1037.950) (-1039.468) -- 0:01:15
452500 -- (-1039.904) (-1033.201) [-1035.719] (-1035.016) * (-1040.884) (-1046.004) [-1035.540] (-1039.256) -- 0:01:15
453000 -- (-1041.424) [-1039.271] (-1037.310) (-1038.314) * (-1044.767) (-1041.301) (-1038.831) [-1038.200] -- 0:01:14
453500 -- (-1039.794) (-1041.535) [-1036.341] (-1035.316) * (-1041.045) [-1043.693] (-1036.761) (-1040.011) -- 0:01:14
454000 -- (-1035.091) [-1037.144] (-1037.456) (-1038.426) * (-1041.862) (-1045.968) (-1040.244) [-1035.980] -- 0:01:14
454500 -- (-1035.437) (-1041.795) (-1041.552) [-1042.197] * [-1040.324] (-1040.536) (-1040.427) (-1038.701) -- 0:01:14
455000 -- (-1048.765) [-1036.217] (-1034.332) (-1037.967) * [-1035.772] (-1043.861) (-1041.116) (-1041.426) -- 0:01:14
Average standard deviation of split frequencies: 0.011372
455500 -- [-1044.105] (-1040.108) (-1037.082) (-1038.324) * [-1040.485] (-1041.446) (-1041.432) (-1040.418) -- 0:01:14
456000 -- (-1037.018) [-1041.946] (-1041.612) (-1036.776) * (-1040.769) (-1040.694) [-1037.444] (-1044.674) -- 0:01:15
456500 -- [-1041.498] (-1036.041) (-1042.522) (-1037.967) * (-1037.527) [-1039.932] (-1037.127) (-1039.609) -- 0:01:15
457000 -- (-1037.652) [-1041.151] (-1036.204) (-1035.669) * (-1035.605) (-1038.858) (-1036.510) [-1039.885] -- 0:01:14
457500 -- (-1053.895) [-1036.905] (-1041.912) (-1037.297) * [-1038.203] (-1040.265) (-1039.987) (-1040.981) -- 0:01:14
458000 -- [-1045.531] (-1038.506) (-1043.401) (-1038.129) * (-1039.118) (-1033.261) (-1037.135) [-1041.953] -- 0:01:14
458500 -- [-1045.574] (-1041.108) (-1050.365) (-1034.090) * (-1033.933) (-1040.820) (-1041.060) [-1035.573] -- 0:01:14
459000 -- (-1040.536) [-1039.566] (-1044.202) (-1035.972) * (-1040.013) [-1036.745] (-1038.607) (-1037.762) -- 0:01:14
459500 -- (-1041.972) (-1042.489) (-1038.841) [-1038.563] * [-1039.015] (-1038.180) (-1038.077) (-1038.345) -- 0:01:14
460000 -- (-1045.604) [-1034.247] (-1035.346) (-1037.966) * (-1036.917) [-1035.990] (-1041.392) (-1040.161) -- 0:01:13
Average standard deviation of split frequencies: 0.015350
460500 -- (-1037.815) (-1040.861) [-1038.102] (-1042.007) * (-1035.967) (-1038.480) [-1038.445] (-1035.554) -- 0:01:13
461000 -- (-1035.458) [-1036.880] (-1042.036) (-1043.844) * (-1037.181) (-1043.667) [-1038.713] (-1047.943) -- 0:01:13
461500 -- [-1036.144] (-1037.513) (-1036.260) (-1039.638) * (-1036.840) [-1039.291] (-1035.711) (-1057.671) -- 0:01:13
462000 -- [-1046.596] (-1038.475) (-1035.861) (-1041.784) * (-1038.630) (-1045.001) [-1037.654] (-1045.971) -- 0:01:13
462500 -- (-1041.483) (-1042.513) [-1037.039] (-1045.919) * (-1041.489) (-1041.289) (-1040.556) [-1040.236] -- 0:01:13
463000 -- (-1043.438) (-1042.641) (-1040.473) [-1042.342] * (-1039.928) [-1038.826] (-1043.612) (-1038.682) -- 0:01:13
463500 -- (-1036.316) (-1044.124) [-1038.701] (-1042.236) * (-1042.474) (-1042.139) (-1041.638) [-1040.455] -- 0:01:14
464000 -- [-1039.893] (-1041.064) (-1032.788) (-1044.173) * (-1036.756) [-1041.347] (-1040.252) (-1045.755) -- 0:01:13
464500 -- (-1036.907) (-1043.494) [-1041.835] (-1040.049) * (-1047.112) (-1039.892) (-1037.237) [-1039.614] -- 0:01:13
465000 -- (-1039.331) (-1043.756) (-1042.157) [-1037.061] * [-1035.057] (-1044.169) (-1042.664) (-1033.764) -- 0:01:13
Average standard deviation of split frequencies: 0.016186
465500 -- [-1036.912] (-1043.155) (-1034.282) (-1044.174) * (-1041.168) (-1040.945) (-1040.634) [-1034.770] -- 0:01:13
466000 -- (-1039.194) (-1040.257) (-1037.388) [-1041.814] * (-1040.141) [-1037.493] (-1036.077) (-1039.202) -- 0:01:13
466500 -- [-1037.207] (-1043.946) (-1039.523) (-1041.409) * (-1039.180) [-1040.150] (-1039.303) (-1040.598) -- 0:01:13
467000 -- (-1038.981) (-1038.623) [-1035.045] (-1041.196) * [-1036.409] (-1038.890) (-1034.512) (-1044.202) -- 0:01:13
467500 -- [-1036.912] (-1040.079) (-1041.630) (-1036.614) * (-1035.972) [-1038.535] (-1039.646) (-1039.172) -- 0:01:12
468000 -- (-1040.696) (-1040.085) (-1036.043) [-1038.391] * (-1037.213) (-1036.674) [-1036.540] (-1036.063) -- 0:01:12
468500 -- (-1042.657) (-1044.031) [-1036.300] (-1041.985) * (-1036.805) (-1039.548) [-1037.582] (-1042.576) -- 0:01:12
469000 -- (-1039.569) (-1047.099) (-1039.546) [-1046.445] * [-1035.267] (-1035.147) (-1046.611) (-1043.148) -- 0:01:12
469500 -- (-1040.748) (-1042.921) [-1037.874] (-1038.845) * (-1035.873) (-1038.936) [-1036.652] (-1049.484) -- 0:01:12
470000 -- (-1042.254) (-1045.491) [-1042.176] (-1037.546) * (-1040.663) [-1036.614] (-1040.634) (-1049.073) -- 0:01:12
Average standard deviation of split frequencies: 0.014022
470500 -- (-1037.606) (-1039.816) (-1037.588) [-1038.353] * (-1037.762) (-1053.312) (-1041.732) [-1043.403] -- 0:01:13
471000 -- (-1038.892) [-1039.382] (-1039.725) (-1035.635) * [-1032.597] (-1044.014) (-1037.054) (-1041.135) -- 0:01:13
471500 -- [-1036.001] (-1038.084) (-1040.091) (-1035.714) * (-1035.812) (-1039.972) [-1037.714] (-1040.966) -- 0:01:12
472000 -- (-1042.477) (-1037.651) [-1041.242] (-1035.883) * [-1038.115] (-1043.506) (-1041.647) (-1039.696) -- 0:01:12
472500 -- (-1045.954) [-1041.696] (-1043.711) (-1037.209) * (-1040.168) (-1046.832) [-1035.366] (-1047.237) -- 0:01:12
473000 -- (-1037.991) [-1041.166] (-1039.007) (-1043.872) * (-1038.194) (-1035.754) [-1044.640] (-1041.342) -- 0:01:12
473500 -- (-1043.990) (-1041.933) [-1033.604] (-1041.497) * [-1036.662] (-1041.331) (-1038.454) (-1038.671) -- 0:01:12
474000 -- (-1043.552) (-1038.850) (-1038.941) [-1040.513] * [-1039.370] (-1037.967) (-1042.761) (-1040.569) -- 0:01:12
474500 -- (-1040.314) (-1039.759) [-1036.753] (-1040.149) * (-1037.766) (-1037.696) [-1041.264] (-1039.802) -- 0:01:11
475000 -- [-1044.007] (-1037.619) (-1037.013) (-1045.864) * [-1037.196] (-1036.218) (-1038.097) (-1041.687) -- 0:01:11
Average standard deviation of split frequencies: 0.014855
475500 -- (-1049.683) (-1035.627) (-1035.414) [-1037.487] * [-1037.145] (-1034.896) (-1034.289) (-1040.776) -- 0:01:11
476000 -- (-1036.421) [-1037.131] (-1040.374) (-1041.320) * [-1040.004] (-1036.207) (-1037.645) (-1043.670) -- 0:01:11
476500 -- (-1042.059) (-1045.752) (-1043.445) [-1037.756] * [-1034.493] (-1036.610) (-1036.203) (-1041.585) -- 0:01:11
477000 -- (-1041.239) [-1039.920] (-1048.044) (-1042.842) * [-1037.949] (-1040.294) (-1039.872) (-1040.015) -- 0:01:11
477500 -- (-1038.706) (-1039.430) (-1043.580) [-1041.682] * [-1042.591] (-1037.312) (-1037.644) (-1039.525) -- 0:01:11
478000 -- [-1039.812] (-1034.339) (-1044.002) (-1038.043) * (-1037.851) (-1043.202) [-1040.742] (-1035.810) -- 0:01:12
478500 -- (-1041.416) (-1036.844) [-1039.769] (-1043.365) * [-1042.003] (-1046.656) (-1035.877) (-1044.620) -- 0:01:11
479000 -- (-1043.120) (-1040.562) [-1040.940] (-1037.190) * (-1041.071) (-1045.711) (-1037.762) [-1040.506] -- 0:01:11
479500 -- (-1041.771) (-1043.489) (-1038.438) [-1037.245] * [-1038.536] (-1046.419) (-1038.813) (-1039.573) -- 0:01:11
480000 -- (-1039.585) (-1038.146) [-1036.384] (-1035.968) * (-1039.242) (-1043.549) [-1038.530] (-1037.366) -- 0:01:11
Average standard deviation of split frequencies: 0.015692
480500 -- (-1044.995) (-1037.166) [-1033.580] (-1035.879) * (-1042.950) (-1034.534) (-1036.396) [-1036.873] -- 0:01:11
481000 -- [-1037.413] (-1048.088) (-1040.855) (-1037.062) * [-1039.017] (-1034.983) (-1043.082) (-1037.020) -- 0:01:11
481500 -- [-1041.585] (-1041.535) (-1036.556) (-1040.489) * (-1040.782) (-1043.492) [-1038.920] (-1046.947) -- 0:01:11
482000 -- (-1036.757) (-1038.335) [-1038.220] (-1033.169) * (-1038.044) [-1033.677] (-1039.885) (-1036.753) -- 0:01:10
482500 -- (-1038.285) [-1036.225] (-1037.089) (-1035.255) * (-1038.829) [-1037.920] (-1042.046) (-1047.105) -- 0:01:10
483000 -- [-1035.199] (-1039.332) (-1039.760) (-1038.987) * (-1041.598) (-1041.571) (-1038.801) [-1038.261] -- 0:01:10
483500 -- [-1037.727] (-1040.220) (-1039.568) (-1037.473) * [-1040.003] (-1040.619) (-1038.337) (-1041.426) -- 0:01:10
484000 -- (-1035.301) (-1044.430) (-1039.102) [-1034.930] * (-1037.682) (-1048.456) [-1035.265] (-1044.939) -- 0:01:10
484500 -- (-1037.560) (-1038.538) [-1039.338] (-1038.239) * (-1037.837) [-1043.910] (-1035.709) (-1041.191) -- 0:01:10
485000 -- (-1039.998) [-1036.337] (-1034.959) (-1035.919) * [-1038.736] (-1040.203) (-1039.998) (-1047.841) -- 0:01:10
Average standard deviation of split frequencies: 0.015519
485500 -- [-1040.531] (-1040.134) (-1041.119) (-1037.644) * (-1041.773) (-1040.446) (-1036.836) [-1039.969] -- 0:01:11
486000 -- (-1040.468) (-1041.509) (-1040.715) [-1040.646] * (-1036.760) [-1041.079] (-1036.682) (-1044.522) -- 0:01:10
486500 -- (-1036.109) (-1044.237) [-1044.294] (-1047.299) * (-1051.662) [-1040.023] (-1040.127) (-1038.307) -- 0:01:10
487000 -- (-1035.082) (-1039.140) [-1042.093] (-1041.811) * (-1039.677) (-1044.940) (-1047.683) [-1042.818] -- 0:01:10
487500 -- (-1042.024) (-1038.545) (-1039.184) [-1041.300] * (-1040.413) (-1042.140) [-1034.850] (-1037.189) -- 0:01:10
488000 -- (-1046.666) (-1043.861) [-1037.935] (-1040.129) * (-1042.365) (-1037.987) [-1039.175] (-1038.165) -- 0:01:10
488500 -- (-1038.134) [-1042.326] (-1042.710) (-1035.192) * (-1039.381) [-1035.510] (-1039.645) (-1041.069) -- 0:01:10
489000 -- [-1038.124] (-1043.998) (-1040.748) (-1035.317) * (-1035.391) [-1043.059] (-1034.822) (-1044.256) -- 0:01:10
489500 -- [-1035.355] (-1043.983) (-1038.117) (-1041.715) * (-1035.274) (-1040.290) [-1043.204] (-1037.455) -- 0:01:09
490000 -- (-1036.352) (-1045.158) (-1034.594) [-1038.045] * [-1034.592] (-1035.755) (-1036.537) (-1042.596) -- 0:01:09
Average standard deviation of split frequencies: 0.015372
490500 -- (-1037.022) (-1033.524) (-1040.055) [-1037.368] * (-1039.088) (-1033.180) [-1039.593] (-1049.343) -- 0:01:09
491000 -- (-1037.753) [-1036.005] (-1035.949) (-1039.301) * [-1037.999] (-1035.823) (-1042.352) (-1040.254) -- 0:01:09
491500 -- (-1034.478) (-1041.100) [-1037.392] (-1045.139) * (-1036.454) (-1039.793) (-1038.750) [-1039.710] -- 0:01:09
492000 -- (-1037.430) (-1042.878) [-1038.733] (-1038.696) * (-1039.139) (-1042.269) (-1044.871) [-1035.232] -- 0:01:09
492500 -- (-1039.136) (-1037.987) (-1044.085) [-1035.897] * (-1038.226) [-1035.815] (-1036.483) (-1037.349) -- 0:01:09
493000 -- (-1033.876) (-1039.683) (-1044.530) [-1037.560] * (-1042.696) (-1040.582) (-1035.152) [-1034.288] -- 0:01:09
493500 -- (-1039.129) (-1046.318) (-1041.282) [-1037.208] * (-1035.331) [-1038.006] (-1043.959) (-1038.430) -- 0:01:09
494000 -- (-1037.356) (-1043.708) [-1038.873] (-1042.757) * (-1042.124) (-1044.476) (-1036.047) [-1042.350] -- 0:01:09
494500 -- [-1037.761] (-1041.113) (-1039.934) (-1036.046) * [-1038.723] (-1035.926) (-1038.397) (-1040.545) -- 0:01:09
495000 -- (-1036.054) [-1040.116] (-1039.500) (-1042.064) * (-1034.306) (-1037.736) (-1043.434) [-1037.167] -- 0:01:09
Average standard deviation of split frequencies: 0.015207
495500 -- (-1035.467) (-1041.252) [-1036.624] (-1035.862) * (-1037.339) [-1035.151] (-1043.431) (-1040.201) -- 0:01:09
496000 -- (-1039.173) [-1042.794] (-1034.138) (-1040.828) * (-1036.560) (-1038.555) [-1039.292] (-1038.539) -- 0:01:09
496500 -- (-1037.716) [-1034.842] (-1037.915) (-1038.406) * (-1038.671) (-1036.379) [-1036.319] (-1041.047) -- 0:01:08
497000 -- (-1034.600) [-1038.156] (-1040.548) (-1038.393) * [-1038.107] (-1040.879) (-1042.611) (-1040.734) -- 0:01:08
497500 -- (-1035.116) [-1043.254] (-1040.192) (-1038.692) * [-1037.778] (-1036.002) (-1039.004) (-1038.733) -- 0:01:08
498000 -- (-1040.253) (-1041.742) [-1041.516] (-1041.117) * (-1035.428) [-1038.541] (-1037.237) (-1043.811) -- 0:01:08
498500 -- (-1037.467) [-1036.501] (-1038.392) (-1035.435) * (-1038.602) (-1037.878) (-1043.985) [-1043.577] -- 0:01:08
499000 -- (-1035.838) (-1044.623) [-1040.488] (-1048.109) * (-1038.232) [-1037.082] (-1044.679) (-1040.837) -- 0:01:08
499500 -- [-1039.197] (-1038.282) (-1037.555) (-1036.164) * (-1039.251) (-1039.304) (-1039.463) [-1034.591] -- 0:01:08
500000 -- (-1041.067) [-1037.701] (-1035.410) (-1037.955) * (-1038.242) [-1035.907] (-1042.591) (-1042.400) -- 0:01:09
Average standard deviation of split frequencies: 0.014123
500500 -- (-1046.586) (-1042.045) (-1042.486) [-1036.692] * (-1040.020) (-1040.691) (-1044.434) [-1041.777] -- 0:01:08
501000 -- (-1045.257) [-1035.722] (-1036.078) (-1038.946) * [-1037.160] (-1045.708) (-1048.367) (-1042.826) -- 0:01:08
501500 -- (-1044.021) (-1043.742) [-1035.359] (-1039.928) * (-1036.921) (-1044.579) [-1039.690] (-1038.108) -- 0:01:08
502000 -- (-1044.504) (-1037.243) [-1037.212] (-1036.851) * [-1040.731] (-1039.196) (-1044.491) (-1039.537) -- 0:01:08
502500 -- (-1037.142) (-1051.566) (-1040.568) [-1037.732] * [-1037.361] (-1037.688) (-1038.885) (-1041.287) -- 0:01:08
503000 -- (-1037.802) (-1040.402) [-1034.853] (-1037.386) * (-1037.424) (-1036.468) (-1040.091) [-1039.661] -- 0:01:08
503500 -- [-1035.538] (-1041.041) (-1039.043) (-1034.382) * (-1037.066) (-1042.283) [-1033.342] (-1040.884) -- 0:01:08
504000 -- (-1037.490) [-1036.089] (-1042.562) (-1034.658) * [-1040.343] (-1037.729) (-1041.633) (-1037.509) -- 0:01:07
504500 -- [-1045.831] (-1046.505) (-1045.046) (-1039.672) * [-1038.658] (-1037.161) (-1040.324) (-1039.444) -- 0:01:07
505000 -- (-1044.278) (-1040.071) [-1038.885] (-1042.323) * [-1036.376] (-1037.952) (-1041.453) (-1040.107) -- 0:01:07
Average standard deviation of split frequencies: 0.013974
505500 -- (-1037.343) [-1038.465] (-1037.315) (-1043.174) * (-1039.873) (-1040.827) (-1037.259) [-1040.943] -- 0:01:07
506000 -- (-1039.675) [-1036.192] (-1036.006) (-1040.104) * [-1037.815] (-1039.223) (-1035.089) (-1037.839) -- 0:01:07
506500 -- [-1036.973] (-1034.152) (-1039.319) (-1035.814) * (-1044.817) (-1036.318) (-1041.576) [-1036.107] -- 0:01:07
507000 -- (-1037.201) [-1036.128] (-1040.175) (-1033.356) * (-1042.388) (-1042.164) [-1033.549] (-1034.416) -- 0:01:07
507500 -- (-1035.836) (-1050.394) (-1038.977) [-1038.286] * (-1036.612) (-1039.038) [-1045.129] (-1036.941) -- 0:01:07
508000 -- [-1041.442] (-1047.759) (-1042.961) (-1039.309) * (-1039.714) (-1036.689) (-1045.322) [-1035.390] -- 0:01:07
508500 -- (-1038.563) (-1039.482) [-1046.329] (-1037.478) * (-1045.725) (-1041.923) (-1039.300) [-1039.486] -- 0:01:07
509000 -- (-1042.112) [-1036.158] (-1042.450) (-1041.709) * [-1039.885] (-1036.423) (-1041.292) (-1035.324) -- 0:01:07
509500 -- (-1050.255) (-1041.587) [-1044.807] (-1045.982) * (-1038.252) [-1039.010] (-1042.664) (-1037.557) -- 0:01:07
510000 -- (-1043.004) [-1038.100] (-1037.038) (-1040.271) * (-1038.232) [-1042.811] (-1040.882) (-1038.977) -- 0:01:07
Average standard deviation of split frequencies: 0.015693
510500 -- [-1034.878] (-1037.956) (-1043.162) (-1035.836) * (-1042.080) [-1039.711] (-1048.812) (-1039.845) -- 0:01:07
511000 -- (-1041.090) [-1036.885] (-1040.219) (-1040.881) * (-1045.744) [-1036.835] (-1042.880) (-1043.000) -- 0:01:06
511500 -- [-1042.444] (-1046.621) (-1038.337) (-1036.088) * [-1037.865] (-1038.712) (-1035.072) (-1035.408) -- 0:01:06
512000 -- (-1038.159) (-1038.777) [-1043.167] (-1037.419) * (-1043.002) [-1038.010] (-1038.373) (-1038.902) -- 0:01:06
512500 -- (-1039.703) (-1043.513) [-1039.963] (-1037.377) * (-1035.591) [-1037.155] (-1042.203) (-1040.185) -- 0:01:06
513000 -- (-1046.078) (-1039.897) (-1033.200) [-1036.656] * [-1037.731] (-1035.559) (-1037.004) (-1043.737) -- 0:01:06
513500 -- (-1048.141) [-1041.918] (-1043.286) (-1035.879) * (-1039.082) (-1039.689) (-1039.051) [-1037.370] -- 0:01:06
514000 -- (-1039.025) (-1043.479) (-1040.915) [-1040.670] * (-1038.081) [-1036.713] (-1036.120) (-1039.002) -- 0:01:06
514500 -- (-1037.234) (-1042.501) (-1041.843) [-1042.191] * (-1035.620) (-1036.809) [-1039.563] (-1038.585) -- 0:01:06
515000 -- (-1040.684) (-1039.345) [-1039.754] (-1041.184) * (-1036.288) (-1041.447) (-1038.299) [-1037.103] -- 0:01:06
Average standard deviation of split frequencies: 0.014617
515500 -- (-1042.607) (-1040.008) [-1038.351] (-1043.048) * (-1035.493) [-1037.898] (-1037.223) (-1038.817) -- 0:01:06
516000 -- (-1035.934) [-1042.606] (-1037.456) (-1038.753) * (-1036.552) (-1036.648) [-1037.591] (-1039.384) -- 0:01:06
516500 -- [-1040.128] (-1042.237) (-1041.240) (-1036.808) * (-1043.602) [-1041.310] (-1038.781) (-1039.393) -- 0:01:06
517000 -- (-1034.240) (-1048.988) [-1037.999] (-1042.167) * (-1038.546) [-1039.762] (-1042.748) (-1034.249) -- 0:01:06
517500 -- (-1039.687) [-1039.354] (-1037.414) (-1034.456) * (-1039.981) (-1039.679) (-1048.425) [-1035.339] -- 0:01:06
518000 -- [-1035.815] (-1036.322) (-1040.975) (-1036.093) * (-1036.551) (-1040.610) [-1036.597] (-1041.157) -- 0:01:06
518500 -- [-1034.649] (-1038.348) (-1036.733) (-1042.362) * (-1041.464) (-1042.319) [-1041.088] (-1040.874) -- 0:01:05
519000 -- (-1035.698) [-1035.832] (-1038.404) (-1038.911) * (-1044.447) (-1045.709) [-1038.100] (-1041.371) -- 0:01:05
519500 -- (-1034.828) (-1036.806) [-1037.708] (-1034.763) * (-1041.987) [-1036.197] (-1041.496) (-1040.149) -- 0:01:05
520000 -- (-1035.040) (-1036.416) (-1039.262) [-1040.650] * (-1052.315) [-1033.132] (-1038.464) (-1041.783) -- 0:01:05
Average standard deviation of split frequencies: 0.012675
520500 -- (-1044.801) [-1042.635] (-1045.652) (-1037.210) * [-1042.000] (-1036.831) (-1038.528) (-1036.593) -- 0:01:05
521000 -- [-1038.631] (-1037.606) (-1041.391) (-1041.318) * [-1036.873] (-1037.802) (-1043.232) (-1041.691) -- 0:01:05
521500 -- (-1041.537) (-1041.479) [-1040.295] (-1038.368) * (-1039.294) (-1042.257) [-1040.325] (-1036.709) -- 0:01:05
522000 -- (-1039.039) (-1036.648) (-1037.856) [-1034.464] * (-1044.076) [-1037.401] (-1045.061) (-1035.081) -- 0:01:05
522500 -- (-1037.960) (-1038.849) [-1038.687] (-1039.500) * (-1045.870) [-1040.340] (-1041.596) (-1040.738) -- 0:01:05
523000 -- [-1040.718] (-1036.727) (-1042.097) (-1036.323) * (-1040.949) (-1040.633) [-1035.425] (-1035.772) -- 0:01:05
523500 -- [-1038.827] (-1037.547) (-1039.889) (-1040.681) * (-1042.766) (-1035.628) (-1043.407) [-1043.808] -- 0:01:05
524000 -- [-1039.307] (-1039.247) (-1034.739) (-1042.146) * (-1040.590) (-1039.781) [-1040.238] (-1039.117) -- 0:01:05
524500 -- (-1041.086) [-1035.605] (-1041.691) (-1034.358) * (-1042.383) (-1037.919) [-1037.816] (-1040.520) -- 0:01:05
525000 -- [-1042.088] (-1039.276) (-1042.225) (-1042.182) * [-1040.537] (-1035.921) (-1039.938) (-1041.618) -- 0:01:05
Average standard deviation of split frequencies: 0.013443
525500 -- [-1038.888] (-1046.204) (-1039.436) (-1042.515) * [-1035.781] (-1043.039) (-1038.075) (-1037.680) -- 0:01:05
526000 -- [-1038.168] (-1042.335) (-1044.101) (-1045.417) * [-1037.046] (-1039.596) (-1035.519) (-1038.804) -- 0:01:04
526500 -- (-1041.064) (-1038.106) (-1043.869) [-1040.262] * [-1040.015] (-1041.914) (-1037.055) (-1036.102) -- 0:01:04
527000 -- (-1041.530) [-1036.893] (-1035.514) (-1045.767) * [-1038.564] (-1037.646) (-1044.113) (-1037.147) -- 0:01:04
527500 -- (-1040.055) (-1039.612) (-1042.622) [-1040.374] * (-1043.818) [-1037.331] (-1041.359) (-1033.537) -- 0:01:04
528000 -- (-1037.317) (-1049.589) (-1045.402) [-1038.492] * (-1041.619) (-1036.731) (-1039.150) [-1036.653] -- 0:01:04
528500 -- (-1043.407) [-1035.205] (-1036.462) (-1041.876) * [-1038.582] (-1033.480) (-1047.030) (-1041.113) -- 0:01:04
529000 -- (-1034.644) [-1039.437] (-1041.138) (-1043.354) * (-1047.370) [-1034.166] (-1039.596) (-1039.919) -- 0:01:04
529500 -- (-1042.654) [-1041.440] (-1036.333) (-1042.823) * (-1051.303) (-1045.896) [-1037.894] (-1041.073) -- 0:01:03
530000 -- (-1049.437) (-1038.700) [-1041.961] (-1040.280) * (-1042.597) (-1038.576) (-1040.717) [-1039.817] -- 0:01:04
Average standard deviation of split frequencies: 0.014213
530500 -- [-1037.272] (-1039.807) (-1041.384) (-1041.733) * (-1047.938) [-1041.643] (-1041.860) (-1043.834) -- 0:01:04
531000 -- (-1036.958) (-1037.117) (-1039.796) [-1041.004] * [-1035.115] (-1039.400) (-1040.748) (-1037.848) -- 0:01:04
531500 -- (-1036.342) (-1042.169) [-1035.996] (-1044.772) * (-1041.325) (-1039.831) (-1040.117) [-1040.196] -- 0:01:04
532000 -- (-1039.149) (-1038.263) [-1035.652] (-1040.252) * (-1039.199) [-1035.855] (-1043.360) (-1048.005) -- 0:01:04
532500 -- (-1043.266) [-1041.063] (-1039.525) (-1034.608) * (-1039.656) (-1038.714) (-1037.803) [-1032.760] -- 0:01:04
533000 -- [-1037.158] (-1032.854) (-1034.622) (-1040.329) * (-1044.666) (-1035.847) (-1045.719) [-1042.155] -- 0:01:03
533500 -- (-1040.328) [-1038.668] (-1036.184) (-1035.490) * (-1044.449) (-1038.537) [-1037.295] (-1036.378) -- 0:01:03
534000 -- [-1038.610] (-1034.600) (-1039.205) (-1042.104) * (-1041.061) [-1039.118] (-1035.635) (-1033.285) -- 0:01:03
534500 -- (-1036.502) [-1035.390] (-1041.615) (-1040.373) * (-1045.027) (-1039.994) [-1035.833] (-1039.682) -- 0:01:03
535000 -- [-1035.420] (-1039.238) (-1036.457) (-1043.098) * [-1037.562] (-1040.973) (-1041.098) (-1042.054) -- 0:01:03
Average standard deviation of split frequencies: 0.013192
535500 -- (-1041.612) (-1038.504) [-1038.081] (-1038.203) * (-1039.550) (-1042.254) [-1032.953] (-1037.535) -- 0:01:03
536000 -- (-1040.685) [-1039.655] (-1041.162) (-1036.007) * [-1038.600] (-1037.894) (-1044.873) (-1040.113) -- 0:01:03
536500 -- [-1036.974] (-1036.016) (-1043.169) (-1037.521) * (-1041.870) [-1040.024] (-1044.418) (-1039.683) -- 0:01:03
537000 -- [-1041.948] (-1037.908) (-1039.598) (-1038.069) * [-1039.364] (-1040.762) (-1040.827) (-1037.423) -- 0:01:02
537500 -- (-1034.327) [-1036.679] (-1040.052) (-1037.667) * [-1039.314] (-1038.687) (-1042.554) (-1041.387) -- 0:01:03
538000 -- (-1035.859) (-1037.934) (-1042.908) [-1039.269] * (-1037.383) (-1037.198) [-1041.449] (-1042.068) -- 0:01:03
538500 -- (-1040.905) (-1036.722) [-1038.124] (-1043.051) * (-1035.844) (-1040.825) [-1035.038] (-1044.896) -- 0:01:03
539000 -- (-1038.665) (-1044.017) [-1039.085] (-1038.975) * [-1033.703] (-1036.350) (-1035.229) (-1040.630) -- 0:01:03
539500 -- (-1035.571) [-1038.680] (-1043.300) (-1040.823) * (-1043.905) (-1035.452) [-1034.976] (-1035.592) -- 0:01:03
540000 -- (-1037.291) [-1039.075] (-1043.635) (-1044.099) * (-1039.933) [-1034.092] (-1038.177) (-1040.155) -- 0:01:03
Average standard deviation of split frequencies: 0.015694
540500 -- (-1039.575) [-1034.259] (-1043.883) (-1035.340) * [-1036.932] (-1039.139) (-1039.885) (-1034.580) -- 0:01:02
541000 -- [-1039.300] (-1036.114) (-1036.396) (-1037.964) * (-1036.969) [-1040.475] (-1049.152) (-1036.364) -- 0:01:02
541500 -- (-1036.020) (-1035.373) [-1037.202] (-1035.095) * (-1035.388) (-1040.842) [-1041.962] (-1052.671) -- 0:01:02
542000 -- (-1039.010) (-1041.194) [-1038.977] (-1040.676) * (-1036.611) [-1045.660] (-1038.907) (-1044.329) -- 0:01:02
542500 -- [-1038.105] (-1039.051) (-1035.293) (-1034.787) * [-1039.554] (-1034.639) (-1037.780) (-1039.086) -- 0:01:02
543000 -- [-1039.590] (-1042.532) (-1042.595) (-1039.129) * (-1036.558) [-1035.235] (-1043.954) (-1036.619) -- 0:01:02
543500 -- [-1042.681] (-1041.277) (-1040.902) (-1037.507) * (-1037.592) (-1038.167) [-1042.281] (-1038.546) -- 0:01:02
544000 -- (-1036.863) (-1041.305) [-1039.503] (-1035.047) * [-1040.041] (-1036.973) (-1040.001) (-1034.378) -- 0:01:02
544500 -- (-1043.882) (-1035.366) (-1042.114) [-1034.905] * (-1038.064) (-1043.768) (-1040.202) [-1037.477] -- 0:01:02
545000 -- [-1039.323] (-1039.810) (-1040.596) (-1041.893) * (-1037.393) (-1043.146) (-1041.459) [-1036.776] -- 0:01:02
Average standard deviation of split frequencies: 0.018994
545500 -- (-1039.488) (-1040.284) [-1036.700] (-1039.105) * (-1038.385) (-1038.060) [-1039.780] (-1041.034) -- 0:01:02
546000 -- (-1042.867) (-1042.219) [-1039.256] (-1035.096) * (-1040.887) (-1040.387) (-1034.687) [-1034.858] -- 0:01:02
546500 -- [-1041.368] (-1050.510) (-1040.999) (-1038.214) * (-1037.266) (-1038.124) (-1041.713) [-1035.851] -- 0:01:02
547000 -- (-1043.238) (-1045.578) (-1039.546) [-1038.089] * (-1037.291) (-1036.703) (-1043.635) [-1036.644] -- 0:01:02
547500 -- (-1044.554) [-1039.915] (-1043.719) (-1034.314) * (-1037.014) [-1037.523] (-1036.734) (-1041.376) -- 0:01:01
548000 -- (-1035.762) (-1042.263) (-1043.712) [-1037.660] * [-1037.586] (-1036.408) (-1035.587) (-1048.332) -- 0:01:01
548500 -- (-1035.113) [-1034.955] (-1039.717) (-1038.368) * (-1035.395) (-1040.385) [-1034.068] (-1039.932) -- 0:01:01
549000 -- (-1037.840) (-1035.199) (-1043.968) [-1036.221] * (-1039.137) (-1037.518) (-1039.356) [-1040.394] -- 0:01:01
549500 -- (-1042.215) [-1038.715] (-1040.633) (-1040.650) * (-1040.090) (-1038.239) (-1034.785) [-1038.086] -- 0:01:01
550000 -- (-1039.135) (-1041.954) (-1037.642) [-1038.967] * (-1039.834) (-1039.817) [-1038.443] (-1040.999) -- 0:01:01
Average standard deviation of split frequencies: 0.020545
550500 -- [-1040.241] (-1036.928) (-1041.623) (-1040.479) * (-1042.829) [-1040.714] (-1044.322) (-1041.242) -- 0:01:01
551000 -- (-1035.967) (-1039.022) [-1033.956] (-1042.693) * (-1038.043) (-1034.563) [-1044.057] (-1037.372) -- 0:01:01
551500 -- (-1039.601) (-1049.577) [-1041.491] (-1040.363) * (-1039.258) [-1036.962] (-1040.146) (-1041.216) -- 0:01:00
552000 -- [-1042.405] (-1042.935) (-1039.131) (-1035.925) * [-1039.950] (-1041.651) (-1040.934) (-1035.350) -- 0:01:01
552500 -- (-1036.940) [-1037.468] (-1036.911) (-1041.100) * (-1042.983) (-1036.234) [-1039.550] (-1036.404) -- 0:01:01
553000 -- (-1039.757) (-1038.021) (-1037.338) [-1038.479] * (-1043.538) [-1036.968] (-1039.498) (-1040.777) -- 0:01:01
553500 -- [-1034.850] (-1043.280) (-1040.589) (-1037.858) * (-1040.362) (-1038.100) (-1037.915) [-1036.664] -- 0:01:01
554000 -- [-1034.070] (-1039.421) (-1039.153) (-1041.095) * (-1043.017) (-1039.957) (-1038.415) [-1037.480] -- 0:01:01
554500 -- (-1035.711) [-1041.414] (-1037.490) (-1042.820) * (-1041.167) [-1040.608] (-1039.627) (-1037.099) -- 0:01:01
555000 -- (-1038.782) (-1041.629) [-1039.106] (-1035.536) * (-1035.984) [-1040.041] (-1039.920) (-1040.507) -- 0:01:00
Average standard deviation of split frequencies: 0.018653
555500 -- [-1037.767] (-1039.918) (-1033.456) (-1036.897) * [-1039.678] (-1038.746) (-1034.170) (-1039.931) -- 0:01:00
556000 -- (-1047.329) (-1041.119) (-1042.085) [-1040.775] * (-1045.675) (-1037.858) (-1035.663) [-1038.500] -- 0:01:00
556500 -- (-1037.701) (-1041.639) (-1042.674) [-1043.364] * [-1043.449] (-1037.979) (-1042.736) (-1044.003) -- 0:01:00
557000 -- (-1038.366) (-1040.300) (-1041.656) [-1037.170] * [-1038.460] (-1036.058) (-1037.380) (-1037.217) -- 0:01:00
557500 -- [-1035.757] (-1043.412) (-1038.138) (-1040.363) * (-1035.789) (-1040.437) (-1042.200) [-1039.102] -- 0:01:00
558000 -- [-1039.083] (-1039.628) (-1037.856) (-1042.455) * (-1047.735) (-1037.481) [-1035.614] (-1035.949) -- 0:01:00
558500 -- [-1040.278] (-1041.377) (-1040.658) (-1039.909) * (-1035.291) (-1043.032) [-1037.324] (-1041.935) -- 0:01:00
559000 -- [-1039.321] (-1039.602) (-1035.010) (-1042.991) * [-1038.819] (-1043.085) (-1036.435) (-1042.100) -- 0:00:59
559500 -- (-1038.203) (-1042.078) [-1035.677] (-1043.503) * [-1033.713] (-1042.402) (-1036.819) (-1039.489) -- 0:01:00
560000 -- (-1038.630) (-1039.340) (-1034.421) [-1036.144] * [-1036.013] (-1038.601) (-1037.017) (-1045.409) -- 0:01:00
Average standard deviation of split frequencies: 0.017657
560500 -- (-1039.858) (-1038.919) [-1036.734] (-1039.090) * [-1037.068] (-1036.664) (-1039.486) (-1045.089) -- 0:01:00
561000 -- (-1036.915) (-1033.985) (-1035.379) [-1040.122] * (-1034.094) (-1039.291) (-1044.218) [-1035.155] -- 0:01:00
561500 -- (-1038.260) (-1039.396) [-1040.551] (-1034.317) * (-1041.563) (-1044.221) [-1037.350] (-1039.416) -- 0:01:00
562000 -- (-1037.523) (-1050.577) (-1039.091) [-1038.983] * (-1040.765) [-1036.264] (-1037.423) (-1045.570) -- 0:01:00
562500 -- (-1036.880) (-1043.132) [-1043.580] (-1044.231) * (-1038.177) (-1036.405) [-1036.335] (-1046.540) -- 0:00:59
563000 -- (-1045.072) (-1041.745) [-1038.024] (-1037.051) * (-1039.720) (-1042.454) [-1036.573] (-1038.782) -- 0:00:59
563500 -- (-1042.761) (-1037.941) [-1034.313] (-1040.648) * [-1036.438] (-1039.280) (-1035.024) (-1037.792) -- 0:00:59
564000 -- (-1038.571) (-1039.663) [-1037.186] (-1048.359) * (-1040.847) [-1041.585] (-1039.577) (-1041.133) -- 0:00:59
564500 -- (-1035.230) (-1039.376) [-1034.492] (-1045.874) * (-1040.792) (-1041.326) [-1040.275] (-1035.650) -- 0:00:59
565000 -- [-1042.929] (-1036.619) (-1038.191) (-1044.230) * (-1037.775) [-1038.387] (-1040.684) (-1036.402) -- 0:00:59
Average standard deviation of split frequencies: 0.017490
565500 -- (-1044.598) (-1036.822) [-1038.682] (-1040.974) * (-1036.693) (-1039.378) [-1039.518] (-1040.762) -- 0:00:59
566000 -- (-1040.518) (-1036.922) (-1034.324) [-1039.009] * (-1042.996) (-1039.758) [-1045.177] (-1035.808) -- 0:00:59
566500 -- (-1046.719) (-1043.597) (-1039.771) [-1036.726] * (-1042.073) (-1042.669) [-1039.614] (-1038.283) -- 0:00:58
567000 -- [-1042.363] (-1039.225) (-1036.206) (-1042.284) * [-1041.525] (-1042.679) (-1043.307) (-1036.874) -- 0:00:59
567500 -- (-1036.258) [-1039.649] (-1042.942) (-1036.102) * (-1041.189) (-1037.221) [-1036.804] (-1046.644) -- 0:00:59
568000 -- [-1035.702] (-1039.155) (-1043.695) (-1035.946) * (-1036.776) (-1039.047) [-1037.683] (-1046.782) -- 0:00:59
568500 -- [-1040.623] (-1041.868) (-1040.778) (-1044.321) * [-1037.193] (-1037.242) (-1040.537) (-1042.584) -- 0:00:59
569000 -- (-1037.906) (-1042.656) [-1043.500] (-1041.122) * (-1040.926) (-1037.172) [-1038.704] (-1039.403) -- 0:00:59
569500 -- (-1038.821) (-1038.413) (-1035.710) [-1039.619] * (-1039.433) (-1042.161) (-1035.243) [-1042.753] -- 0:00:58
570000 -- (-1040.035) [-1036.504] (-1042.662) (-1036.315) * (-1041.979) [-1035.525] (-1039.546) (-1042.750) -- 0:00:58
Average standard deviation of split frequencies: 0.016521
570500 -- (-1041.071) (-1042.399) (-1039.237) [-1036.194] * (-1047.045) (-1044.960) (-1042.140) [-1039.783] -- 0:00:58
571000 -- (-1039.140) (-1040.425) (-1042.609) [-1037.998] * (-1044.010) (-1039.799) (-1040.452) [-1036.880] -- 0:00:58
571500 -- [-1041.332] (-1038.062) (-1037.815) (-1033.494) * (-1045.779) (-1037.232) [-1036.479] (-1038.725) -- 0:00:58
572000 -- [-1035.532] (-1039.317) (-1038.316) (-1038.828) * (-1040.559) (-1040.351) [-1036.546] (-1040.489) -- 0:00:58
572500 -- (-1038.293) (-1034.631) [-1045.125] (-1040.677) * (-1041.101) (-1037.953) (-1050.658) [-1043.626] -- 0:00:58
573000 -- (-1039.631) (-1036.830) (-1049.275) [-1038.191] * [-1039.844] (-1037.935) (-1046.074) (-1050.850) -- 0:00:58
573500 -- (-1046.759) (-1042.655) [-1037.781] (-1038.171) * (-1041.657) (-1041.048) [-1035.940] (-1043.010) -- 0:00:58
574000 -- [-1048.246] (-1048.034) (-1048.788) (-1038.186) * (-1039.982) (-1039.873) [-1034.764] (-1038.301) -- 0:00:58
574500 -- (-1037.699) [-1034.827] (-1046.350) (-1036.800) * (-1044.519) [-1037.763] (-1037.389) (-1041.685) -- 0:00:58
575000 -- (-1042.100) [-1040.577] (-1047.147) (-1040.169) * (-1042.041) (-1037.374) (-1039.059) [-1037.939] -- 0:00:58
Average standard deviation of split frequencies: 0.014731
575500 -- (-1040.190) [-1036.232] (-1038.488) (-1033.628) * (-1045.151) [-1038.023] (-1039.862) (-1039.040) -- 0:00:58
576000 -- (-1036.519) [-1039.583] (-1036.714) (-1041.980) * (-1041.024) (-1034.617) [-1035.176] (-1044.230) -- 0:00:58
576500 -- (-1042.779) (-1048.515) [-1039.119] (-1036.716) * (-1046.846) (-1036.828) (-1039.072) [-1041.968] -- 0:00:58
577000 -- (-1045.908) [-1042.522] (-1040.036) (-1035.406) * [-1039.658] (-1033.421) (-1045.827) (-1037.562) -- 0:00:57
577500 -- (-1040.114) (-1042.612) [-1037.833] (-1035.802) * (-1046.237) [-1034.990] (-1039.330) (-1038.124) -- 0:00:57
578000 -- (-1038.112) [-1040.748] (-1036.596) (-1046.580) * (-1041.511) (-1039.666) [-1040.726] (-1040.341) -- 0:00:57
578500 -- [-1038.550] (-1048.069) (-1043.248) (-1047.101) * (-1037.866) [-1039.072] (-1045.222) (-1042.882) -- 0:00:57
579000 -- (-1040.329) [-1035.452] (-1038.430) (-1043.497) * [-1040.653] (-1034.265) (-1043.541) (-1038.390) -- 0:00:57
579500 -- [-1038.220] (-1044.442) (-1038.225) (-1038.688) * (-1038.433) [-1038.895] (-1038.102) (-1040.451) -- 0:00:57
580000 -- [-1044.587] (-1044.938) (-1043.051) (-1037.053) * (-1040.776) (-1038.124) [-1034.000] (-1043.142) -- 0:00:57
Average standard deviation of split frequencies: 0.015425
580500 -- [-1035.995] (-1039.121) (-1054.253) (-1037.779) * (-1046.339) (-1040.998) [-1036.594] (-1041.981) -- 0:00:57
581000 -- [-1036.792] (-1039.577) (-1040.553) (-1039.264) * (-1055.000) (-1035.104) (-1043.480) [-1039.308] -- 0:00:56
581500 -- (-1034.195) (-1044.729) [-1037.412] (-1041.730) * (-1038.243) (-1045.604) (-1040.780) [-1042.640] -- 0:00:57
582000 -- (-1042.443) (-1036.290) [-1043.967] (-1040.790) * (-1036.476) [-1042.508] (-1035.358) (-1038.437) -- 0:00:57
582500 -- (-1044.282) (-1039.986) [-1042.934] (-1038.225) * (-1046.913) (-1042.838) (-1038.606) [-1034.794] -- 0:00:57
583000 -- [-1040.286] (-1033.619) (-1036.279) (-1044.760) * (-1041.272) (-1040.208) (-1048.311) [-1037.931] -- 0:00:57
583500 -- (-1036.588) [-1040.100] (-1037.727) (-1039.259) * (-1046.376) (-1037.846) [-1036.262] (-1041.670) -- 0:00:57
584000 -- [-1035.613] (-1040.125) (-1037.056) (-1035.929) * (-1046.429) (-1038.836) [-1035.559] (-1040.190) -- 0:00:56
584500 -- (-1039.699) [-1035.187] (-1039.468) (-1034.934) * (-1036.243) (-1040.039) (-1039.919) [-1044.265] -- 0:00:56
585000 -- [-1040.550] (-1042.044) (-1042.199) (-1035.505) * (-1039.249) (-1037.750) [-1039.941] (-1037.728) -- 0:00:56
Average standard deviation of split frequencies: 0.015284
585500 -- (-1044.080) (-1036.695) (-1037.612) [-1036.600] * (-1042.017) (-1040.978) [-1037.439] (-1044.826) -- 0:00:56
586000 -- (-1042.247) (-1038.577) [-1039.766] (-1035.315) * [-1037.730] (-1043.463) (-1039.022) (-1039.033) -- 0:00:56
586500 -- (-1045.196) (-1037.882) [-1034.993] (-1042.758) * (-1037.911) (-1043.334) [-1034.901] (-1039.819) -- 0:00:56
587000 -- (-1037.766) (-1038.813) (-1035.033) [-1040.378] * (-1038.995) (-1044.144) [-1037.715] (-1037.299) -- 0:00:56
587500 -- (-1039.782) [-1036.854] (-1038.621) (-1036.283) * (-1037.893) (-1041.766) (-1041.586) [-1045.739] -- 0:00:56
588000 -- (-1044.396) (-1041.889) [-1035.311] (-1041.886) * (-1038.640) (-1042.536) (-1043.259) [-1040.778] -- 0:00:56
588500 -- (-1045.100) (-1042.415) [-1039.536] (-1035.130) * [-1039.564] (-1034.544) (-1040.440) (-1042.991) -- 0:00:55
589000 -- [-1039.926] (-1040.789) (-1040.826) (-1043.751) * (-1038.661) [-1036.340] (-1036.890) (-1047.767) -- 0:00:56
589500 -- [-1036.342] (-1041.470) (-1040.010) (-1037.484) * (-1039.913) [-1043.622] (-1038.556) (-1040.334) -- 0:00:56
590000 -- (-1044.067) (-1040.146) (-1043.525) [-1037.990] * [-1036.252] (-1038.043) (-1041.297) (-1042.587) -- 0:00:56
Average standard deviation of split frequencies: 0.014366
590500 -- (-1042.481) [-1041.528] (-1039.666) (-1036.344) * (-1039.328) [-1038.694] (-1041.729) (-1038.786) -- 0:00:56
591000 -- (-1039.469) (-1037.390) (-1037.701) [-1041.801] * [-1037.783] (-1034.941) (-1039.146) (-1051.967) -- 0:00:56
591500 -- (-1040.978) (-1038.857) [-1039.766] (-1039.165) * (-1038.359) [-1034.726] (-1041.409) (-1040.139) -- 0:00:55
592000 -- [-1038.771] (-1038.639) (-1048.183) (-1042.890) * (-1036.631) (-1037.483) [-1038.776] (-1040.940) -- 0:00:55
592500 -- (-1042.613) (-1040.947) [-1037.882] (-1036.413) * (-1036.473) [-1038.741] (-1033.492) (-1041.950) -- 0:00:55
593000 -- (-1038.890) [-1037.556] (-1037.665) (-1041.415) * (-1039.385) (-1038.516) [-1040.548] (-1043.576) -- 0:00:55
593500 -- [-1039.932] (-1043.008) (-1038.067) (-1038.630) * (-1042.462) (-1040.398) (-1038.069) [-1048.570] -- 0:00:55
594000 -- (-1049.417) (-1042.854) [-1035.797] (-1039.589) * (-1037.908) (-1041.319) [-1038.084] (-1050.391) -- 0:00:55
594500 -- (-1043.733) [-1036.833] (-1039.074) (-1039.587) * (-1040.861) [-1035.808] (-1037.617) (-1047.886) -- 0:00:55
595000 -- [-1047.828] (-1043.596) (-1040.919) (-1040.312) * [-1039.336] (-1037.247) (-1038.270) (-1043.478) -- 0:00:55
Average standard deviation of split frequencies: 0.013446
595500 -- [-1038.126] (-1039.914) (-1044.238) (-1039.670) * (-1038.070) (-1045.461) [-1037.113] (-1040.541) -- 0:00:55
596000 -- [-1038.189] (-1040.838) (-1044.619) (-1038.644) * (-1040.240) [-1035.635] (-1036.098) (-1040.403) -- 0:00:54
596500 -- [-1035.179] (-1042.834) (-1043.657) (-1039.846) * (-1035.849) (-1042.774) [-1037.143] (-1043.181) -- 0:00:55
597000 -- [-1039.670] (-1036.509) (-1035.483) (-1038.085) * (-1038.224) (-1039.584) (-1034.139) [-1038.341] -- 0:00:55
597500 -- (-1034.664) (-1043.915) [-1039.053] (-1035.995) * [-1040.471] (-1035.498) (-1039.555) (-1037.964) -- 0:00:55
598000 -- [-1037.793] (-1043.942) (-1038.455) (-1035.520) * [-1038.767] (-1041.196) (-1034.610) (-1038.373) -- 0:00:55
598500 -- (-1034.434) (-1048.987) (-1043.873) [-1035.724] * (-1040.096) (-1040.528) [-1043.248] (-1040.026) -- 0:00:55
599000 -- (-1039.157) [-1036.046] (-1034.636) (-1036.124) * [-1042.928] (-1037.624) (-1037.836) (-1035.530) -- 0:00:54
599500 -- (-1037.304) (-1044.830) [-1035.744] (-1036.993) * (-1040.789) (-1037.509) [-1037.286] (-1044.282) -- 0:00:54
600000 -- (-1038.778) (-1037.424) (-1045.844) [-1040.029] * [-1037.334] (-1037.610) (-1043.718) (-1048.015) -- 0:00:54
Average standard deviation of split frequencies: 0.012557
600500 -- (-1043.363) (-1044.792) (-1043.333) [-1037.314] * (-1037.725) (-1039.680) [-1038.794] (-1040.587) -- 0:00:54
601000 -- [-1037.503] (-1045.901) (-1035.985) (-1040.567) * [-1040.710] (-1041.712) (-1042.577) (-1043.804) -- 0:00:54
601500 -- [-1034.827] (-1035.627) (-1036.616) (-1036.977) * (-1040.835) (-1042.941) (-1049.640) [-1041.056] -- 0:00:54
602000 -- (-1043.846) (-1044.759) [-1038.064] (-1048.064) * [-1037.292] (-1038.685) (-1043.531) (-1048.366) -- 0:00:54
602500 -- (-1036.059) (-1043.519) (-1040.246) [-1035.436] * [-1037.153] (-1037.908) (-1044.829) (-1043.519) -- 0:00:54
603000 -- [-1040.086] (-1037.557) (-1037.589) (-1041.542) * (-1043.002) (-1040.729) [-1038.912] (-1044.137) -- 0:00:53
603500 -- (-1041.771) (-1043.103) [-1036.977] (-1040.709) * (-1040.655) (-1036.101) [-1040.648] (-1037.805) -- 0:00:53
604000 -- (-1033.183) (-1039.573) [-1037.250] (-1043.547) * [-1037.190] (-1037.995) (-1041.567) (-1038.369) -- 0:00:54
604500 -- (-1049.553) (-1039.012) [-1038.356] (-1039.514) * [-1039.262] (-1036.788) (-1045.671) (-1039.014) -- 0:00:54
605000 -- (-1037.536) (-1039.500) [-1036.234] (-1036.121) * [-1038.539] (-1037.373) (-1042.298) (-1039.094) -- 0:00:54
Average standard deviation of split frequencies: 0.013224
605500 -- (-1034.809) (-1036.517) (-1036.570) [-1034.951] * (-1041.522) [-1038.504] (-1046.933) (-1041.757) -- 0:00:54
606000 -- (-1038.224) [-1039.361] (-1035.879) (-1039.200) * [-1041.111] (-1042.037) (-1042.038) (-1041.379) -- 0:00:53
606500 -- (-1035.669) (-1036.724) [-1037.706] (-1037.552) * [-1038.055] (-1040.462) (-1035.138) (-1040.161) -- 0:00:53
607000 -- (-1041.793) (-1039.689) (-1042.917) [-1037.091] * (-1036.530) (-1040.221) [-1038.080] (-1037.297) -- 0:00:53
607500 -- [-1035.626] (-1037.650) (-1039.887) (-1041.995) * [-1041.203] (-1039.195) (-1035.622) (-1040.885) -- 0:00:53
608000 -- (-1035.334) (-1045.479) [-1040.805] (-1039.696) * [-1037.157] (-1039.722) (-1039.938) (-1038.068) -- 0:00:53
608500 -- (-1037.898) [-1038.167] (-1047.131) (-1039.984) * (-1036.903) [-1039.688] (-1039.637) (-1037.122) -- 0:00:53
609000 -- (-1041.298) (-1038.925) (-1045.609) [-1035.728] * (-1043.221) (-1038.688) [-1036.639] (-1035.663) -- 0:00:53
609500 -- (-1036.499) [-1040.385] (-1042.626) (-1039.213) * (-1040.626) (-1042.667) [-1041.237] (-1037.725) -- 0:00:53
610000 -- (-1039.665) [-1041.579] (-1045.420) (-1035.388) * (-1038.856) (-1040.500) [-1043.434] (-1039.527) -- 0:00:53
Average standard deviation of split frequencies: 0.011579
610500 -- (-1045.444) (-1037.833) [-1040.163] (-1043.506) * (-1040.463) (-1037.224) (-1045.423) [-1038.839] -- 0:00:52
611000 -- [-1040.415] (-1036.148) (-1037.846) (-1038.002) * (-1036.407) [-1038.903] (-1041.799) (-1041.748) -- 0:00:53
611500 -- [-1034.218] (-1049.357) (-1037.436) (-1036.314) * (-1039.194) (-1038.293) (-1048.638) [-1041.403] -- 0:00:53
612000 -- (-1044.430) (-1046.756) (-1039.186) [-1038.203] * (-1043.959) (-1041.884) [-1040.965] (-1037.921) -- 0:00:53
612500 -- (-1037.925) [-1038.545] (-1040.517) (-1043.198) * [-1034.346] (-1041.335) (-1042.462) (-1043.235) -- 0:00:53
613000 -- (-1036.663) (-1038.015) [-1038.978] (-1037.347) * (-1043.166) (-1037.958) [-1038.431] (-1045.558) -- 0:00:53
613500 -- (-1038.581) (-1047.093) (-1043.406) [-1036.800] * [-1040.658] (-1033.989) (-1040.952) (-1044.733) -- 0:00:52
614000 -- (-1039.094) (-1044.767) [-1039.959] (-1037.261) * [-1041.511] (-1039.825) (-1035.633) (-1051.598) -- 0:00:52
614500 -- [-1035.308] (-1038.359) (-1037.146) (-1034.489) * [-1039.254] (-1042.195) (-1034.459) (-1038.938) -- 0:00:52
615000 -- (-1036.566) (-1039.676) (-1041.750) [-1036.789] * (-1040.379) (-1036.479) (-1036.310) [-1035.194] -- 0:00:52
Average standard deviation of split frequencies: 0.011479
615500 -- [-1037.209] (-1034.787) (-1044.583) (-1040.314) * (-1036.119) [-1042.358] (-1048.983) (-1042.973) -- 0:00:52
616000 -- [-1039.917] (-1034.674) (-1041.593) (-1039.797) * [-1039.209] (-1037.692) (-1042.030) (-1039.022) -- 0:00:52
616500 -- (-1040.118) (-1039.819) (-1038.165) [-1043.682] * (-1037.683) (-1039.869) (-1040.382) [-1036.405] -- 0:00:52
617000 -- (-1036.651) (-1042.201) (-1037.952) [-1035.728] * [-1038.850] (-1039.540) (-1036.305) (-1038.782) -- 0:00:52
617500 -- (-1038.161) (-1037.496) [-1038.184] (-1041.831) * (-1039.116) (-1041.320) [-1040.179] (-1039.763) -- 0:00:52
618000 -- (-1038.213) (-1035.873) (-1040.129) [-1043.239] * (-1041.251) (-1038.221) [-1037.048] (-1040.729) -- 0:00:51
618500 -- (-1044.361) (-1036.524) (-1039.929) [-1040.132] * (-1043.400) (-1044.844) (-1034.869) [-1038.351] -- 0:00:52
619000 -- [-1039.996] (-1039.405) (-1038.961) (-1039.875) * [-1039.234] (-1045.837) (-1036.344) (-1036.274) -- 0:00:52
619500 -- (-1048.513) (-1036.785) (-1037.197) [-1034.232] * (-1044.187) [-1039.841] (-1038.253) (-1042.554) -- 0:00:52
620000 -- (-1040.195) (-1037.684) [-1039.225] (-1035.213) * (-1039.345) [-1042.362] (-1035.513) (-1036.898) -- 0:00:52
Average standard deviation of split frequencies: 0.010633
620500 -- (-1044.512) (-1039.643) [-1040.081] (-1036.879) * [-1037.457] (-1045.519) (-1043.446) (-1042.016) -- 0:00:51
621000 -- [-1039.911] (-1038.154) (-1039.220) (-1035.777) * [-1036.491] (-1042.939) (-1035.061) (-1039.893) -- 0:00:51
621500 -- (-1046.770) [-1037.323] (-1041.747) (-1039.121) * (-1040.215) (-1035.394) (-1043.229) [-1038.497] -- 0:00:51
622000 -- (-1046.270) (-1038.140) [-1041.009] (-1034.406) * [-1035.107] (-1042.021) (-1034.281) (-1041.347) -- 0:00:51
622500 -- (-1045.590) (-1036.563) (-1037.363) [-1035.667] * (-1036.922) (-1036.194) (-1042.460) [-1037.053] -- 0:00:51
623000 -- (-1049.295) (-1038.600) [-1038.117] (-1035.754) * (-1040.242) (-1034.490) (-1037.496) [-1035.776] -- 0:00:51
623500 -- (-1046.677) [-1039.353] (-1038.022) (-1034.119) * (-1037.623) (-1038.193) (-1038.500) [-1039.468] -- 0:00:51
624000 -- (-1048.223) [-1041.055] (-1037.545) (-1036.349) * [-1038.109] (-1042.474) (-1039.243) (-1044.580) -- 0:00:51
624500 -- (-1046.888) (-1041.457) (-1044.618) [-1039.616] * (-1041.553) (-1040.687) [-1036.183] (-1036.274) -- 0:00:51
625000 -- [-1039.019] (-1040.650) (-1044.546) (-1048.221) * (-1040.518) (-1041.305) [-1034.932] (-1042.222) -- 0:00:51
Average standard deviation of split frequencies: 0.012049
625500 -- [-1042.224] (-1041.443) (-1045.096) (-1035.387) * (-1036.052) [-1040.462] (-1038.923) (-1036.260) -- 0:00:50
626000 -- [-1041.468] (-1040.627) (-1037.456) (-1039.578) * (-1039.196) [-1041.475] (-1043.311) (-1039.758) -- 0:00:51
626500 -- (-1041.723) (-1040.736) [-1035.626] (-1040.475) * (-1038.994) (-1037.577) [-1035.093] (-1041.959) -- 0:00:51
627000 -- (-1051.269) [-1040.208] (-1039.342) (-1040.923) * (-1040.651) (-1038.183) [-1037.320] (-1038.153) -- 0:00:51
627500 -- (-1048.867) (-1045.482) [-1043.182] (-1039.083) * [-1040.403] (-1037.773) (-1033.826) (-1039.553) -- 0:00:51
628000 -- (-1039.691) (-1038.625) [-1038.238] (-1040.338) * [-1041.914] (-1043.533) (-1042.166) (-1040.754) -- 0:00:50
628500 -- (-1038.491) [-1035.451] (-1039.283) (-1037.754) * (-1038.203) (-1039.439) [-1036.349] (-1038.418) -- 0:00:50
629000 -- (-1042.639) (-1037.911) [-1043.651] (-1041.930) * (-1038.428) (-1042.002) [-1037.269] (-1035.933) -- 0:00:50
629500 -- [-1037.723] (-1042.302) (-1045.132) (-1042.307) * (-1038.969) (-1039.783) (-1040.879) [-1035.668] -- 0:00:50
630000 -- [-1041.634] (-1038.521) (-1044.049) (-1044.018) * (-1038.934) (-1034.652) (-1038.873) [-1038.615] -- 0:00:50
Average standard deviation of split frequencies: 0.011960
630500 -- (-1040.826) [-1035.400] (-1039.857) (-1036.461) * (-1034.235) (-1035.040) (-1040.379) [-1034.594] -- 0:00:50
631000 -- (-1038.213) [-1035.758] (-1040.228) (-1037.855) * (-1035.599) (-1038.728) (-1040.115) [-1039.694] -- 0:00:50
631500 -- (-1037.979) [-1036.497] (-1041.277) (-1036.178) * (-1040.163) (-1038.739) (-1041.737) [-1038.332] -- 0:00:50
632000 -- [-1048.543] (-1044.244) (-1041.433) (-1035.989) * (-1043.427) [-1042.279] (-1044.176) (-1040.866) -- 0:00:50
632500 -- (-1040.604) (-1037.581) [-1039.047] (-1043.028) * (-1042.780) (-1037.702) (-1037.642) [-1039.329] -- 0:00:49
633000 -- (-1042.326) (-1036.558) (-1039.848) [-1036.571] * (-1041.054) [-1037.233] (-1037.112) (-1037.042) -- 0:00:49
633500 -- (-1042.344) (-1044.172) [-1036.931] (-1042.988) * (-1042.574) (-1040.513) (-1034.686) [-1041.464] -- 0:00:50
634000 -- (-1039.516) [-1042.416] (-1041.146) (-1041.906) * (-1048.773) [-1037.741] (-1039.497) (-1041.318) -- 0:00:50
634500 -- (-1039.723) [-1037.816] (-1042.871) (-1041.795) * (-1040.950) [-1035.937] (-1036.526) (-1043.645) -- 0:00:50
635000 -- (-1038.475) [-1040.691] (-1041.333) (-1046.700) * (-1043.125) (-1044.222) [-1033.348] (-1049.821) -- 0:00:50
Average standard deviation of split frequencies: 0.010377
635500 -- (-1036.321) (-1043.338) [-1038.911] (-1041.866) * [-1038.266] (-1036.447) (-1037.869) (-1040.699) -- 0:00:49
636000 -- (-1034.224) (-1034.939) (-1037.082) [-1038.064] * (-1044.908) (-1043.843) (-1039.821) [-1042.938] -- 0:00:49
636500 -- (-1033.031) (-1041.077) (-1037.082) [-1040.092] * (-1039.472) (-1042.820) (-1039.721) [-1040.903] -- 0:00:49
637000 -- [-1040.362] (-1036.570) (-1036.621) (-1039.048) * (-1037.156) (-1039.039) (-1041.322) [-1034.808] -- 0:00:49
637500 -- (-1038.674) (-1037.606) [-1041.198] (-1039.946) * (-1040.371) (-1040.248) (-1038.282) [-1040.131] -- 0:00:49
638000 -- [-1036.915] (-1039.508) (-1037.834) (-1036.770) * (-1039.091) (-1043.517) [-1037.317] (-1036.970) -- 0:00:49
638500 -- (-1042.502) [-1036.608] (-1036.449) (-1037.792) * (-1039.641) [-1036.588] (-1039.273) (-1042.851) -- 0:00:49
639000 -- [-1038.186] (-1035.779) (-1035.726) (-1036.382) * (-1037.669) (-1045.625) [-1034.441] (-1040.859) -- 0:00:49
639500 -- (-1037.374) [-1041.148] (-1041.879) (-1039.132) * (-1048.622) (-1038.522) [-1038.494] (-1039.653) -- 0:00:49
640000 -- [-1037.647] (-1036.433) (-1044.157) (-1036.466) * [-1039.887] (-1036.651) (-1037.292) (-1043.609) -- 0:00:48
Average standard deviation of split frequencies: 0.011773
640500 -- (-1044.762) [-1035.568] (-1037.938) (-1034.290) * [-1041.195] (-1041.645) (-1036.542) (-1047.039) -- 0:00:49
641000 -- (-1041.435) (-1039.208) [-1042.785] (-1037.467) * (-1043.186) (-1036.493) [-1034.094] (-1046.793) -- 0:00:49
641500 -- (-1043.081) (-1045.254) [-1033.872] (-1038.081) * (-1036.429) (-1039.759) [-1039.030] (-1043.680) -- 0:00:49
642000 -- (-1038.634) [-1036.303] (-1038.940) (-1043.957) * (-1036.125) (-1035.889) (-1034.145) [-1045.639] -- 0:00:49
642500 -- [-1034.587] (-1039.445) (-1040.900) (-1051.485) * (-1042.672) (-1045.475) (-1042.224) [-1036.024] -- 0:00:48
643000 -- (-1034.420) [-1038.313] (-1036.056) (-1039.363) * (-1040.725) (-1041.035) (-1038.950) [-1042.326] -- 0:00:48
643500 -- (-1041.247) (-1036.005) [-1035.372] (-1043.091) * (-1036.331) (-1037.437) (-1034.866) [-1040.061] -- 0:00:48
644000 -- (-1041.427) (-1033.972) [-1041.604] (-1048.818) * (-1038.143) [-1036.347] (-1037.149) (-1039.934) -- 0:00:48
644500 -- (-1049.137) [-1036.568] (-1035.766) (-1039.436) * [-1034.724] (-1037.411) (-1040.310) (-1042.445) -- 0:00:48
645000 -- (-1051.747) [-1034.675] (-1042.353) (-1041.216) * [-1038.149] (-1035.216) (-1038.192) (-1039.191) -- 0:00:48
Average standard deviation of split frequencies: 0.010216
645500 -- (-1041.806) [-1039.130] (-1041.698) (-1035.019) * (-1038.500) (-1040.361) [-1036.128] (-1041.888) -- 0:00:48
646000 -- (-1047.273) (-1039.400) [-1037.736] (-1036.951) * (-1037.653) (-1037.739) [-1038.324] (-1046.808) -- 0:00:48
646500 -- (-1044.474) [-1043.161] (-1034.103) (-1038.043) * (-1036.026) (-1040.597) [-1036.701] (-1041.276) -- 0:00:48
647000 -- (-1043.989) [-1044.407] (-1037.470) (-1038.814) * (-1039.248) (-1042.163) [-1036.370] (-1040.544) -- 0:00:48
647500 -- (-1040.005) (-1042.041) [-1040.259] (-1036.036) * (-1038.486) [-1034.185] (-1037.262) (-1040.447) -- 0:00:47
648000 -- (-1041.351) [-1042.405] (-1040.999) (-1036.792) * (-1036.425) [-1041.792] (-1038.360) (-1036.804) -- 0:00:48
648500 -- (-1041.470) [-1034.059] (-1038.618) (-1038.393) * (-1035.487) [-1038.539] (-1037.857) (-1035.936) -- 0:00:48
649000 -- (-1037.333) [-1035.428] (-1037.804) (-1046.651) * (-1036.025) [-1038.895] (-1041.632) (-1037.254) -- 0:00:48
649500 -- (-1039.232) [-1032.897] (-1041.483) (-1033.579) * (-1042.197) (-1045.009) [-1034.709] (-1035.013) -- 0:00:48
650000 -- (-1035.259) (-1036.395) (-1038.962) [-1034.316] * (-1037.253) [-1037.762] (-1038.466) (-1037.619) -- 0:00:47
Average standard deviation of split frequencies: 0.008694
650500 -- [-1042.228] (-1041.617) (-1035.403) (-1037.247) * [-1035.046] (-1036.795) (-1045.371) (-1038.620) -- 0:00:47
651000 -- (-1036.688) (-1037.124) (-1036.457) [-1037.664] * (-1039.489) (-1034.048) [-1039.422] (-1039.522) -- 0:00:47
651500 -- [-1036.014] (-1039.559) (-1034.340) (-1038.281) * (-1040.318) (-1037.461) (-1040.048) [-1041.411] -- 0:00:47
652000 -- (-1041.912) [-1035.807] (-1036.109) (-1037.200) * (-1037.649) [-1044.708] (-1044.457) (-1041.400) -- 0:00:47
652500 -- (-1039.856) (-1038.014) [-1039.008] (-1039.175) * (-1044.914) [-1038.391] (-1045.378) (-1041.285) -- 0:00:47
653000 -- (-1036.772) (-1034.831) (-1044.977) [-1035.169] * (-1036.789) [-1042.675] (-1039.946) (-1033.846) -- 0:00:47
653500 -- [-1035.284] (-1037.589) (-1041.700) (-1038.612) * (-1040.662) [-1039.230] (-1043.057) (-1049.127) -- 0:00:47
654000 -- (-1042.211) (-1037.107) [-1038.209] (-1037.001) * [-1045.115] (-1035.742) (-1040.222) (-1038.425) -- 0:00:47
654500 -- [-1040.775] (-1038.887) (-1038.064) (-1035.808) * (-1039.395) [-1042.849] (-1038.649) (-1036.965) -- 0:00:46
655000 -- (-1038.424) (-1036.378) (-1039.657) [-1034.378] * (-1042.407) [-1035.964] (-1039.817) (-1039.554) -- 0:00:46
Average standard deviation of split frequencies: 0.007186
655500 -- [-1039.018] (-1041.548) (-1036.723) (-1039.790) * (-1042.162) (-1040.563) (-1039.696) [-1036.073] -- 0:00:47
656000 -- (-1039.354) (-1041.266) (-1041.902) [-1040.804] * (-1038.881) (-1045.456) (-1039.908) [-1040.111] -- 0:00:47
656500 -- (-1037.863) [-1036.464] (-1044.821) (-1040.973) * [-1035.047] (-1054.466) (-1042.166) (-1041.947) -- 0:00:47
657000 -- [-1040.237] (-1045.947) (-1044.457) (-1045.206) * (-1036.436) (-1042.960) (-1038.547) [-1040.420] -- 0:00:46
657500 -- (-1047.041) [-1042.714] (-1042.204) (-1042.510) * [-1038.649] (-1050.009) (-1039.232) (-1042.892) -- 0:00:46
658000 -- (-1044.873) (-1036.993) [-1037.159] (-1037.201) * [-1035.633] (-1048.933) (-1039.592) (-1042.593) -- 0:00:46
658500 -- [-1039.776] (-1039.520) (-1041.033) (-1038.849) * (-1042.233) [-1037.596] (-1047.219) (-1042.603) -- 0:00:46
659000 -- (-1042.712) [-1037.427] (-1034.774) (-1041.336) * (-1037.249) (-1037.675) (-1040.882) [-1039.437] -- 0:00:46
659500 -- (-1041.022) (-1040.075) [-1037.247] (-1045.477) * (-1045.675) (-1042.866) [-1034.308] (-1044.924) -- 0:00:46
660000 -- (-1036.969) [-1042.079] (-1037.444) (-1036.243) * (-1044.736) (-1040.506) (-1034.393) [-1037.313] -- 0:00:46
Average standard deviation of split frequencies: 0.005708
660500 -- (-1043.763) (-1035.046) [-1039.759] (-1037.876) * [-1040.316] (-1040.712) (-1035.959) (-1040.720) -- 0:00:46
661000 -- (-1037.867) (-1041.844) (-1039.813) [-1035.092] * (-1037.898) [-1041.784] (-1037.447) (-1037.652) -- 0:00:46
661500 -- (-1034.216) (-1041.457) [-1039.938] (-1038.660) * [-1035.580] (-1041.274) (-1046.317) (-1044.885) -- 0:00:46
662000 -- (-1033.853) (-1041.253) (-1037.078) [-1038.974] * [-1041.399] (-1044.834) (-1042.465) (-1039.640) -- 0:00:45
662500 -- [-1044.829] (-1037.529) (-1039.458) (-1039.401) * (-1040.101) (-1042.903) (-1036.609) [-1040.154] -- 0:00:45
663000 -- (-1040.505) (-1044.058) [-1035.472] (-1039.587) * [-1035.618] (-1039.492) (-1044.123) (-1037.269) -- 0:00:46
663500 -- (-1040.670) (-1043.068) [-1044.441] (-1047.309) * (-1039.028) [-1036.461] (-1041.057) (-1041.231) -- 0:00:46
664000 -- (-1036.473) (-1038.529) [-1034.246] (-1039.142) * (-1035.641) (-1040.680) [-1034.050] (-1043.372) -- 0:00:46
664500 -- (-1036.559) [-1033.980] (-1041.464) (-1045.170) * [-1034.926] (-1038.344) (-1036.226) (-1046.786) -- 0:00:45
665000 -- (-1038.101) (-1035.955) [-1040.184] (-1045.859) * (-1039.268) [-1038.908] (-1043.232) (-1036.263) -- 0:00:45
Average standard deviation of split frequencies: 0.006370
665500 -- [-1035.475] (-1040.566) (-1039.235) (-1034.934) * (-1041.407) (-1048.128) [-1040.461] (-1039.592) -- 0:00:45
666000 -- (-1046.127) (-1037.577) (-1034.632) [-1037.381] * (-1036.903) (-1040.460) (-1038.358) [-1040.291] -- 0:00:45
666500 -- (-1038.387) (-1038.016) (-1043.144) [-1037.646] * (-1041.972) (-1037.992) [-1037.015] (-1036.822) -- 0:00:45
667000 -- [-1037.166] (-1033.758) (-1041.197) (-1040.545) * [-1041.655] (-1034.457) (-1043.344) (-1037.473) -- 0:00:45
667500 -- (-1042.671) (-1037.856) (-1041.368) [-1033.902] * (-1044.428) (-1040.966) [-1037.929] (-1043.988) -- 0:00:45
668000 -- (-1041.746) [-1036.374] (-1038.672) (-1036.678) * (-1036.625) [-1038.533] (-1042.297) (-1041.212) -- 0:00:45
668500 -- [-1038.773] (-1039.542) (-1035.038) (-1035.272) * (-1035.564) (-1036.590) (-1043.666) [-1039.310] -- 0:00:45
669000 -- [-1037.036] (-1035.314) (-1036.497) (-1035.026) * (-1047.104) (-1043.680) [-1043.621] (-1042.289) -- 0:00:45
669500 -- (-1039.210) (-1041.432) (-1037.214) [-1047.303] * [-1034.771] (-1038.663) (-1038.752) (-1040.230) -- 0:00:45
670000 -- (-1040.086) (-1044.836) (-1038.629) [-1038.321] * (-1039.955) (-1035.776) [-1038.506] (-1039.510) -- 0:00:45
Average standard deviation of split frequencies: 0.007029
670500 -- (-1041.198) [-1036.976] (-1037.443) (-1035.794) * (-1039.560) [-1039.282] (-1039.364) (-1038.057) -- 0:00:45
671000 -- (-1045.309) (-1037.784) (-1045.566) [-1037.536] * (-1041.241) (-1038.669) (-1033.284) [-1039.409] -- 0:00:45
671500 -- [-1034.774] (-1040.784) (-1049.621) (-1037.615) * (-1038.808) (-1038.434) [-1039.970] (-1042.292) -- 0:00:45
672000 -- (-1038.499) (-1038.498) [-1038.461] (-1036.954) * (-1042.931) (-1039.572) (-1042.067) [-1037.976] -- 0:00:44
672500 -- (-1042.360) (-1037.945) (-1038.653) [-1038.061] * [-1041.558] (-1040.003) (-1035.092) (-1044.958) -- 0:00:44
673000 -- (-1040.876) (-1038.438) [-1035.920] (-1043.933) * (-1042.834) [-1039.402] (-1038.692) (-1045.999) -- 0:00:44
673500 -- [-1039.838] (-1035.881) (-1038.133) (-1042.234) * (-1040.371) (-1038.687) [-1038.815] (-1038.170) -- 0:00:44
674000 -- (-1037.355) [-1036.910] (-1036.867) (-1045.214) * [-1034.965] (-1038.822) (-1035.231) (-1039.365) -- 0:00:44
674500 -- (-1035.836) (-1039.219) [-1037.206] (-1039.293) * (-1037.659) [-1036.190] (-1036.288) (-1037.664) -- 0:00:44
675000 -- (-1041.725) [-1041.459] (-1041.495) (-1042.024) * (-1045.833) (-1033.718) [-1043.783] (-1037.110) -- 0:00:44
Average standard deviation of split frequencies: 0.007671
675500 -- (-1041.249) (-1042.165) (-1037.810) [-1039.858] * (-1037.528) [-1039.052] (-1037.976) (-1036.106) -- 0:00:44
676000 -- [-1039.265] (-1035.611) (-1034.621) (-1038.655) * (-1036.311) (-1036.744) [-1035.161] (-1036.920) -- 0:00:44
676500 -- [-1045.303] (-1041.237) (-1041.809) (-1043.693) * [-1036.710] (-1039.533) (-1042.266) (-1038.891) -- 0:00:44
677000 -- [-1038.508] (-1038.314) (-1035.150) (-1039.008) * (-1047.860) (-1041.945) (-1038.517) [-1034.975] -- 0:00:44
677500 -- [-1037.792] (-1041.025) (-1038.386) (-1038.467) * (-1039.231) (-1041.989) [-1035.897] (-1037.454) -- 0:00:44
678000 -- (-1038.035) (-1038.523) [-1036.545] (-1042.622) * (-1038.804) (-1041.800) [-1041.117] (-1040.211) -- 0:00:44
678500 -- (-1035.767) [-1039.121] (-1036.785) (-1047.620) * (-1038.744) (-1043.466) [-1038.070] (-1039.751) -- 0:00:44
679000 -- (-1041.505) [-1036.545] (-1034.269) (-1042.628) * (-1040.468) (-1040.354) [-1039.544] (-1042.439) -- 0:00:43
679500 -- (-1041.277) [-1035.821] (-1035.305) (-1034.153) * (-1045.110) [-1042.724] (-1038.301) (-1040.967) -- 0:00:43
680000 -- [-1036.597] (-1037.069) (-1041.606) (-1037.178) * (-1044.005) (-1034.376) [-1035.253] (-1033.481) -- 0:00:43
Average standard deviation of split frequencies: 0.006926
680500 -- [-1036.241] (-1035.679) (-1043.194) (-1036.690) * (-1039.077) (-1038.660) (-1038.159) [-1049.833] -- 0:00:43
681000 -- (-1042.486) [-1037.767] (-1039.561) (-1041.066) * [-1037.395] (-1044.086) (-1036.652) (-1038.757) -- 0:00:43
681500 -- [-1041.480] (-1042.894) (-1036.023) (-1038.789) * (-1037.606) (-1036.284) [-1038.480] (-1043.774) -- 0:00:43
682000 -- (-1037.201) [-1035.142] (-1038.264) (-1040.495) * (-1037.043) (-1039.699) [-1036.309] (-1047.753) -- 0:00:43
682500 -- [-1043.371] (-1041.533) (-1035.658) (-1043.042) * [-1038.460] (-1044.686) (-1039.192) (-1038.179) -- 0:00:43
683000 -- (-1041.700) (-1037.914) (-1035.535) [-1039.841] * (-1040.416) [-1037.347] (-1037.570) (-1034.744) -- 0:00:43
683500 -- (-1043.365) [-1037.792] (-1036.358) (-1037.761) * [-1036.672] (-1039.193) (-1041.579) (-1038.843) -- 0:00:43
684000 -- [-1037.757] (-1038.635) (-1038.993) (-1035.835) * (-1035.801) [-1036.935] (-1037.278) (-1039.758) -- 0:00:43
684500 -- (-1040.465) (-1037.234) [-1038.405] (-1039.800) * (-1034.381) (-1037.984) (-1038.865) [-1037.363] -- 0:00:43
685000 -- (-1035.815) (-1037.576) [-1035.099] (-1034.382) * (-1041.188) [-1035.815] (-1041.119) (-1040.244) -- 0:00:43
Average standard deviation of split frequencies: 0.005497
685500 -- [-1035.221] (-1036.186) (-1039.933) (-1044.663) * (-1039.034) [-1038.149] (-1041.800) (-1041.342) -- 0:00:43
686000 -- (-1043.434) [-1036.406] (-1042.896) (-1038.797) * (-1043.327) (-1033.771) (-1041.570) [-1039.550] -- 0:00:43
686500 -- (-1038.569) [-1035.840] (-1041.109) (-1038.137) * [-1041.494] (-1035.885) (-1039.359) (-1035.110) -- 0:00:42
687000 -- (-1037.370) [-1033.576] (-1038.679) (-1035.547) * [-1035.067] (-1039.391) (-1045.133) (-1037.204) -- 0:00:42
687500 -- (-1040.314) (-1046.295) [-1035.418] (-1037.636) * (-1036.654) [-1037.670] (-1042.124) (-1038.842) -- 0:00:42
688000 -- [-1036.815] (-1039.129) (-1035.404) (-1039.224) * (-1039.064) [-1038.566] (-1037.292) (-1035.326) -- 0:00:42
688500 -- (-1041.479) [-1037.952] (-1039.807) (-1038.504) * [-1034.164] (-1038.814) (-1038.177) (-1038.459) -- 0:00:42
689000 -- (-1038.934) [-1041.461] (-1037.043) (-1040.804) * [-1037.633] (-1041.953) (-1040.794) (-1035.570) -- 0:00:42
689500 -- [-1038.728] (-1039.595) (-1039.769) (-1034.671) * (-1035.225) (-1035.074) [-1040.642] (-1036.625) -- 0:00:42
690000 -- (-1040.027) [-1036.960] (-1039.527) (-1046.436) * (-1045.773) [-1040.895] (-1039.490) (-1043.313) -- 0:00:42
Average standard deviation of split frequencies: 0.007508
690500 -- (-1039.892) [-1036.380] (-1036.323) (-1044.824) * (-1039.029) (-1038.321) [-1039.356] (-1038.801) -- 0:00:42
691000 -- (-1036.719) [-1042.539] (-1037.515) (-1043.291) * [-1038.374] (-1035.279) (-1043.561) (-1041.675) -- 0:00:42
691500 -- [-1035.369] (-1037.801) (-1038.227) (-1036.739) * [-1033.802] (-1042.555) (-1052.354) (-1038.348) -- 0:00:42
692000 -- [-1039.577] (-1037.304) (-1041.449) (-1038.252) * (-1035.525) (-1040.788) (-1042.355) [-1040.533] -- 0:00:42
692500 -- (-1038.706) (-1035.892) [-1034.984] (-1040.532) * (-1038.720) [-1037.463] (-1041.282) (-1034.803) -- 0:00:42
693000 -- (-1041.687) (-1037.288) [-1041.248] (-1047.878) * (-1036.661) (-1040.116) (-1043.304) [-1036.716] -- 0:00:42
693500 -- [-1036.215] (-1037.634) (-1049.939) (-1036.046) * (-1039.430) [-1036.797] (-1041.587) (-1040.999) -- 0:00:41
694000 -- (-1041.203) (-1038.308) [-1038.985] (-1035.285) * (-1036.194) (-1037.357) (-1042.328) [-1049.065] -- 0:00:41
694500 -- (-1039.406) [-1035.684] (-1041.252) (-1039.257) * [-1037.255] (-1037.096) (-1044.159) (-1036.825) -- 0:00:41
695000 -- (-1037.065) (-1042.610) (-1036.127) [-1041.458] * (-1038.482) (-1035.194) (-1039.467) [-1038.126] -- 0:00:41
Average standard deviation of split frequencies: 0.006773
695500 -- (-1036.558) (-1040.736) (-1039.947) [-1043.191] * (-1042.385) [-1038.541] (-1040.629) (-1041.976) -- 0:00:41
696000 -- (-1034.692) (-1039.963) [-1044.051] (-1035.496) * (-1045.663) [-1039.246] (-1037.832) (-1040.090) -- 0:00:41
696500 -- [-1033.986] (-1035.856) (-1034.649) (-1038.281) * (-1044.984) [-1038.552] (-1040.190) (-1040.593) -- 0:00:41
697000 -- [-1035.787] (-1034.990) (-1039.242) (-1035.265) * [-1037.044] (-1041.017) (-1034.801) (-1035.895) -- 0:00:41
697500 -- [-1041.461] (-1043.202) (-1039.972) (-1032.642) * [-1039.142] (-1043.499) (-1037.546) (-1034.473) -- 0:00:41
698000 -- (-1036.022) [-1041.731] (-1038.494) (-1038.690) * (-1039.152) (-1045.326) [-1036.608] (-1043.063) -- 0:00:41
698500 -- [-1035.204] (-1036.204) (-1039.745) (-1039.913) * [-1039.301] (-1034.991) (-1038.487) (-1037.079) -- 0:00:41
699000 -- (-1034.630) (-1037.003) [-1036.946] (-1039.614) * (-1041.879) (-1035.020) (-1035.513) [-1042.970] -- 0:00:41
699500 -- (-1041.528) [-1038.360] (-1035.147) (-1039.640) * [-1039.754] (-1041.266) (-1036.882) (-1039.334) -- 0:00:41
700000 -- (-1036.338) [-1036.834] (-1038.850) (-1045.787) * (-1034.870) (-1038.837) (-1036.696) [-1040.545] -- 0:00:41
Average standard deviation of split frequencies: 0.004037
700500 -- (-1041.546) (-1034.064) (-1044.063) [-1037.416] * (-1038.266) [-1036.602] (-1036.732) (-1046.975) -- 0:00:41
701000 -- (-1039.711) (-1034.574) [-1038.601] (-1042.699) * (-1040.065) (-1036.868) [-1036.726] (-1043.660) -- 0:00:40
701500 -- [-1039.102] (-1042.828) (-1041.870) (-1044.761) * [-1036.386] (-1043.602) (-1036.740) (-1040.160) -- 0:00:40
702000 -- (-1045.159) (-1040.218) (-1045.137) [-1038.082] * (-1036.106) (-1043.700) [-1037.852] (-1039.366) -- 0:00:40
702500 -- (-1039.648) (-1036.546) [-1038.292] (-1042.459) * [-1037.051] (-1044.722) (-1041.095) (-1040.998) -- 0:00:40
703000 -- [-1036.079] (-1043.787) (-1036.158) (-1042.818) * [-1041.319] (-1036.385) (-1038.352) (-1039.847) -- 0:00:40
703500 -- (-1037.826) (-1045.355) (-1039.150) [-1042.163] * (-1040.975) [-1038.684] (-1038.245) (-1040.820) -- 0:00:40
704000 -- (-1043.001) (-1040.515) [-1033.992] (-1040.825) * (-1041.109) (-1040.616) [-1039.785] (-1037.767) -- 0:00:40
704500 -- [-1039.535] (-1042.169) (-1045.699) (-1037.965) * (-1042.700) [-1036.719] (-1037.471) (-1041.110) -- 0:00:40
705000 -- [-1035.585] (-1042.464) (-1044.103) (-1039.767) * [-1034.648] (-1039.846) (-1039.798) (-1042.212) -- 0:00:40
Average standard deviation of split frequencies: 0.004006
705500 -- (-1035.760) (-1035.155) [-1045.478] (-1039.566) * (-1042.842) [-1037.063] (-1036.126) (-1037.113) -- 0:00:40
706000 -- [-1039.469] (-1036.641) (-1043.742) (-1035.644) * (-1041.836) (-1040.826) [-1038.321] (-1036.498) -- 0:00:40
706500 -- (-1042.577) [-1036.007] (-1037.713) (-1041.180) * (-1038.483) (-1045.420) (-1040.479) [-1040.618] -- 0:00:40
707000 -- (-1036.735) (-1041.186) [-1035.128] (-1042.267) * (-1036.259) [-1036.316] (-1036.839) (-1036.667) -- 0:00:40
707500 -- [-1042.244] (-1039.169) (-1041.434) (-1037.842) * (-1047.589) [-1038.536] (-1045.162) (-1033.947) -- 0:00:40
708000 -- (-1042.378) (-1042.693) (-1035.507) [-1037.485] * (-1040.765) (-1036.745) [-1039.329] (-1043.098) -- 0:00:40
708500 -- [-1039.004] (-1036.235) (-1038.313) (-1042.774) * (-1039.227) (-1036.212) (-1045.771) [-1035.118] -- 0:00:39
709000 -- (-1040.154) (-1034.772) (-1040.072) [-1038.432] * [-1039.656] (-1040.911) (-1041.509) (-1036.294) -- 0:00:39
709500 -- [-1043.298] (-1045.553) (-1045.777) (-1043.025) * (-1046.565) (-1039.883) (-1046.690) [-1036.678] -- 0:00:39
710000 -- (-1043.893) (-1042.777) (-1036.307) [-1041.630] * [-1037.395] (-1035.774) (-1048.703) (-1042.526) -- 0:00:39
Average standard deviation of split frequencies: 0.001990
710500 -- [-1041.653] (-1039.391) (-1039.966) (-1036.724) * (-1036.822) [-1040.356] (-1038.505) (-1036.423) -- 0:00:39
711000 -- (-1042.571) (-1042.729) (-1036.924) [-1040.894] * (-1041.017) (-1036.060) (-1042.046) [-1041.673] -- 0:00:39
711500 -- (-1043.602) (-1039.938) [-1038.854] (-1038.507) * (-1034.619) (-1041.035) [-1036.965] (-1038.283) -- 0:00:39
712000 -- (-1039.011) [-1039.879] (-1036.112) (-1036.952) * (-1036.185) (-1041.833) (-1044.767) [-1036.375] -- 0:00:39
712500 -- (-1043.395) (-1037.718) (-1036.517) [-1036.160] * (-1036.811) (-1038.726) (-1044.488) [-1035.959] -- 0:00:39
713000 -- (-1039.517) (-1040.226) [-1037.545] (-1038.643) * (-1036.455) [-1043.194] (-1042.330) (-1039.972) -- 0:00:39
713500 -- (-1045.681) (-1036.592) (-1045.252) [-1040.123] * (-1047.230) (-1043.071) (-1048.183) [-1034.052] -- 0:00:39
714000 -- (-1045.405) [-1037.891] (-1042.512) (-1042.787) * [-1039.262] (-1036.743) (-1042.886) (-1035.967) -- 0:00:39
714500 -- (-1038.732) [-1039.798] (-1039.678) (-1040.014) * (-1043.918) (-1039.753) [-1046.632] (-1035.882) -- 0:00:39
715000 -- (-1039.146) (-1038.856) (-1042.210) [-1038.816] * (-1042.103) (-1044.932) (-1039.098) [-1035.496] -- 0:00:39
Average standard deviation of split frequencies: 0.001975
715500 -- (-1038.032) (-1041.434) (-1039.593) [-1041.651] * [-1037.984] (-1034.636) (-1039.899) (-1038.497) -- 0:00:38
716000 -- (-1038.515) [-1041.992] (-1037.568) (-1038.775) * [-1034.851] (-1036.721) (-1037.649) (-1042.433) -- 0:00:38
716500 -- (-1041.320) [-1035.397] (-1044.280) (-1042.139) * [-1034.878] (-1040.579) (-1040.430) (-1039.777) -- 0:00:39
717000 -- (-1038.499) (-1036.323) (-1040.063) [-1036.762] * (-1044.638) [-1043.061] (-1039.952) (-1037.810) -- 0:00:39
717500 -- (-1036.554) (-1038.801) (-1042.067) [-1041.916] * (-1039.403) [-1039.655] (-1040.261) (-1038.964) -- 0:00:38
718000 -- (-1041.454) [-1037.432] (-1038.040) (-1036.960) * (-1038.715) (-1042.811) (-1036.244) [-1036.111] -- 0:00:38
718500 -- [-1035.508] (-1038.859) (-1038.560) (-1037.452) * (-1040.537) (-1038.493) [-1039.476] (-1036.567) -- 0:00:38
719000 -- [-1041.807] (-1034.508) (-1042.267) (-1047.168) * (-1042.648) [-1034.767] (-1038.768) (-1038.050) -- 0:00:38
719500 -- (-1038.694) (-1039.160) [-1037.099] (-1036.906) * (-1042.999) [-1039.008] (-1039.321) (-1042.523) -- 0:00:38
720000 -- [-1045.137] (-1047.842) (-1036.473) (-1039.231) * (-1045.232) [-1038.153] (-1044.491) (-1041.981) -- 0:00:38
Average standard deviation of split frequencies: 0.000654
720500 -- [-1042.590] (-1040.376) (-1040.923) (-1042.894) * [-1042.605] (-1039.137) (-1035.950) (-1037.956) -- 0:00:38
721000 -- (-1037.121) [-1035.420] (-1036.271) (-1042.271) * [-1037.773] (-1040.398) (-1041.793) (-1036.268) -- 0:00:38
721500 -- (-1036.212) (-1036.208) [-1042.656] (-1039.563) * (-1042.291) [-1039.402] (-1043.894) (-1039.909) -- 0:00:38
722000 -- (-1037.302) (-1039.499) [-1036.898] (-1044.481) * (-1044.280) (-1038.460) (-1047.412) [-1037.976] -- 0:00:38
722500 -- (-1033.069) [-1035.987] (-1042.221) (-1040.291) * (-1038.830) (-1037.724) [-1044.210] (-1037.439) -- 0:00:38
723000 -- [-1040.499] (-1037.887) (-1041.257) (-1038.902) * (-1036.495) (-1042.111) [-1038.720] (-1038.720) -- 0:00:37
723500 -- (-1035.144) (-1036.242) [-1039.468] (-1037.279) * [-1035.382] (-1038.092) (-1038.314) (-1039.163) -- 0:00:37
724000 -- (-1037.814) [-1037.807] (-1032.478) (-1038.386) * [-1036.812] (-1048.724) (-1035.744) (-1040.569) -- 0:00:38
724500 -- (-1041.938) (-1039.033) [-1040.606] (-1039.288) * (-1042.326) (-1035.976) [-1042.832] (-1040.019) -- 0:00:38
725000 -- [-1034.734] (-1035.515) (-1034.888) (-1040.031) * (-1037.875) [-1036.832] (-1039.952) (-1035.479) -- 0:00:37
Average standard deviation of split frequencies: 0.000000
725500 -- (-1035.836) (-1036.043) [-1038.005] (-1039.163) * (-1049.190) [-1038.239] (-1041.992) (-1040.390) -- 0:00:37
726000 -- (-1036.307) (-1036.806) [-1035.310] (-1043.292) * (-1039.908) (-1045.980) [-1037.215] (-1042.791) -- 0:00:37
726500 -- (-1037.280) (-1035.520) (-1039.106) [-1034.990] * [-1040.740] (-1040.259) (-1035.590) (-1042.168) -- 0:00:37
727000 -- (-1036.385) (-1046.078) (-1035.598) [-1039.722] * [-1038.990] (-1035.909) (-1035.323) (-1040.881) -- 0:00:37
727500 -- (-1035.976) (-1037.618) [-1036.935] (-1034.802) * (-1038.973) [-1039.590] (-1037.836) (-1039.896) -- 0:00:37
728000 -- (-1042.339) (-1047.810) [-1038.509] (-1039.162) * [-1042.488] (-1036.619) (-1043.889) (-1040.345) -- 0:00:37
728500 -- (-1037.342) [-1040.052] (-1043.284) (-1037.707) * (-1048.234) (-1037.465) (-1039.631) [-1039.258] -- 0:00:37
729000 -- (-1042.343) [-1040.616] (-1033.700) (-1037.288) * (-1041.872) (-1034.557) [-1037.290] (-1046.041) -- 0:00:37
729500 -- [-1035.879] (-1040.214) (-1038.247) (-1043.264) * (-1042.490) [-1036.563] (-1042.839) (-1039.128) -- 0:00:37
730000 -- (-1036.818) (-1035.197) (-1038.112) [-1034.692] * (-1038.405) (-1035.926) (-1045.601) [-1042.034] -- 0:00:36
Average standard deviation of split frequencies: 0.001936
730500 -- (-1038.098) (-1038.637) [-1041.533] (-1041.584) * (-1040.194) (-1042.307) [-1041.203] (-1041.293) -- 0:00:36
731000 -- (-1039.165) (-1040.330) (-1039.512) [-1035.025] * [-1037.150] (-1035.167) (-1040.353) (-1043.567) -- 0:00:36
731500 -- [-1038.606] (-1035.590) (-1043.185) (-1038.950) * [-1037.314] (-1042.352) (-1044.199) (-1042.791) -- 0:00:37
732000 -- (-1037.564) (-1038.665) (-1044.728) [-1036.767] * (-1048.359) (-1035.893) (-1043.991) [-1038.854] -- 0:00:36
732500 -- (-1037.987) [-1037.702] (-1038.339) (-1038.837) * (-1044.752) (-1035.912) [-1037.957] (-1038.961) -- 0:00:36
733000 -- (-1045.438) (-1039.491) [-1039.238] (-1035.753) * (-1038.521) (-1037.609) (-1038.614) [-1037.489] -- 0:00:36
733500 -- (-1040.403) (-1040.043) [-1033.663] (-1035.363) * [-1035.433] (-1040.846) (-1037.478) (-1045.006) -- 0:00:36
734000 -- (-1038.541) (-1035.390) (-1034.721) [-1046.892] * (-1039.499) (-1038.124) [-1036.657] (-1047.381) -- 0:00:36
734500 -- (-1043.810) (-1040.804) (-1039.173) [-1036.306] * [-1043.952] (-1042.316) (-1039.063) (-1043.875) -- 0:00:36
735000 -- (-1042.617) (-1036.457) (-1038.401) [-1038.985] * (-1041.668) (-1039.981) [-1037.365] (-1042.571) -- 0:00:36
Average standard deviation of split frequencies: 0.001921
735500 -- (-1042.731) (-1037.756) (-1034.136) [-1036.098] * [-1040.824] (-1043.920) (-1039.827) (-1035.613) -- 0:00:36
736000 -- [-1039.054] (-1047.484) (-1042.748) (-1037.450) * (-1042.116) (-1042.099) [-1043.192] (-1042.610) -- 0:00:36
736500 -- [-1040.172] (-1043.574) (-1039.635) (-1049.741) * (-1041.627) (-1038.501) [-1041.213] (-1037.921) -- 0:00:36
737000 -- [-1035.885] (-1045.839) (-1036.884) (-1041.528) * (-1043.109) (-1043.287) (-1043.077) [-1034.859] -- 0:00:36
737500 -- [-1035.407] (-1033.080) (-1039.695) (-1042.140) * (-1037.620) [-1040.186] (-1040.040) (-1038.430) -- 0:00:35
738000 -- (-1039.724) (-1045.279) [-1035.364] (-1043.085) * (-1040.862) (-1039.944) [-1038.141] (-1043.783) -- 0:00:35
738500 -- (-1038.641) (-1033.038) [-1039.487] (-1046.086) * (-1036.421) (-1037.673) (-1038.533) [-1037.473] -- 0:00:36
739000 -- (-1042.804) (-1039.142) (-1039.329) [-1037.468] * (-1044.386) [-1034.006] (-1040.806) (-1036.938) -- 0:00:36
739500 -- (-1042.826) [-1038.012] (-1039.796) (-1034.221) * [-1046.614] (-1039.299) (-1036.466) (-1039.790) -- 0:00:35
740000 -- (-1049.963) [-1039.433] (-1041.408) (-1035.058) * (-1051.122) (-1041.082) (-1037.248) [-1038.384] -- 0:00:35
Average standard deviation of split frequencies: 0.002546
740500 -- (-1046.743) (-1036.137) (-1040.113) [-1038.108] * (-1043.033) (-1038.009) (-1037.685) [-1038.971] -- 0:00:35
741000 -- (-1043.014) [-1034.711] (-1036.379) (-1039.777) * (-1039.069) (-1037.210) [-1038.498] (-1034.338) -- 0:00:35
741500 -- (-1038.834) (-1035.122) [-1036.243] (-1037.369) * (-1036.007) (-1034.299) (-1037.901) [-1037.436] -- 0:00:35
742000 -- (-1036.407) [-1037.053] (-1039.055) (-1039.509) * (-1043.824) [-1042.376] (-1043.735) (-1038.594) -- 0:00:35
742500 -- (-1037.571) (-1039.182) [-1039.502] (-1043.976) * (-1046.513) (-1039.559) (-1040.519) [-1038.003] -- 0:00:35
743000 -- (-1036.942) (-1045.130) [-1038.036] (-1038.678) * (-1043.736) (-1044.278) (-1043.646) [-1035.487] -- 0:00:35
743500 -- (-1042.899) (-1039.843) (-1035.432) [-1042.489] * (-1044.084) (-1045.572) [-1042.509] (-1046.525) -- 0:00:35
744000 -- (-1035.354) (-1045.317) (-1034.253) [-1038.536] * [-1039.222] (-1040.052) (-1052.098) (-1039.332) -- 0:00:35
744500 -- (-1044.605) [-1035.814] (-1039.059) (-1040.792) * [-1040.903] (-1035.134) (-1041.072) (-1040.479) -- 0:00:35
745000 -- (-1038.247) (-1035.629) (-1039.935) [-1039.625] * (-1045.013) (-1040.007) [-1037.604] (-1043.704) -- 0:00:35
Average standard deviation of split frequencies: 0.003160
745500 -- (-1038.574) (-1046.241) (-1046.844) [-1034.625] * (-1042.301) (-1041.545) (-1043.026) [-1040.689] -- 0:00:35
746000 -- (-1047.591) (-1040.168) (-1039.171) [-1039.517] * (-1039.810) [-1037.556] (-1036.898) (-1042.836) -- 0:00:35
746500 -- (-1046.088) (-1042.565) [-1039.902] (-1039.286) * (-1037.668) (-1036.081) (-1042.379) [-1040.870] -- 0:00:34
747000 -- [-1041.854] (-1037.725) (-1037.741) (-1043.017) * (-1037.140) [-1038.214] (-1038.663) (-1049.874) -- 0:00:34
747500 -- (-1043.917) [-1038.373] (-1047.576) (-1035.417) * [-1035.321] (-1039.517) (-1041.072) (-1049.409) -- 0:00:34
748000 -- (-1042.964) (-1039.631) [-1035.444] (-1037.165) * [-1038.263] (-1041.737) (-1039.892) (-1042.400) -- 0:00:34
748500 -- [-1041.606] (-1038.294) (-1039.336) (-1033.899) * (-1037.238) (-1038.806) [-1043.011] (-1042.685) -- 0:00:34
749000 -- (-1044.959) (-1038.551) (-1035.900) [-1042.139] * [-1036.804] (-1040.321) (-1039.716) (-1040.910) -- 0:00:34
749500 -- (-1039.736) (-1039.097) [-1038.120] (-1044.494) * (-1046.608) [-1040.584] (-1038.155) (-1039.429) -- 0:00:34
750000 -- [-1035.987] (-1041.946) (-1045.956) (-1038.970) * (-1047.617) [-1036.616] (-1038.273) (-1040.681) -- 0:00:34
Average standard deviation of split frequencies: 0.003768
750500 -- (-1038.387) (-1049.721) [-1038.445] (-1037.507) * (-1040.470) [-1035.481] (-1038.381) (-1043.951) -- 0:00:34
751000 -- (-1040.131) (-1042.891) [-1041.569] (-1038.246) * (-1041.504) [-1040.698] (-1034.913) (-1036.400) -- 0:00:34
751500 -- (-1041.803) (-1039.872) [-1043.842] (-1045.301) * (-1037.689) (-1050.607) (-1038.086) [-1035.970] -- 0:00:34
752000 -- (-1040.320) (-1040.478) (-1042.760) [-1037.818] * (-1039.223) (-1037.948) [-1032.759] (-1039.385) -- 0:00:34
752500 -- (-1042.082) (-1039.047) [-1038.810] (-1038.114) * (-1044.031) (-1040.387) (-1043.777) [-1037.691] -- 0:00:34
753000 -- (-1034.683) [-1037.829] (-1044.047) (-1042.403) * (-1038.275) (-1040.344) [-1044.817] (-1035.973) -- 0:00:34
753500 -- (-1038.570) [-1035.510] (-1040.104) (-1035.710) * (-1045.863) [-1036.402] (-1039.604) (-1039.181) -- 0:00:34
754000 -- (-1043.347) (-1037.487) (-1037.127) [-1038.407] * (-1036.297) [-1038.965] (-1043.663) (-1040.014) -- 0:00:33
754500 -- (-1044.163) (-1036.037) (-1040.472) [-1042.074] * (-1050.568) [-1038.095] (-1040.590) (-1041.447) -- 0:00:33
755000 -- (-1047.609) (-1040.115) [-1037.120] (-1047.469) * (-1034.261) (-1039.081) (-1037.190) [-1037.674] -- 0:00:33
Average standard deviation of split frequencies: 0.004988
755500 -- [-1043.504] (-1041.512) (-1039.520) (-1038.163) * (-1039.042) (-1035.818) (-1041.591) [-1039.685] -- 0:00:33
756000 -- (-1039.983) (-1038.181) (-1045.589) [-1040.356] * (-1037.586) (-1039.945) (-1043.408) [-1034.749] -- 0:00:33
756500 -- (-1035.177) (-1044.954) (-1037.711) [-1046.860] * (-1033.480) (-1037.712) (-1048.790) [-1037.186] -- 0:00:33
757000 -- (-1035.088) [-1042.444] (-1039.694) (-1043.873) * (-1036.664) (-1050.080) (-1042.191) [-1039.676] -- 0:00:33
757500 -- (-1046.355) (-1036.735) (-1039.277) [-1042.756] * (-1040.004) (-1040.877) [-1045.683] (-1035.521) -- 0:00:33
758000 -- [-1041.921] (-1039.435) (-1040.179) (-1039.207) * (-1037.412) [-1034.748] (-1048.052) (-1044.546) -- 0:00:33
758500 -- [-1040.888] (-1038.862) (-1040.173) (-1042.721) * (-1039.012) (-1041.369) (-1043.601) [-1041.105] -- 0:00:33
759000 -- (-1036.378) [-1040.392] (-1040.337) (-1041.148) * (-1040.293) [-1033.561] (-1037.662) (-1038.881) -- 0:00:33
759500 -- (-1041.622) (-1043.890) (-1034.835) [-1038.192] * (-1042.080) (-1039.012) [-1037.029] (-1041.651) -- 0:00:33
760000 -- (-1036.411) (-1044.785) [-1038.256] (-1038.461) * (-1048.252) (-1042.033) (-1036.895) [-1037.972] -- 0:00:33
Average standard deviation of split frequencies: 0.003099
760500 -- (-1040.962) [-1044.064] (-1036.910) (-1039.648) * (-1040.546) (-1045.716) (-1037.251) [-1034.867] -- 0:00:33
761000 -- (-1038.270) (-1041.341) (-1037.859) [-1041.690] * (-1040.273) (-1038.418) [-1039.439] (-1040.034) -- 0:00:32
761500 -- [-1036.029] (-1043.804) (-1038.266) (-1042.563) * [-1037.282] (-1038.414) (-1039.356) (-1040.782) -- 0:00:32
762000 -- [-1037.480] (-1053.014) (-1041.316) (-1040.160) * [-1039.047] (-1046.340) (-1044.642) (-1037.861) -- 0:00:32
762500 -- [-1039.013] (-1038.960) (-1037.270) (-1039.616) * (-1036.855) (-1052.346) [-1042.631] (-1045.704) -- 0:00:32
763000 -- (-1041.689) [-1044.808] (-1039.947) (-1037.538) * [-1036.006] (-1038.569) (-1041.153) (-1038.384) -- 0:00:32
763500 -- [-1036.099] (-1048.092) (-1042.319) (-1037.958) * (-1040.250) (-1043.111) (-1041.758) [-1042.119] -- 0:00:32
764000 -- [-1036.816] (-1050.134) (-1040.079) (-1043.654) * (-1044.706) [-1044.994] (-1038.972) (-1040.606) -- 0:00:32
764500 -- (-1042.964) (-1040.932) (-1042.608) [-1042.128] * (-1040.494) (-1041.850) (-1036.678) [-1038.345] -- 0:00:32
765000 -- [-1038.790] (-1043.251) (-1043.058) (-1038.295) * (-1040.613) (-1034.670) (-1045.201) [-1039.352] -- 0:00:32
Average standard deviation of split frequencies: 0.001846
765500 -- (-1042.130) [-1039.974] (-1037.980) (-1040.821) * (-1035.754) (-1043.378) (-1044.232) [-1039.269] -- 0:00:32
766000 -- (-1037.144) (-1036.877) (-1037.841) [-1037.909] * (-1043.441) (-1035.144) (-1038.726) [-1036.728] -- 0:00:32
766500 -- (-1037.175) [-1045.343] (-1042.954) (-1040.448) * [-1035.600] (-1036.611) (-1037.239) (-1036.273) -- 0:00:32
767000 -- [-1040.911] (-1046.542) (-1045.583) (-1035.577) * (-1041.887) [-1042.332] (-1039.446) (-1036.281) -- 0:00:32
767500 -- (-1039.137) (-1042.230) (-1043.993) [-1036.106] * (-1039.312) (-1043.712) [-1039.159] (-1035.633) -- 0:00:32
768000 -- (-1040.864) [-1036.898] (-1040.706) (-1037.447) * [-1034.893] (-1038.637) (-1044.426) (-1047.079) -- 0:00:32
768500 -- (-1037.049) (-1039.385) (-1035.264) [-1034.847] * (-1038.652) [-1035.541] (-1040.089) (-1036.373) -- 0:00:31
769000 -- (-1041.828) (-1037.149) [-1035.315] (-1036.206) * [-1038.196] (-1034.593) (-1036.110) (-1039.987) -- 0:00:31
769500 -- (-1042.257) [-1035.481] (-1038.530) (-1039.507) * (-1037.626) [-1038.461] (-1039.294) (-1041.920) -- 0:00:31
770000 -- (-1040.606) [-1036.682] (-1037.707) (-1048.175) * [-1038.367] (-1042.981) (-1040.381) (-1039.294) -- 0:00:31
Average standard deviation of split frequencies: 0.001223
770500 -- [-1044.573] (-1037.022) (-1039.772) (-1043.802) * (-1046.483) (-1043.094) (-1040.447) [-1037.880] -- 0:00:31
771000 -- (-1040.430) (-1041.742) [-1043.944] (-1042.164) * (-1041.935) (-1038.770) (-1041.701) [-1036.727] -- 0:00:31
771500 -- [-1034.976] (-1037.995) (-1043.487) (-1043.693) * (-1038.852) (-1044.265) [-1036.096] (-1036.204) -- 0:00:31
772000 -- (-1039.087) [-1036.807] (-1036.089) (-1036.835) * (-1038.167) (-1035.858) (-1035.401) [-1034.454] -- 0:00:31
772500 -- (-1037.644) [-1036.792] (-1035.959) (-1036.521) * (-1036.416) [-1036.648] (-1042.174) (-1036.660) -- 0:00:31
773000 -- (-1037.278) [-1041.047] (-1040.673) (-1041.436) * (-1039.582) (-1040.432) (-1041.801) [-1040.288] -- 0:00:31
773500 -- (-1043.113) (-1037.902) (-1039.607) [-1036.674] * (-1037.369) (-1044.840) (-1039.849) [-1040.241] -- 0:00:31
774000 -- (-1039.614) (-1043.275) [-1037.491] (-1039.708) * (-1036.641) (-1035.087) (-1037.850) [-1036.429] -- 0:00:31
774500 -- [-1037.403] (-1035.833) (-1039.276) (-1047.168) * (-1038.405) [-1038.737] (-1037.257) (-1037.090) -- 0:00:31
775000 -- (-1045.170) [-1041.512] (-1040.939) (-1039.139) * (-1038.008) (-1044.402) (-1042.069) [-1038.036] -- 0:00:31
Average standard deviation of split frequencies: 0.001215
775500 -- [-1039.450] (-1041.587) (-1046.152) (-1037.820) * (-1038.981) (-1037.327) (-1043.343) [-1045.185] -- 0:00:30
776000 -- (-1035.655) [-1036.918] (-1045.470) (-1038.952) * (-1038.527) (-1034.243) [-1038.951] (-1036.875) -- 0:00:30
776500 -- (-1044.605) (-1041.325) (-1039.059) [-1038.140] * (-1037.763) (-1039.774) [-1036.019] (-1037.269) -- 0:00:30
777000 -- (-1035.724) (-1039.651) [-1035.906] (-1040.969) * (-1043.482) [-1040.605] (-1038.993) (-1043.418) -- 0:00:30
777500 -- (-1037.057) (-1040.594) [-1040.652] (-1038.813) * [-1035.518] (-1038.832) (-1046.204) (-1043.621) -- 0:00:30
778000 -- (-1046.431) (-1040.156) [-1033.540] (-1038.962) * [-1037.834] (-1040.867) (-1037.616) (-1041.323) -- 0:00:30
778500 -- (-1044.299) (-1033.185) (-1039.508) [-1038.877] * (-1036.211) (-1038.189) [-1036.907] (-1042.081) -- 0:00:30
779000 -- (-1039.613) [-1038.048] (-1039.026) (-1040.347) * (-1043.373) [-1036.563] (-1041.139) (-1036.843) -- 0:00:30
779500 -- [-1046.241] (-1036.590) (-1039.874) (-1040.840) * (-1041.549) [-1035.822] (-1041.698) (-1042.294) -- 0:00:30
780000 -- (-1036.269) [-1037.588] (-1038.787) (-1043.088) * (-1044.835) [-1043.925] (-1048.489) (-1047.026) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
780500 -- [-1036.635] (-1038.718) (-1044.467) (-1038.586) * (-1046.333) [-1041.141] (-1040.893) (-1045.874) -- 0:00:30
781000 -- (-1035.893) (-1036.919) [-1036.633] (-1039.955) * (-1046.064) (-1041.897) (-1034.547) [-1039.584] -- 0:00:30
781500 -- [-1037.718] (-1033.917) (-1043.634) (-1036.793) * [-1039.233] (-1041.076) (-1044.406) (-1037.357) -- 0:00:30
782000 -- (-1035.567) (-1034.419) (-1047.113) [-1035.018] * (-1040.856) (-1038.682) [-1041.959] (-1036.403) -- 0:00:30
782500 -- [-1037.117] (-1037.038) (-1039.989) (-1039.540) * [-1037.896] (-1038.339) (-1039.944) (-1038.859) -- 0:00:30
783000 -- (-1038.476) (-1039.318) (-1040.055) [-1039.353] * [-1039.987] (-1035.916) (-1041.869) (-1038.123) -- 0:00:29
783500 -- (-1038.929) (-1037.195) (-1038.342) [-1048.124] * (-1039.906) (-1042.093) (-1035.944) [-1039.031] -- 0:00:29
784000 -- [-1036.991] (-1033.299) (-1044.437) (-1040.147) * (-1043.906) (-1039.916) [-1039.283] (-1045.287) -- 0:00:29
784500 -- (-1044.826) (-1036.298) (-1038.152) [-1034.898] * (-1040.230) (-1044.109) [-1039.985] (-1037.878) -- 0:00:29
785000 -- (-1041.187) [-1035.886] (-1037.183) (-1038.492) * (-1036.979) (-1042.322) (-1039.075) [-1040.658] -- 0:00:29
Average standard deviation of split frequencies: 0.001200
785500 -- (-1040.505) (-1040.177) [-1039.838] (-1035.237) * (-1039.720) [-1042.877] (-1038.440) (-1040.015) -- 0:00:29
786000 -- (-1038.075) (-1038.753) (-1041.168) [-1034.872] * (-1038.535) (-1044.184) [-1032.628] (-1040.624) -- 0:00:29
786500 -- (-1041.231) (-1040.174) (-1039.893) [-1039.960] * (-1041.508) [-1041.309] (-1036.256) (-1039.028) -- 0:00:29
787000 -- (-1041.612) (-1037.955) [-1037.214] (-1036.760) * (-1039.509) (-1040.470) [-1035.778] (-1050.009) -- 0:00:29
787500 -- (-1039.424) (-1038.960) [-1039.671] (-1041.214) * (-1041.895) (-1041.035) (-1034.279) [-1040.316] -- 0:00:29
788000 -- (-1043.984) (-1036.010) (-1033.345) [-1036.273] * (-1039.591) (-1038.004) (-1040.797) [-1037.642] -- 0:00:29
788500 -- (-1035.205) [-1036.586] (-1042.367) (-1038.382) * [-1039.485] (-1039.898) (-1039.145) (-1036.712) -- 0:00:29
789000 -- (-1045.773) [-1035.971] (-1041.651) (-1040.329) * [-1038.845] (-1038.559) (-1034.307) (-1044.498) -- 0:00:29
789500 -- (-1040.852) (-1038.291) (-1041.304) [-1042.776] * [-1036.025] (-1035.493) (-1041.796) (-1039.340) -- 0:00:29
790000 -- [-1035.656] (-1042.339) (-1036.375) (-1036.515) * [-1038.158] (-1040.180) (-1037.623) (-1048.068) -- 0:00:28
Average standard deviation of split frequencies: 0.000596
790500 -- (-1039.090) (-1036.865) [-1036.014] (-1037.803) * [-1035.623] (-1040.496) (-1041.425) (-1035.648) -- 0:00:28
791000 -- (-1036.483) (-1037.088) [-1043.845] (-1041.889) * (-1038.779) [-1036.808] (-1042.058) (-1040.953) -- 0:00:28
791500 -- (-1040.397) [-1034.924] (-1038.592) (-1040.112) * (-1042.933) [-1041.893] (-1039.717) (-1043.026) -- 0:00:28
792000 -- (-1047.229) (-1045.892) (-1037.816) [-1038.456] * (-1038.073) [-1042.807] (-1047.195) (-1045.018) -- 0:00:28
792500 -- [-1036.958] (-1045.388) (-1040.883) (-1037.002) * (-1043.297) (-1039.135) (-1050.440) [-1039.284] -- 0:00:28
793000 -- (-1042.500) (-1046.170) [-1035.930] (-1035.648) * (-1039.641) (-1038.221) (-1041.035) [-1038.918] -- 0:00:28
793500 -- (-1040.491) (-1038.378) (-1037.857) [-1036.018] * (-1044.602) (-1041.073) (-1040.581) [-1039.709] -- 0:00:28
794000 -- [-1043.946] (-1040.327) (-1043.132) (-1035.932) * [-1043.126] (-1040.011) (-1040.328) (-1034.316) -- 0:00:28
794500 -- (-1039.566) [-1037.425] (-1040.223) (-1042.476) * (-1041.408) [-1039.093] (-1041.974) (-1036.476) -- 0:00:28
795000 -- (-1041.831) (-1037.716) [-1040.242] (-1037.567) * [-1036.650] (-1044.669) (-1040.666) (-1039.411) -- 0:00:28
Average standard deviation of split frequencies: 0.001184
795500 -- [-1038.902] (-1039.137) (-1040.804) (-1044.691) * (-1037.649) (-1038.292) [-1042.876] (-1035.498) -- 0:00:28
796000 -- (-1034.587) (-1043.982) [-1046.716] (-1040.365) * (-1039.298) (-1034.906) [-1036.773] (-1042.820) -- 0:00:28
796500 -- (-1038.737) (-1041.341) [-1039.565] (-1039.293) * [-1038.156] (-1039.393) (-1041.517) (-1043.600) -- 0:00:28
797000 -- (-1035.842) (-1040.301) [-1042.592] (-1042.143) * (-1040.855) (-1038.116) (-1035.281) [-1038.057] -- 0:00:28
797500 -- (-1036.761) (-1040.598) [-1038.706] (-1038.166) * (-1039.880) (-1036.012) (-1036.868) [-1040.777] -- 0:00:27
798000 -- (-1042.350) (-1047.056) [-1039.624] (-1036.452) * (-1040.072) (-1045.269) [-1034.556] (-1040.672) -- 0:00:27
798500 -- (-1034.955) (-1044.569) (-1039.530) [-1038.336] * (-1040.013) (-1044.299) [-1040.260] (-1035.321) -- 0:00:27
799000 -- (-1037.462) (-1042.140) [-1039.260] (-1034.487) * (-1042.194) (-1043.711) (-1047.811) [-1038.232] -- 0:00:27
799500 -- [-1035.980] (-1045.436) (-1041.121) (-1038.774) * [-1039.219] (-1040.292) (-1040.759) (-1043.186) -- 0:00:27
800000 -- (-1036.056) (-1044.257) [-1040.067] (-1039.536) * (-1035.147) (-1041.170) (-1043.797) [-1039.162] -- 0:00:27
Average standard deviation of split frequencies: 0.001766
800500 -- (-1034.386) (-1043.044) (-1042.808) [-1036.052] * (-1038.314) (-1046.941) (-1036.012) [-1042.636] -- 0:00:27
801000 -- (-1038.716) (-1044.415) [-1035.719] (-1043.019) * [-1042.160] (-1037.225) (-1036.907) (-1037.127) -- 0:00:27
801500 -- (-1044.630) (-1043.376) (-1038.299) [-1037.019] * (-1038.754) (-1043.571) [-1039.457] (-1037.247) -- 0:00:27
802000 -- (-1034.445) [-1041.859] (-1041.501) (-1036.397) * [-1035.309] (-1040.338) (-1044.970) (-1043.357) -- 0:00:27
802500 -- [-1032.630] (-1042.116) (-1042.941) (-1037.315) * (-1041.458) [-1040.383] (-1038.102) (-1038.051) -- 0:00:27
803000 -- (-1035.418) [-1037.429] (-1042.534) (-1041.498) * (-1042.948) (-1036.876) (-1034.744) [-1035.868] -- 0:00:27
803500 -- [-1038.723] (-1038.189) (-1034.674) (-1037.796) * (-1038.705) (-1040.905) [-1036.415] (-1038.173) -- 0:00:27
804000 -- [-1035.643] (-1038.033) (-1036.491) (-1035.361) * (-1041.722) [-1038.653] (-1045.610) (-1037.761) -- 0:00:27
804500 -- (-1036.322) (-1041.509) [-1040.758] (-1037.439) * (-1047.616) [-1038.417] (-1038.227) (-1046.791) -- 0:00:26
805000 -- [-1040.868] (-1043.011) (-1047.094) (-1036.020) * (-1036.194) [-1039.827] (-1038.814) (-1046.727) -- 0:00:26
Average standard deviation of split frequencies: 0.001755
805500 -- (-1042.485) [-1040.630] (-1047.122) (-1038.556) * (-1045.154) [-1038.889] (-1043.079) (-1047.970) -- 0:00:26
806000 -- (-1036.537) (-1045.042) [-1038.348] (-1038.023) * (-1039.208) [-1039.944] (-1038.806) (-1047.928) -- 0:00:26
806500 -- (-1041.021) (-1040.472) (-1038.937) [-1038.319] * (-1035.471) [-1037.055] (-1043.287) (-1038.064) -- 0:00:26
807000 -- [-1039.217] (-1039.805) (-1041.565) (-1040.388) * (-1042.324) (-1040.142) [-1036.542] (-1037.693) -- 0:00:26
807500 -- (-1040.766) (-1045.285) [-1044.883] (-1037.072) * (-1039.114) [-1039.265] (-1037.872) (-1038.748) -- 0:00:26
808000 -- [-1036.577] (-1036.809) (-1042.305) (-1041.085) * [-1035.309] (-1041.816) (-1036.154) (-1038.887) -- 0:00:26
808500 -- [-1035.876] (-1039.965) (-1043.648) (-1042.221) * (-1039.970) [-1037.631] (-1036.956) (-1040.882) -- 0:00:26
809000 -- (-1041.415) [-1036.371] (-1047.632) (-1042.101) * (-1046.139) (-1040.183) [-1036.742] (-1045.228) -- 0:00:26
809500 -- (-1040.119) (-1035.126) (-1041.855) [-1037.239] * (-1039.984) (-1042.861) (-1040.889) [-1036.142] -- 0:00:26
810000 -- [-1045.459] (-1034.358) (-1038.293) (-1039.292) * (-1039.276) [-1035.384] (-1040.725) (-1040.606) -- 0:00:26
Average standard deviation of split frequencies: 0.001745
810500 -- (-1045.451) [-1038.682] (-1042.210) (-1036.540) * [-1032.743] (-1041.349) (-1038.910) (-1039.616) -- 0:00:26
811000 -- (-1037.033) [-1035.628] (-1041.358) (-1045.040) * (-1037.378) [-1041.473] (-1041.647) (-1036.921) -- 0:00:26
811500 -- (-1036.348) (-1034.826) [-1038.067] (-1042.364) * (-1035.585) (-1042.709) [-1034.739] (-1035.969) -- 0:00:26
812000 -- (-1034.566) (-1041.197) [-1041.301] (-1045.383) * (-1036.584) (-1041.054) [-1038.061] (-1038.553) -- 0:00:25
812500 -- (-1036.332) [-1038.231] (-1041.416) (-1038.260) * (-1040.198) [-1036.523] (-1042.572) (-1037.345) -- 0:00:25
813000 -- [-1037.114] (-1042.428) (-1036.403) (-1041.734) * [-1036.798] (-1048.134) (-1040.715) (-1036.799) -- 0:00:25
813500 -- (-1044.312) (-1039.512) (-1035.217) [-1038.750] * (-1045.361) (-1041.089) [-1033.192] (-1039.029) -- 0:00:25
814000 -- (-1040.615) [-1043.744] (-1035.547) (-1039.062) * [-1043.288] (-1046.439) (-1044.249) (-1038.404) -- 0:00:25
814500 -- (-1040.510) (-1038.352) [-1041.807] (-1039.220) * (-1036.852) [-1044.986] (-1035.858) (-1042.225) -- 0:00:25
815000 -- (-1038.627) (-1042.987) (-1038.168) [-1032.783] * (-1048.944) (-1049.694) [-1039.037] (-1038.200) -- 0:00:25
Average standard deviation of split frequencies: 0.001733
815500 -- [-1039.143] (-1034.136) (-1039.893) (-1036.684) * (-1041.944) (-1037.755) (-1040.303) [-1034.272] -- 0:00:25
816000 -- (-1038.219) (-1037.758) (-1047.350) [-1036.846] * (-1039.565) (-1040.405) [-1035.446] (-1039.281) -- 0:00:25
816500 -- (-1035.568) (-1036.742) (-1039.951) [-1036.667] * (-1040.915) (-1038.238) (-1035.841) [-1037.223] -- 0:00:25
817000 -- (-1038.339) (-1040.184) [-1037.622] (-1039.783) * [-1040.604] (-1038.775) (-1040.820) (-1038.441) -- 0:00:25
817500 -- (-1039.968) (-1041.434) (-1036.311) [-1037.108] * (-1038.789) [-1037.780] (-1038.615) (-1043.267) -- 0:00:25
818000 -- (-1037.697) [-1040.213] (-1039.650) (-1033.878) * (-1034.769) [-1037.453] (-1034.938) (-1038.949) -- 0:00:25
818500 -- (-1039.649) [-1040.253] (-1039.159) (-1040.051) * (-1039.689) [-1037.003] (-1036.675) (-1035.665) -- 0:00:25
819000 -- [-1038.590] (-1041.146) (-1039.540) (-1036.189) * (-1040.022) (-1036.837) (-1040.009) [-1037.100] -- 0:00:24
819500 -- (-1036.093) (-1042.234) (-1037.450) [-1041.221] * (-1037.888) [-1036.894] (-1042.550) (-1033.780) -- 0:00:24
820000 -- (-1041.204) [-1034.317] (-1038.923) (-1038.686) * (-1043.740) (-1045.007) (-1049.264) [-1039.460] -- 0:00:24
Average standard deviation of split frequencies: 0.001723
820500 -- (-1040.852) [-1039.357] (-1040.269) (-1039.570) * (-1036.486) (-1035.191) [-1041.022] (-1051.823) -- 0:00:24
821000 -- [-1040.474] (-1039.588) (-1040.542) (-1041.260) * (-1037.537) (-1046.293) [-1038.059] (-1044.587) -- 0:00:24
821500 -- (-1040.032) [-1043.090] (-1041.774) (-1042.758) * (-1047.746) (-1033.944) [-1038.135] (-1037.877) -- 0:00:24
822000 -- (-1039.402) (-1037.355) [-1039.589] (-1037.554) * (-1039.194) (-1038.528) (-1037.022) [-1033.083] -- 0:00:24
822500 -- (-1042.440) (-1042.967) [-1035.827] (-1035.779) * (-1038.692) (-1038.961) (-1043.514) [-1037.733] -- 0:00:24
823000 -- (-1044.790) (-1038.393) (-1036.062) [-1037.294] * (-1040.371) [-1039.200] (-1036.208) (-1043.933) -- 0:00:24
823500 -- [-1037.341] (-1035.199) (-1039.395) (-1037.601) * [-1036.479] (-1038.838) (-1035.041) (-1034.413) -- 0:00:24
824000 -- [-1040.753] (-1039.644) (-1038.437) (-1041.340) * (-1040.626) (-1041.742) (-1039.239) [-1039.186] -- 0:00:24
824500 -- [-1038.572] (-1037.606) (-1038.119) (-1038.479) * (-1039.287) [-1036.313] (-1036.187) (-1045.083) -- 0:00:24
825000 -- (-1041.249) (-1034.426) [-1034.573] (-1042.509) * (-1038.188) (-1038.734) (-1040.858) [-1034.554] -- 0:00:24
Average standard deviation of split frequencies: 0.000571
825500 -- (-1039.890) (-1037.503) (-1039.000) [-1037.515] * (-1037.356) (-1041.408) (-1033.672) [-1038.393] -- 0:00:24
826000 -- (-1040.817) [-1038.667] (-1039.917) (-1040.697) * [-1035.840] (-1041.661) (-1043.650) (-1038.310) -- 0:00:24
826500 -- (-1041.560) (-1035.533) [-1040.307] (-1038.437) * (-1039.242) [-1043.446] (-1040.114) (-1037.844) -- 0:00:23
827000 -- (-1044.078) [-1037.717] (-1035.300) (-1041.507) * [-1036.588] (-1036.679) (-1042.291) (-1037.899) -- 0:00:23
827500 -- (-1041.169) (-1039.214) [-1033.800] (-1039.395) * [-1035.052] (-1040.610) (-1044.116) (-1036.125) -- 0:00:23
828000 -- [-1037.159] (-1039.532) (-1035.038) (-1039.919) * (-1040.924) (-1039.069) (-1044.995) [-1038.215] -- 0:00:23
828500 -- (-1038.144) (-1039.409) [-1036.492] (-1038.739) * (-1037.322) [-1040.336] (-1045.306) (-1036.879) -- 0:00:23
829000 -- [-1043.010] (-1036.964) (-1041.561) (-1044.073) * [-1039.688] (-1043.609) (-1046.796) (-1038.577) -- 0:00:23
829500 -- (-1038.795) (-1038.752) (-1036.862) [-1037.633] * (-1038.519) (-1043.673) [-1042.408] (-1048.955) -- 0:00:23
830000 -- (-1036.914) (-1042.012) [-1037.508] (-1047.733) * (-1039.318) [-1038.396] (-1048.963) (-1037.479) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
830500 -- (-1040.856) (-1037.500) (-1037.213) [-1040.625] * (-1039.568) (-1039.695) (-1043.570) [-1038.519] -- 0:00:23
831000 -- (-1040.270) (-1037.529) [-1036.854] (-1039.409) * (-1038.645) (-1041.510) [-1036.456] (-1035.070) -- 0:00:23
831500 -- (-1034.590) (-1036.036) [-1036.550] (-1042.106) * [-1033.285] (-1035.761) (-1042.876) (-1035.853) -- 0:00:23
832000 -- (-1037.782) (-1036.878) (-1045.423) [-1045.964] * (-1039.570) (-1039.500) (-1040.735) [-1039.333] -- 0:00:23
832500 -- (-1037.559) [-1036.409] (-1037.781) (-1039.806) * (-1038.867) (-1035.320) [-1038.172] (-1041.771) -- 0:00:23
833000 -- (-1039.220) (-1038.795) [-1039.470] (-1038.156) * (-1040.328) (-1035.346) [-1037.545] (-1044.167) -- 0:00:23
833500 -- [-1038.811] (-1042.292) (-1038.241) (-1036.225) * (-1035.305) (-1036.092) (-1035.273) [-1041.813] -- 0:00:22
834000 -- (-1042.654) [-1038.674] (-1038.260) (-1036.956) * (-1037.080) (-1037.586) (-1041.962) [-1033.700] -- 0:00:22
834500 -- (-1040.075) (-1042.319) (-1040.799) [-1043.334] * (-1039.595) [-1035.590] (-1041.181) (-1038.727) -- 0:00:22
835000 -- (-1040.983) (-1037.893) [-1039.601] (-1033.910) * (-1038.648) (-1040.404) (-1034.437) [-1038.601] -- 0:00:22
Average standard deviation of split frequencies: 0.001692
835500 -- (-1040.933) (-1036.265) [-1040.915] (-1035.736) * (-1039.198) [-1039.450] (-1035.988) (-1045.927) -- 0:00:22
836000 -- (-1041.446) [-1036.879] (-1046.524) (-1043.401) * (-1036.502) (-1042.560) (-1035.979) [-1038.182] -- 0:00:22
836500 -- (-1037.754) [-1037.054] (-1037.205) (-1036.724) * [-1035.340] (-1044.037) (-1036.242) (-1038.872) -- 0:00:22
837000 -- (-1035.522) (-1038.740) [-1035.946] (-1039.105) * (-1037.027) (-1036.017) (-1039.984) [-1037.828] -- 0:00:22
837500 -- [-1036.657] (-1039.757) (-1046.597) (-1038.131) * (-1036.010) [-1038.394] (-1037.702) (-1041.300) -- 0:00:22
838000 -- (-1045.039) (-1038.775) (-1038.921) [-1036.109] * [-1039.300] (-1045.939) (-1038.373) (-1040.415) -- 0:00:22
838500 -- (-1038.685) [-1042.110] (-1042.098) (-1037.665) * [-1034.098] (-1038.652) (-1039.034) (-1045.897) -- 0:00:22
839000 -- (-1037.580) (-1040.076) [-1043.999] (-1038.055) * (-1036.142) [-1039.879] (-1041.124) (-1041.672) -- 0:00:22
839500 -- (-1038.582) [-1037.901] (-1044.638) (-1034.778) * (-1037.872) [-1041.621] (-1044.796) (-1039.179) -- 0:00:22
840000 -- (-1037.005) (-1037.295) [-1045.857] (-1034.843) * (-1038.497) (-1037.661) (-1043.651) [-1039.270] -- 0:00:22
Average standard deviation of split frequencies: 0.002804
840500 -- (-1037.344) [-1037.675] (-1041.940) (-1041.889) * (-1039.386) (-1040.545) (-1035.332) [-1034.409] -- 0:00:22
841000 -- [-1038.307] (-1039.783) (-1043.249) (-1042.136) * (-1040.448) (-1036.218) (-1037.614) [-1034.326] -- 0:00:21
841500 -- (-1039.298) [-1042.274] (-1041.293) (-1044.978) * [-1037.693] (-1040.950) (-1042.012) (-1037.929) -- 0:00:21
842000 -- [-1042.446] (-1035.669) (-1040.789) (-1040.437) * (-1035.746) (-1041.445) [-1037.825] (-1041.970) -- 0:00:21
842500 -- (-1047.196) [-1037.550] (-1040.665) (-1040.211) * (-1039.190) [-1034.225] (-1039.414) (-1033.843) -- 0:00:21
843000 -- (-1044.036) [-1035.617] (-1045.718) (-1040.163) * (-1036.550) (-1035.106) (-1035.121) [-1036.276] -- 0:00:21
843500 -- (-1043.167) [-1034.635] (-1045.473) (-1042.237) * (-1034.601) (-1037.140) [-1037.144] (-1043.505) -- 0:00:21
844000 -- (-1044.180) [-1039.222] (-1042.281) (-1037.769) * [-1041.879] (-1035.627) (-1035.421) (-1040.203) -- 0:00:21
844500 -- (-1046.131) (-1039.835) (-1039.611) [-1041.646] * [-1042.601] (-1037.763) (-1036.403) (-1038.988) -- 0:00:21
845000 -- (-1038.735) (-1041.613) (-1040.477) [-1035.777] * (-1038.104) [-1040.478] (-1039.249) (-1041.426) -- 0:00:21
Average standard deviation of split frequencies: 0.002786
845500 -- (-1039.370) (-1050.050) (-1041.434) [-1036.329] * [-1041.421] (-1039.002) (-1042.951) (-1040.819) -- 0:00:21
846000 -- [-1037.721] (-1038.525) (-1041.351) (-1036.849) * (-1039.659) (-1039.216) (-1039.022) [-1038.220] -- 0:00:21
846500 -- (-1040.125) (-1047.619) [-1044.166] (-1035.894) * (-1040.229) (-1035.245) [-1039.424] (-1046.835) -- 0:00:21
847000 -- (-1045.522) (-1040.307) (-1037.608) [-1037.968] * (-1048.757) (-1039.690) (-1040.844) [-1037.916] -- 0:00:21
847500 -- (-1039.720) [-1037.474] (-1039.809) (-1036.568) * (-1046.243) (-1039.415) (-1040.647) [-1038.259] -- 0:00:21
848000 -- (-1039.722) (-1039.248) (-1035.724) [-1044.645] * [-1037.697] (-1039.040) (-1036.673) (-1038.454) -- 0:00:20
848500 -- [-1038.984] (-1038.711) (-1040.708) (-1048.553) * [-1039.619] (-1038.279) (-1039.895) (-1043.654) -- 0:00:20
849000 -- (-1035.730) (-1036.161) (-1039.141) [-1043.592] * (-1038.515) (-1039.248) (-1037.242) [-1042.930] -- 0:00:20
849500 -- (-1041.103) [-1036.150] (-1040.122) (-1048.409) * (-1038.984) (-1039.769) [-1037.255] (-1042.845) -- 0:00:20
850000 -- (-1038.373) [-1035.883] (-1041.163) (-1043.935) * (-1041.976) (-1035.158) (-1039.970) [-1036.721] -- 0:00:20
Average standard deviation of split frequencies: 0.003325
850500 -- [-1036.258] (-1049.383) (-1042.526) (-1043.219) * (-1044.783) (-1041.651) (-1040.298) [-1041.623] -- 0:00:20
851000 -- [-1036.383] (-1038.125) (-1037.361) (-1044.293) * (-1050.741) (-1046.135) (-1039.078) [-1037.620] -- 0:00:20
851500 -- (-1037.644) (-1045.093) [-1036.148] (-1035.058) * (-1039.286) [-1038.760] (-1041.222) (-1042.200) -- 0:00:20
852000 -- (-1042.417) (-1040.572) [-1035.719] (-1037.634) * (-1047.068) [-1035.233] (-1038.179) (-1040.831) -- 0:00:20
852500 -- (-1036.373) [-1033.920] (-1037.669) (-1047.559) * (-1045.694) (-1037.523) (-1037.372) [-1042.350] -- 0:00:20
853000 -- (-1039.628) (-1039.826) (-1033.373) [-1038.766] * [-1043.042] (-1034.842) (-1041.971) (-1044.344) -- 0:00:20
853500 -- [-1038.017] (-1039.069) (-1039.727) (-1036.075) * (-1037.241) (-1040.297) (-1040.087) [-1039.179] -- 0:00:20
854000 -- [-1041.493] (-1037.172) (-1040.132) (-1037.196) * (-1038.904) (-1041.446) (-1038.674) [-1034.949] -- 0:00:20
854500 -- [-1033.953] (-1038.346) (-1038.731) (-1039.970) * (-1038.386) [-1036.353] (-1043.107) (-1042.762) -- 0:00:20
855000 -- (-1033.603) (-1038.546) [-1038.042] (-1037.111) * [-1042.644] (-1034.466) (-1049.071) (-1044.056) -- 0:00:20
Average standard deviation of split frequencies: 0.002754
855500 -- (-1038.526) [-1041.820] (-1046.237) (-1037.959) * (-1043.641) (-1037.032) [-1042.396] (-1050.001) -- 0:00:19
856000 -- [-1042.032] (-1037.660) (-1040.028) (-1037.825) * (-1042.127) (-1036.253) [-1042.966] (-1045.421) -- 0:00:19
856500 -- [-1034.358] (-1041.596) (-1035.988) (-1034.757) * [-1038.784] (-1037.541) (-1038.715) (-1041.357) -- 0:00:19
857000 -- (-1038.291) [-1041.662] (-1041.995) (-1039.787) * (-1036.345) (-1037.330) (-1048.926) [-1042.597] -- 0:00:19
857500 -- (-1044.773) [-1035.675] (-1043.559) (-1035.210) * [-1034.566] (-1042.134) (-1043.899) (-1038.462) -- 0:00:19
858000 -- (-1042.713) (-1038.820) (-1035.892) [-1038.444] * (-1036.074) (-1042.785) (-1044.070) [-1035.085] -- 0:00:19
858500 -- [-1036.805] (-1034.189) (-1039.166) (-1039.267) * (-1039.710) (-1044.306) (-1042.303) [-1038.754] -- 0:00:19
859000 -- (-1037.449) (-1033.239) [-1036.961] (-1038.724) * [-1035.187] (-1038.122) (-1037.744) (-1036.723) -- 0:00:19
859500 -- (-1035.255) (-1035.475) [-1037.561] (-1038.775) * [-1036.551] (-1039.468) (-1038.947) (-1038.569) -- 0:00:19
860000 -- (-1036.776) (-1045.387) (-1038.214) [-1042.775] * (-1041.661) (-1040.063) (-1035.964) [-1037.498] -- 0:00:19
Average standard deviation of split frequencies: 0.002191
860500 -- (-1038.899) [-1038.291] (-1035.320) (-1041.753) * (-1039.980) [-1035.542] (-1034.030) (-1036.174) -- 0:00:19
861000 -- (-1036.938) [-1035.419] (-1041.173) (-1043.669) * (-1040.797) (-1037.612) (-1036.578) [-1036.206] -- 0:00:19
861500 -- (-1036.391) (-1038.326) (-1038.201) [-1038.752] * [-1037.793] (-1039.663) (-1039.040) (-1034.353) -- 0:00:19
862000 -- [-1033.432] (-1035.576) (-1041.375) (-1039.397) * (-1039.039) [-1035.646] (-1042.145) (-1035.760) -- 0:00:19
862500 -- (-1035.390) (-1047.811) (-1038.187) [-1038.650] * (-1039.560) (-1041.395) [-1040.892] (-1040.483) -- 0:00:18
863000 -- (-1039.100) [-1036.489] (-1035.217) (-1038.605) * (-1041.634) (-1040.286) (-1038.579) [-1037.867] -- 0:00:18
863500 -- [-1036.277] (-1040.205) (-1033.757) (-1037.197) * (-1044.211) [-1036.100] (-1042.226) (-1038.208) -- 0:00:18
864000 -- (-1035.840) (-1041.464) (-1033.565) [-1037.023] * (-1036.689) [-1041.737] (-1038.129) (-1045.236) -- 0:00:18
864500 -- (-1036.263) [-1037.918] (-1040.067) (-1034.040) * (-1036.753) (-1035.655) (-1034.513) [-1036.876] -- 0:00:18
865000 -- [-1033.929] (-1040.634) (-1038.309) (-1040.083) * (-1041.553) (-1038.947) (-1041.133) [-1036.435] -- 0:00:18
Average standard deviation of split frequencies: 0.002722
865500 -- [-1034.538] (-1038.066) (-1039.623) (-1039.960) * (-1039.197) (-1036.046) (-1040.839) [-1034.962] -- 0:00:18
866000 -- (-1039.170) (-1039.637) [-1039.363] (-1045.766) * (-1034.369) (-1036.876) [-1039.451] (-1039.181) -- 0:00:18
866500 -- (-1043.664) (-1034.567) [-1045.013] (-1038.651) * [-1035.952] (-1038.791) (-1041.767) (-1036.909) -- 0:00:18
867000 -- (-1049.150) [-1040.117] (-1043.385) (-1041.837) * [-1036.861] (-1039.795) (-1044.281) (-1041.165) -- 0:00:18
867500 -- [-1043.773] (-1041.674) (-1046.869) (-1037.799) * (-1043.701) [-1042.494] (-1039.241) (-1042.706) -- 0:00:18
868000 -- (-1040.175) [-1044.861] (-1046.426) (-1036.134) * (-1046.776) (-1042.474) (-1037.999) [-1035.978] -- 0:00:18
868500 -- (-1040.315) (-1051.285) [-1043.999] (-1036.522) * [-1037.618] (-1042.925) (-1040.702) (-1039.252) -- 0:00:18
869000 -- (-1038.203) (-1047.511) (-1033.523) [-1039.451] * (-1037.297) [-1042.292] (-1040.731) (-1040.677) -- 0:00:18
869500 -- (-1037.331) (-1042.988) [-1037.687] (-1046.364) * (-1038.217) [-1041.136] (-1037.033) (-1038.194) -- 0:00:18
870000 -- (-1039.533) (-1037.526) [-1040.416] (-1044.934) * (-1039.655) (-1043.255) [-1039.834] (-1040.098) -- 0:00:17
Average standard deviation of split frequencies: 0.002707
870500 -- (-1043.057) [-1037.848] (-1044.929) (-1041.245) * (-1032.848) (-1041.621) [-1038.518] (-1040.169) -- 0:00:17
871000 -- (-1039.569) [-1037.646] (-1041.474) (-1035.693) * (-1036.640) [-1038.285] (-1035.358) (-1039.862) -- 0:00:17
871500 -- (-1040.805) (-1037.596) [-1039.509] (-1037.428) * (-1037.556) (-1035.133) (-1039.570) [-1038.344] -- 0:00:17
872000 -- (-1039.469) [-1039.752] (-1041.931) (-1037.095) * (-1042.396) (-1042.532) [-1036.857] (-1039.380) -- 0:00:17
872500 -- (-1038.653) (-1042.528) (-1035.452) [-1039.503] * (-1039.162) (-1040.609) [-1042.639] (-1046.760) -- 0:00:17
873000 -- (-1036.592) (-1042.451) (-1034.909) [-1035.060] * (-1044.816) (-1041.639) [-1039.563] (-1041.440) -- 0:00:17
873500 -- [-1044.379] (-1042.628) (-1041.193) (-1038.336) * (-1042.090) (-1038.826) (-1037.126) [-1041.468] -- 0:00:17
874000 -- (-1051.475) (-1043.002) (-1039.428) [-1035.866] * (-1042.978) (-1041.800) (-1039.044) [-1033.371] -- 0:00:17
874500 -- (-1042.199) [-1042.064] (-1041.227) (-1039.266) * (-1039.681) (-1039.282) [-1036.821] (-1044.303) -- 0:00:17
875000 -- (-1041.585) (-1037.507) (-1034.916) [-1039.962] * (-1036.776) (-1037.792) [-1039.578] (-1036.261) -- 0:00:17
Average standard deviation of split frequencies: 0.004305
875500 -- (-1045.388) (-1040.810) (-1038.534) [-1034.806] * (-1037.121) [-1038.645] (-1038.442) (-1040.384) -- 0:00:17
876000 -- (-1035.503) (-1036.234) (-1043.292) [-1036.823] * (-1042.695) (-1036.337) [-1037.951] (-1034.730) -- 0:00:16
876500 -- (-1047.788) (-1039.971) [-1041.081] (-1035.472) * (-1041.341) [-1039.165] (-1038.756) (-1037.664) -- 0:00:17
877000 -- (-1040.494) (-1045.415) [-1034.570] (-1044.322) * (-1039.268) [-1037.826] (-1037.383) (-1045.158) -- 0:00:16
877500 -- [-1040.817] (-1043.548) (-1042.430) (-1037.388) * (-1041.936) (-1038.768) [-1041.498] (-1036.615) -- 0:00:16
878000 -- (-1039.339) [-1034.833] (-1040.689) (-1040.162) * (-1036.110) (-1042.424) [-1042.611] (-1039.245) -- 0:00:16
878500 -- (-1041.213) (-1034.702) (-1035.531) [-1037.729] * (-1037.639) (-1041.843) (-1037.200) [-1038.827] -- 0:00:16
879000 -- [-1041.613] (-1042.526) (-1040.902) (-1039.771) * (-1040.693) (-1039.331) (-1039.070) [-1038.883] -- 0:00:16
879500 -- (-1042.672) (-1037.977) (-1035.595) [-1036.908] * [-1035.138] (-1044.298) (-1034.907) (-1040.397) -- 0:00:16
880000 -- (-1040.221) [-1036.814] (-1036.931) (-1041.366) * (-1036.881) (-1049.784) [-1041.122] (-1034.364) -- 0:00:16
Average standard deviation of split frequencies: 0.003212
880500 -- (-1043.563) (-1043.782) [-1037.774] (-1039.433) * [-1036.530] (-1040.269) (-1043.423) (-1040.933) -- 0:00:16
881000 -- (-1038.050) [-1034.297] (-1036.652) (-1044.070) * [-1039.458] (-1046.652) (-1040.118) (-1047.518) -- 0:00:16
881500 -- (-1037.786) (-1039.157) (-1034.780) [-1039.027] * (-1042.186) [-1038.607] (-1036.573) (-1038.243) -- 0:00:16
882000 -- (-1042.154) (-1037.928) [-1038.106] (-1043.164) * (-1040.677) (-1043.684) (-1041.987) [-1038.917] -- 0:00:16
882500 -- (-1036.795) (-1036.405) (-1034.812) [-1039.414] * (-1038.984) [-1038.438] (-1040.400) (-1039.978) -- 0:00:16
883000 -- (-1038.110) [-1036.307] (-1035.092) (-1039.330) * (-1039.508) [-1033.807] (-1045.292) (-1044.096) -- 0:00:16
883500 -- (-1040.522) (-1040.451) [-1040.602] (-1040.812) * (-1042.907) (-1038.412) [-1040.789] (-1046.794) -- 0:00:15
884000 -- (-1036.152) [-1034.867] (-1036.685) (-1038.714) * (-1042.023) (-1044.712) [-1036.823] (-1045.327) -- 0:00:16
884500 -- [-1038.054] (-1036.936) (-1035.111) (-1038.154) * [-1042.794] (-1036.482) (-1046.541) (-1039.490) -- 0:00:15
885000 -- (-1035.701) [-1037.317] (-1037.125) (-1039.645) * (-1035.123) (-1036.215) (-1039.677) [-1041.776] -- 0:00:15
Average standard deviation of split frequencies: 0.003192
885500 -- [-1039.187] (-1038.478) (-1042.451) (-1044.653) * [-1039.147] (-1036.269) (-1044.639) (-1038.858) -- 0:00:15
886000 -- [-1041.470] (-1037.375) (-1035.812) (-1041.898) * [-1037.384] (-1039.339) (-1035.132) (-1036.752) -- 0:00:15
886500 -- (-1045.458) [-1038.986] (-1044.674) (-1039.394) * (-1041.738) [-1034.210] (-1042.455) (-1043.337) -- 0:00:15
887000 -- [-1038.529] (-1042.674) (-1046.518) (-1041.404) * [-1039.641] (-1038.948) (-1040.508) (-1041.935) -- 0:00:15
887500 -- (-1037.650) (-1039.945) [-1040.051] (-1038.269) * [-1033.973] (-1034.869) (-1039.066) (-1046.047) -- 0:00:15
888000 -- (-1040.557) [-1040.828] (-1040.152) (-1034.694) * (-1036.391) [-1034.972] (-1045.831) (-1034.415) -- 0:00:15
888500 -- [-1045.732] (-1038.926) (-1043.287) (-1036.614) * (-1043.169) [-1042.446] (-1039.910) (-1036.349) -- 0:00:15
889000 -- (-1039.163) (-1041.638) (-1039.565) [-1041.978] * (-1038.183) (-1043.207) [-1042.667] (-1038.974) -- 0:00:15
889500 -- (-1036.028) (-1042.097) (-1038.471) [-1039.324] * (-1040.846) (-1040.530) [-1041.275] (-1036.412) -- 0:00:15
890000 -- [-1035.591] (-1039.690) (-1035.588) (-1034.446) * (-1033.884) (-1038.037) [-1035.924] (-1046.785) -- 0:00:15
Average standard deviation of split frequencies: 0.003705
890500 -- (-1044.253) [-1036.181] (-1036.763) (-1038.755) * (-1042.757) (-1040.538) (-1042.185) [-1039.667] -- 0:00:15
891000 -- [-1036.039] (-1036.969) (-1038.750) (-1037.428) * (-1037.101) (-1032.988) (-1042.283) [-1034.682] -- 0:00:15
891500 -- [-1035.581] (-1038.663) (-1038.021) (-1040.142) * (-1042.027) [-1036.716] (-1038.841) (-1041.171) -- 0:00:14
892000 -- (-1038.797) (-1036.027) [-1037.254] (-1039.513) * (-1042.559) [-1036.106] (-1040.061) (-1042.293) -- 0:00:14
892500 -- (-1040.527) (-1034.616) (-1036.459) [-1035.726] * (-1033.436) (-1038.139) (-1039.168) [-1041.417] -- 0:00:14
893000 -- (-1041.665) [-1039.943] (-1042.080) (-1044.418) * (-1039.802) [-1040.473] (-1038.341) (-1044.174) -- 0:00:14
893500 -- (-1046.434) (-1036.052) (-1037.909) [-1039.943] * (-1045.445) [-1039.016] (-1034.398) (-1042.565) -- 0:00:14
894000 -- (-1044.892) [-1041.983] (-1040.026) (-1036.399) * [-1039.495] (-1039.377) (-1037.013) (-1044.778) -- 0:00:14
894500 -- [-1040.255] (-1036.977) (-1039.703) (-1036.223) * (-1041.917) (-1044.353) [-1035.548] (-1044.270) -- 0:00:14
895000 -- (-1043.720) (-1036.769) (-1038.639) [-1034.851] * [-1038.033] (-1041.097) (-1039.134) (-1041.926) -- 0:00:14
Average standard deviation of split frequencies: 0.003157
895500 -- (-1041.427) (-1039.700) (-1039.611) [-1036.193] * (-1045.002) (-1039.898) [-1039.000] (-1037.208) -- 0:00:14
896000 -- (-1043.989) [-1038.486] (-1040.257) (-1041.975) * (-1037.347) (-1040.934) (-1041.954) [-1037.960] -- 0:00:14
896500 -- [-1036.584] (-1042.508) (-1038.312) (-1036.522) * (-1040.971) (-1038.111) (-1041.386) [-1035.792] -- 0:00:14
897000 -- [-1035.626] (-1038.325) (-1033.874) (-1045.445) * (-1038.321) [-1039.986] (-1037.125) (-1039.809) -- 0:00:14
897500 -- (-1036.425) (-1043.744) (-1038.935) [-1039.251] * [-1036.632] (-1037.157) (-1038.381) (-1038.678) -- 0:00:14
898000 -- [-1036.761] (-1037.283) (-1037.738) (-1040.774) * (-1038.956) [-1037.590] (-1035.715) (-1038.422) -- 0:00:13
898500 -- (-1034.644) (-1036.633) [-1038.451] (-1033.032) * (-1037.701) [-1042.414] (-1037.173) (-1040.339) -- 0:00:14
899000 -- (-1039.745) (-1033.731) (-1038.549) [-1036.703] * (-1037.005) (-1034.494) (-1041.226) [-1036.136] -- 0:00:13
899500 -- [-1034.314] (-1037.585) (-1045.941) (-1039.627) * (-1038.458) (-1039.109) (-1042.926) [-1039.763] -- 0:00:13
900000 -- (-1038.395) (-1037.610) (-1046.571) [-1036.949] * (-1044.401) (-1038.906) (-1035.544) [-1038.675] -- 0:00:13
Average standard deviation of split frequencies: 0.003140
900500 -- (-1037.745) (-1036.787) (-1037.858) [-1038.752] * (-1036.827) (-1039.048) [-1039.379] (-1038.697) -- 0:00:13
901000 -- (-1036.603) (-1037.233) (-1036.831) [-1038.303] * (-1049.538) (-1038.079) [-1037.436] (-1034.444) -- 0:00:13
901500 -- (-1041.286) (-1039.029) (-1049.742) [-1039.853] * (-1043.660) (-1046.898) [-1035.740] (-1035.357) -- 0:00:13
902000 -- [-1037.396] (-1045.688) (-1036.013) (-1038.311) * (-1039.056) [-1043.715] (-1041.409) (-1037.478) -- 0:00:13
902500 -- (-1036.872) (-1048.924) (-1043.939) [-1044.968] * (-1045.423) (-1046.504) [-1037.267] (-1043.672) -- 0:00:13
903000 -- (-1044.805) (-1040.442) (-1038.726) [-1039.888] * (-1039.249) (-1037.622) (-1037.780) [-1039.368] -- 0:00:13
903500 -- (-1049.321) (-1039.429) (-1037.040) [-1036.514] * (-1039.634) (-1037.457) [-1041.007] (-1035.182) -- 0:00:13
904000 -- (-1046.999) [-1036.969] (-1039.845) (-1039.770) * (-1048.526) (-1035.715) [-1036.920] (-1039.137) -- 0:00:13
904500 -- (-1038.207) [-1038.833] (-1036.649) (-1036.364) * (-1049.319) [-1036.638] (-1035.304) (-1038.445) -- 0:00:13
905000 -- (-1041.694) (-1045.219) [-1034.845] (-1039.888) * (-1040.510) [-1036.543] (-1036.606) (-1036.496) -- 0:00:13
Average standard deviation of split frequencies: 0.002602
905500 -- (-1039.322) (-1045.167) (-1044.535) [-1037.567] * (-1040.512) (-1036.607) (-1037.710) [-1037.709] -- 0:00:12
906000 -- (-1045.191) (-1037.103) [-1035.726] (-1044.952) * [-1035.836] (-1044.930) (-1045.974) (-1038.198) -- 0:00:12
906500 -- [-1037.504] (-1035.665) (-1037.505) (-1043.608) * (-1036.825) [-1040.779] (-1038.773) (-1037.454) -- 0:00:12
907000 -- [-1040.292] (-1038.952) (-1035.337) (-1039.876) * [-1037.790] (-1040.164) (-1042.083) (-1041.264) -- 0:00:12
907500 -- (-1041.214) (-1045.274) (-1043.593) [-1038.663] * [-1036.795] (-1042.623) (-1041.628) (-1040.435) -- 0:00:12
908000 -- (-1037.558) (-1042.717) (-1035.883) [-1042.821] * (-1041.952) (-1040.003) (-1042.622) [-1040.831] -- 0:00:12
908500 -- [-1038.077] (-1041.198) (-1036.377) (-1046.208) * (-1044.679) (-1040.564) (-1037.490) [-1036.362] -- 0:00:12
909000 -- (-1045.119) (-1037.320) (-1035.002) [-1036.578] * [-1038.344] (-1041.518) (-1039.439) (-1043.814) -- 0:00:12
909500 -- [-1035.148] (-1038.883) (-1041.637) (-1037.255) * [-1033.690] (-1042.036) (-1040.077) (-1036.327) -- 0:00:12
910000 -- [-1036.630] (-1040.401) (-1039.850) (-1036.619) * (-1033.490) [-1041.923] (-1038.410) (-1039.055) -- 0:00:12
Average standard deviation of split frequencies: 0.003106
910500 -- (-1039.623) (-1042.116) [-1038.221] (-1037.522) * [-1040.367] (-1038.288) (-1039.316) (-1045.120) -- 0:00:12
911000 -- (-1044.114) (-1042.072) [-1040.243] (-1037.150) * [-1036.608] (-1041.680) (-1042.199) (-1037.819) -- 0:00:12
911500 -- [-1041.835] (-1039.636) (-1039.028) (-1034.614) * (-1037.022) (-1035.934) (-1047.258) [-1038.480] -- 0:00:12
912000 -- [-1035.185] (-1041.284) (-1043.472) (-1036.511) * [-1036.514] (-1038.591) (-1045.534) (-1039.677) -- 0:00:12
912500 -- [-1035.233] (-1037.881) (-1038.366) (-1035.466) * [-1038.396] (-1043.999) (-1037.682) (-1039.453) -- 0:00:11
913000 -- [-1039.439] (-1041.492) (-1033.984) (-1038.587) * (-1033.075) (-1038.709) (-1037.210) [-1036.727] -- 0:00:12
913500 -- (-1041.170) (-1035.793) [-1037.295] (-1038.162) * [-1039.431] (-1038.937) (-1041.683) (-1049.176) -- 0:00:11
914000 -- (-1038.818) [-1039.190] (-1034.495) (-1037.372) * [-1036.000] (-1042.945) (-1036.632) (-1040.569) -- 0:00:11
914500 -- (-1041.554) (-1041.300) (-1038.451) [-1039.789] * (-1039.076) (-1042.883) [-1041.106] (-1040.154) -- 0:00:11
915000 -- (-1038.261) [-1040.078] (-1038.322) (-1046.602) * [-1037.985] (-1038.182) (-1038.148) (-1036.699) -- 0:00:11
Average standard deviation of split frequencies: 0.003602
915500 -- (-1040.005) (-1043.132) (-1039.565) [-1045.137] * (-1037.942) (-1036.533) (-1041.155) [-1041.959] -- 0:00:11
916000 -- [-1039.856] (-1046.609) (-1046.522) (-1045.057) * (-1037.533) (-1039.502) (-1044.394) [-1039.412] -- 0:00:11
916500 -- [-1036.750] (-1041.600) (-1046.037) (-1039.458) * [-1037.219] (-1036.401) (-1040.628) (-1040.802) -- 0:00:11
917000 -- [-1041.509] (-1047.138) (-1042.547) (-1045.501) * [-1038.130] (-1033.747) (-1045.267) (-1040.403) -- 0:00:11
917500 -- (-1039.264) [-1043.499] (-1039.722) (-1041.173) * [-1036.029] (-1039.872) (-1042.458) (-1036.238) -- 0:00:11
918000 -- (-1038.617) [-1035.564] (-1044.375) (-1042.642) * (-1041.650) (-1037.013) (-1042.262) [-1034.308] -- 0:00:11
918500 -- (-1037.894) (-1039.232) [-1036.048] (-1035.761) * (-1037.300) (-1037.306) [-1038.820] (-1038.416) -- 0:00:11
919000 -- (-1050.294) (-1040.121) [-1039.137] (-1041.484) * (-1039.563) [-1038.440] (-1042.984) (-1038.241) -- 0:00:11
919500 -- (-1037.279) (-1044.371) [-1038.171] (-1041.627) * [-1043.287] (-1041.943) (-1040.885) (-1036.824) -- 0:00:11
920000 -- [-1041.979] (-1037.724) (-1040.556) (-1044.845) * (-1044.253) [-1039.615] (-1036.627) (-1039.278) -- 0:00:10
Average standard deviation of split frequencies: 0.002048
920500 -- [-1041.457] (-1039.001) (-1035.585) (-1044.529) * (-1036.705) (-1036.321) (-1033.982) [-1035.855] -- 0:00:10
921000 -- (-1038.169) (-1042.584) [-1036.526] (-1039.504) * (-1037.709) (-1036.199) (-1039.306) [-1033.688] -- 0:00:10
921500 -- (-1039.767) [-1040.495] (-1036.852) (-1040.415) * (-1038.360) (-1043.212) (-1037.584) [-1039.948] -- 0:00:10
922000 -- [-1039.052] (-1034.878) (-1042.322) (-1039.263) * [-1039.687] (-1041.146) (-1037.713) (-1036.756) -- 0:00:10
922500 -- (-1035.348) (-1034.406) [-1041.133] (-1037.988) * [-1036.936] (-1039.158) (-1033.695) (-1036.171) -- 0:00:10
923000 -- (-1041.538) (-1037.562) [-1038.311] (-1038.656) * (-1037.906) (-1037.747) [-1034.684] (-1037.982) -- 0:00:10
923500 -- (-1041.418) [-1038.078] (-1040.016) (-1040.792) * (-1043.475) (-1039.584) [-1038.383] (-1036.397) -- 0:00:10
924000 -- (-1042.900) [-1039.171] (-1036.086) (-1043.161) * [-1034.098] (-1039.585) (-1036.352) (-1037.249) -- 0:00:10
924500 -- (-1041.753) [-1038.298] (-1038.179) (-1041.045) * [-1037.110] (-1041.574) (-1035.218) (-1036.659) -- 0:00:10
925000 -- [-1040.859] (-1041.207) (-1042.278) (-1044.241) * (-1039.203) (-1044.188) [-1037.590] (-1038.611) -- 0:00:10
Average standard deviation of split frequencies: 0.001018
925500 -- (-1039.607) [-1041.061] (-1046.433) (-1043.760) * [-1037.638] (-1047.064) (-1039.799) (-1038.602) -- 0:00:10
926000 -- (-1035.843) [-1037.113] (-1044.857) (-1034.116) * (-1034.765) (-1041.425) [-1034.536] (-1045.040) -- 0:00:10
926500 -- [-1036.186] (-1039.938) (-1042.737) (-1038.708) * (-1042.253) [-1038.997] (-1036.947) (-1045.383) -- 0:00:10
927000 -- [-1037.105] (-1043.488) (-1041.681) (-1037.577) * (-1038.245) (-1043.265) (-1042.461) [-1036.012] -- 0:00:10
927500 -- (-1036.998) (-1037.474) [-1039.209] (-1037.051) * (-1035.145) (-1037.671) [-1045.750] (-1043.106) -- 0:00:10
928000 -- (-1037.360) [-1036.624] (-1036.112) (-1042.001) * [-1038.988] (-1046.431) (-1034.944) (-1041.966) -- 0:00:09
928500 -- [-1038.252] (-1044.034) (-1038.890) (-1043.788) * (-1037.745) [-1040.726] (-1034.328) (-1037.895) -- 0:00:09
929000 -- (-1037.708) (-1040.120) (-1037.446) [-1039.739] * (-1037.167) (-1041.670) (-1039.338) [-1040.432] -- 0:00:09
929500 -- (-1045.268) (-1037.510) [-1037.227] (-1041.001) * (-1045.392) (-1042.465) (-1035.966) [-1036.035] -- 0:00:09
930000 -- (-1038.882) [-1040.317] (-1043.276) (-1038.934) * (-1037.134) (-1042.436) (-1038.105) [-1035.971] -- 0:00:09
Average standard deviation of split frequencies: 0.001520
930500 -- (-1040.655) (-1040.012) [-1043.830] (-1040.791) * (-1037.698) [-1037.373] (-1042.342) (-1040.506) -- 0:00:09
931000 -- (-1039.047) (-1043.975) (-1037.949) [-1037.551] * (-1036.853) (-1038.411) [-1040.668] (-1035.229) -- 0:00:09
931500 -- [-1034.800] (-1038.550) (-1033.612) (-1040.170) * (-1038.757) (-1043.075) [-1036.951] (-1038.373) -- 0:00:09
932000 -- (-1037.299) [-1040.351] (-1037.649) (-1038.771) * (-1041.096) (-1048.348) (-1042.067) [-1036.294] -- 0:00:09
932500 -- [-1035.424] (-1037.031) (-1038.596) (-1038.051) * [-1038.751] (-1036.447) (-1038.086) (-1037.520) -- 0:00:09
933000 -- (-1043.398) (-1035.520) (-1039.851) [-1037.830] * (-1043.209) (-1037.469) (-1035.629) [-1036.755] -- 0:00:09
933500 -- (-1049.959) (-1034.861) (-1051.167) [-1033.579] * (-1041.305) (-1037.869) (-1032.959) [-1037.584] -- 0:00:09
934000 -- (-1037.469) [-1038.105] (-1041.796) (-1041.467) * (-1044.803) (-1040.011) [-1037.000] (-1042.434) -- 0:00:09
934500 -- (-1035.924) (-1045.148) (-1036.354) [-1036.420] * [-1045.397] (-1041.659) (-1037.497) (-1040.601) -- 0:00:08
935000 -- (-1034.873) [-1043.135] (-1039.532) (-1037.946) * [-1037.921] (-1037.130) (-1040.200) (-1039.902) -- 0:00:08
Average standard deviation of split frequencies: 0.002015
935500 -- (-1034.058) (-1034.797) (-1035.598) [-1037.191] * (-1039.598) (-1038.031) [-1042.036] (-1040.144) -- 0:00:08
936000 -- [-1038.315] (-1035.305) (-1035.373) (-1042.609) * (-1038.829) (-1039.704) (-1037.662) [-1043.137] -- 0:00:08
936500 -- (-1036.619) (-1040.622) (-1038.590) [-1036.059] * [-1041.599] (-1039.676) (-1038.920) (-1036.989) -- 0:00:08
937000 -- (-1034.094) (-1043.701) (-1039.341) [-1039.357] * (-1051.700) (-1041.727) [-1036.070] (-1036.714) -- 0:00:08
937500 -- [-1044.261] (-1037.258) (-1040.893) (-1035.908) * (-1042.168) [-1040.265] (-1041.804) (-1037.509) -- 0:00:08
938000 -- (-1036.138) (-1045.224) (-1037.119) [-1042.792] * (-1041.268) [-1039.168] (-1036.496) (-1041.578) -- 0:00:08
938500 -- (-1039.430) (-1039.235) (-1041.913) [-1034.848] * [-1038.309] (-1049.822) (-1037.741) (-1037.982) -- 0:00:08
939000 -- (-1034.903) (-1040.107) [-1037.917] (-1039.566) * (-1039.986) (-1045.097) (-1039.442) [-1039.523] -- 0:00:08
939500 -- [-1036.202] (-1034.914) (-1038.344) (-1041.636) * (-1040.291) (-1036.589) (-1040.455) [-1035.628] -- 0:00:08
940000 -- (-1036.943) [-1041.136] (-1037.540) (-1035.549) * (-1043.934) (-1036.765) [-1034.116] (-1039.664) -- 0:00:08
Average standard deviation of split frequencies: 0.003007
940500 -- [-1035.249] (-1037.939) (-1042.529) (-1037.980) * (-1049.925) (-1040.849) (-1039.926) [-1037.838] -- 0:00:08
941000 -- (-1037.412) [-1038.156] (-1035.316) (-1042.083) * (-1048.768) [-1042.076] (-1043.823) (-1034.597) -- 0:00:08
941500 -- (-1039.096) (-1045.485) [-1034.864] (-1040.317) * (-1041.081) (-1042.947) (-1037.315) [-1037.532] -- 0:00:08
942000 -- (-1042.387) [-1035.203] (-1042.447) (-1038.126) * (-1046.705) [-1046.607] (-1038.265) (-1037.544) -- 0:00:08
942500 -- (-1037.967) (-1035.254) (-1040.655) [-1041.466] * [-1043.626] (-1047.533) (-1043.582) (-1034.360) -- 0:00:07
943000 -- [-1037.211] (-1038.333) (-1043.268) (-1042.889) * (-1047.722) (-1041.613) (-1042.350) [-1037.594] -- 0:00:07
943500 -- (-1036.947) (-1043.634) [-1046.169] (-1039.887) * (-1044.902) (-1037.840) (-1038.650) [-1039.419] -- 0:00:07
944000 -- (-1048.458) [-1035.017] (-1036.344) (-1045.185) * [-1036.735] (-1039.018) (-1042.165) (-1039.174) -- 0:00:07
944500 -- (-1039.059) (-1042.979) (-1041.018) [-1042.156] * (-1036.906) (-1038.209) (-1040.928) [-1035.266] -- 0:00:07
945000 -- (-1034.050) (-1037.809) (-1040.680) [-1037.341] * (-1041.965) (-1037.733) (-1041.161) [-1035.184] -- 0:00:07
Average standard deviation of split frequencies: 0.002492
945500 -- [-1042.847] (-1039.832) (-1038.348) (-1038.621) * [-1036.784] (-1039.438) (-1034.834) (-1041.186) -- 0:00:07
946000 -- (-1036.556) [-1042.608] (-1038.447) (-1040.035) * (-1037.154) [-1039.032] (-1037.684) (-1044.494) -- 0:00:07
946500 -- (-1041.020) (-1036.977) (-1038.690) [-1035.812] * (-1042.351) (-1033.285) (-1042.919) [-1038.051] -- 0:00:07
947000 -- (-1041.568) [-1038.834] (-1041.777) (-1035.882) * (-1039.773) [-1039.334] (-1041.861) (-1039.926) -- 0:00:07
947500 -- (-1035.234) (-1044.057) (-1043.753) [-1035.232] * (-1039.118) [-1037.448] (-1039.118) (-1038.164) -- 0:00:07
948000 -- (-1042.523) (-1035.837) (-1038.778) [-1038.427] * (-1037.631) [-1039.408] (-1039.394) (-1034.984) -- 0:00:07
948500 -- [-1036.285] (-1037.622) (-1041.144) (-1037.258) * [-1040.937] (-1037.697) (-1034.769) (-1039.024) -- 0:00:07
949000 -- (-1040.545) (-1039.983) (-1039.125) [-1035.179] * (-1035.732) (-1042.675) (-1036.425) [-1038.143] -- 0:00:06
949500 -- (-1037.604) (-1040.618) (-1038.724) [-1038.200] * (-1037.691) [-1037.829] (-1038.667) (-1042.719) -- 0:00:06
950000 -- (-1036.295) (-1038.536) [-1039.169] (-1044.934) * [-1041.794] (-1046.192) (-1045.311) (-1035.277) -- 0:00:06
Average standard deviation of split frequencies: 0.002975
950500 -- [-1045.765] (-1036.557) (-1045.527) (-1037.871) * [-1038.690] (-1046.813) (-1040.420) (-1036.790) -- 0:00:06
951000 -- (-1041.421) (-1039.377) [-1037.699] (-1040.837) * (-1041.347) [-1036.939] (-1039.941) (-1038.310) -- 0:00:06
951500 -- (-1036.907) (-1046.622) (-1038.571) [-1037.772] * (-1044.672) (-1035.694) [-1032.352] (-1039.929) -- 0:00:06
952000 -- (-1040.646) (-1037.569) (-1035.668) [-1039.140] * (-1038.383) (-1036.331) (-1034.762) [-1042.970] -- 0:00:06
952500 -- (-1038.700) [-1036.285] (-1034.388) (-1036.833) * [-1038.475] (-1039.272) (-1036.179) (-1044.931) -- 0:00:06
953000 -- [-1037.239] (-1043.007) (-1034.250) (-1042.296) * [-1038.868] (-1039.497) (-1040.131) (-1037.660) -- 0:00:06
953500 -- (-1043.701) (-1035.388) [-1041.439] (-1036.682) * (-1041.632) (-1042.957) [-1035.995] (-1040.728) -- 0:00:06
954000 -- (-1048.639) (-1046.182) [-1035.097] (-1038.373) * (-1044.439) (-1037.498) (-1039.600) [-1036.211] -- 0:00:06
954500 -- [-1037.918] (-1037.686) (-1040.298) (-1037.071) * (-1041.834) (-1045.177) (-1038.686) [-1034.299] -- 0:00:06
955000 -- (-1043.215) (-1036.915) (-1037.152) [-1035.067] * (-1035.106) (-1036.122) [-1035.195] (-1043.402) -- 0:00:06
Average standard deviation of split frequencies: 0.002466
955500 -- (-1036.373) [-1040.279] (-1041.380) (-1039.479) * [-1042.490] (-1039.111) (-1035.951) (-1047.884) -- 0:00:06
956000 -- (-1043.163) (-1049.168) [-1045.253] (-1040.564) * [-1035.453] (-1040.494) (-1040.230) (-1042.553) -- 0:00:06
956500 -- (-1040.441) [-1040.969] (-1041.440) (-1043.458) * [-1039.256] (-1035.796) (-1041.222) (-1038.066) -- 0:00:05
957000 -- (-1038.216) (-1040.242) [-1042.501] (-1034.235) * (-1046.831) (-1041.453) (-1035.740) [-1040.181] -- 0:00:05
957500 -- (-1036.625) (-1043.690) (-1040.398) [-1038.745] * (-1041.043) (-1037.165) (-1037.899) [-1036.453] -- 0:00:05
958000 -- (-1037.388) (-1038.820) [-1039.591] (-1046.721) * [-1040.308] (-1033.453) (-1040.896) (-1043.377) -- 0:00:05
958500 -- (-1040.359) (-1047.309) (-1041.574) [-1035.095] * (-1045.778) (-1040.828) (-1037.661) [-1039.182] -- 0:00:05
959000 -- [-1041.137] (-1036.862) (-1042.096) (-1038.166) * (-1047.709) (-1038.435) (-1040.668) [-1038.077] -- 0:00:05
959500 -- (-1041.425) (-1039.079) (-1040.431) [-1037.750] * (-1041.092) [-1037.906] (-1041.162) (-1035.104) -- 0:00:05
960000 -- (-1040.342) (-1040.543) (-1038.901) [-1039.155] * [-1039.150] (-1043.580) (-1038.886) (-1041.891) -- 0:00:05
Average standard deviation of split frequencies: 0.002454
960500 -- (-1039.676) (-1036.833) [-1033.315] (-1041.773) * (-1040.190) [-1041.886] (-1039.198) (-1038.124) -- 0:00:05
961000 -- [-1041.097] (-1036.665) (-1040.173) (-1038.191) * (-1047.792) [-1037.323] (-1039.806) (-1039.320) -- 0:00:05
961500 -- [-1036.753] (-1036.077) (-1039.795) (-1046.900) * (-1044.780) (-1036.237) (-1038.499) [-1037.877] -- 0:00:05
962000 -- [-1035.140] (-1043.014) (-1046.592) (-1043.165) * (-1037.580) [-1043.042] (-1041.191) (-1041.131) -- 0:00:05
962500 -- (-1038.115) (-1035.548) [-1049.758] (-1048.053) * (-1036.416) (-1039.363) (-1038.745) [-1039.096] -- 0:00:05
963000 -- [-1043.378] (-1038.444) (-1038.857) (-1037.070) * (-1040.480) (-1039.034) [-1039.258] (-1040.533) -- 0:00:05
963500 -- (-1039.393) [-1038.178] (-1039.884) (-1043.897) * (-1036.462) [-1036.484] (-1040.028) (-1042.399) -- 0:00:05
964000 -- (-1036.343) (-1041.688) [-1037.310] (-1034.585) * (-1042.741) [-1041.576] (-1037.167) (-1038.025) -- 0:00:04
964500 -- (-1038.573) [-1037.417] (-1038.463) (-1040.839) * (-1043.805) (-1036.016) [-1039.437] (-1039.244) -- 0:00:04
965000 -- [-1039.478] (-1034.965) (-1037.769) (-1036.666) * (-1041.048) (-1037.975) [-1037.172] (-1036.018) -- 0:00:04
Average standard deviation of split frequencies: 0.001952
965500 -- (-1037.112) (-1036.417) [-1038.584] (-1037.272) * (-1036.472) (-1038.452) (-1035.447) [-1038.400] -- 0:00:04
966000 -- (-1040.403) (-1041.910) [-1041.658] (-1037.102) * (-1034.540) [-1040.867] (-1039.505) (-1042.510) -- 0:00:04
966500 -- [-1035.997] (-1044.932) (-1042.229) (-1038.376) * (-1036.991) (-1041.511) (-1045.906) [-1040.521] -- 0:00:04
967000 -- (-1040.397) (-1039.380) (-1037.808) [-1039.982] * (-1038.339) (-1038.675) (-1045.587) [-1041.882] -- 0:00:04
967500 -- (-1034.364) (-1039.325) [-1041.896] (-1040.852) * (-1043.087) [-1039.418] (-1043.226) (-1037.920) -- 0:00:04
968000 -- (-1036.303) (-1045.831) [-1034.759] (-1037.764) * [-1038.164] (-1042.229) (-1042.738) (-1039.873) -- 0:00:04
968500 -- (-1040.196) (-1045.703) (-1041.375) [-1038.821] * (-1040.449) [-1039.466] (-1033.366) (-1040.593) -- 0:00:04
969000 -- [-1039.740] (-1038.698) (-1035.957) (-1039.359) * (-1040.610) [-1039.026] (-1038.934) (-1040.377) -- 0:00:04
969500 -- (-1040.619) (-1039.978) (-1037.217) [-1035.319] * (-1041.414) [-1039.289] (-1038.502) (-1041.175) -- 0:00:04
970000 -- [-1039.264] (-1047.438) (-1042.810) (-1041.490) * (-1034.440) (-1040.912) (-1037.152) [-1036.215] -- 0:00:04
Average standard deviation of split frequencies: 0.001943
970500 -- [-1043.366] (-1043.658) (-1040.516) (-1036.572) * (-1036.847) (-1040.868) [-1036.845] (-1035.863) -- 0:00:04
971000 -- (-1042.437) (-1042.183) (-1040.018) [-1037.363] * (-1037.791) (-1035.662) (-1036.117) [-1038.027] -- 0:00:03
971500 -- (-1041.237) [-1036.755] (-1040.405) (-1035.950) * (-1040.854) (-1045.838) [-1037.353] (-1035.748) -- 0:00:03
972000 -- (-1037.912) [-1042.869] (-1037.754) (-1036.781) * [-1038.635] (-1042.613) (-1038.809) (-1041.140) -- 0:00:03
972500 -- [-1045.164] (-1037.951) (-1042.657) (-1039.596) * (-1043.473) (-1037.608) (-1035.830) [-1042.420] -- 0:00:03
973000 -- [-1044.245] (-1041.576) (-1043.468) (-1039.327) * (-1041.068) (-1041.534) [-1039.562] (-1037.157) -- 0:00:03
973500 -- (-1044.173) (-1042.444) (-1041.646) [-1035.851] * (-1040.554) (-1042.749) (-1042.524) [-1039.490] -- 0:00:03
974000 -- [-1037.518] (-1037.718) (-1037.936) (-1043.794) * (-1042.880) (-1036.129) (-1040.171) [-1045.069] -- 0:00:03
974500 -- (-1038.228) (-1045.375) (-1042.676) [-1041.803] * (-1048.357) (-1036.290) (-1040.054) [-1039.069] -- 0:00:03
975000 -- (-1042.498) (-1041.139) (-1043.835) [-1037.065] * (-1040.782) (-1035.883) (-1034.871) [-1035.569] -- 0:00:03
Average standard deviation of split frequencies: 0.001449
975500 -- (-1039.315) (-1039.562) [-1041.054] (-1037.576) * (-1037.771) [-1035.832] (-1040.312) (-1039.498) -- 0:00:03
976000 -- [-1039.347] (-1049.028) (-1044.978) (-1040.582) * (-1035.171) [-1038.968] (-1037.325) (-1041.475) -- 0:00:03
976500 -- (-1041.188) (-1042.759) (-1042.843) [-1035.234] * [-1041.750] (-1037.882) (-1045.320) (-1039.959) -- 0:00:03
977000 -- (-1040.344) [-1038.707] (-1040.965) (-1035.310) * [-1045.287] (-1041.660) (-1035.004) (-1041.445) -- 0:00:03
977500 -- [-1043.738] (-1041.422) (-1037.661) (-1039.208) * (-1035.807) (-1040.687) (-1035.987) [-1043.045] -- 0:00:03
978000 -- (-1042.644) (-1035.394) (-1037.067) [-1038.725] * [-1042.071] (-1043.786) (-1038.542) (-1045.217) -- 0:00:03
978500 -- (-1035.873) [-1037.019] (-1040.689) (-1034.885) * (-1042.817) (-1038.223) [-1040.058] (-1041.230) -- 0:00:02
979000 -- (-1036.166) [-1035.975] (-1035.841) (-1034.795) * [-1037.547] (-1036.798) (-1034.230) (-1042.422) -- 0:00:02
979500 -- [-1036.527] (-1046.795) (-1037.245) (-1039.406) * (-1037.403) (-1041.175) [-1037.729] (-1045.467) -- 0:00:02
980000 -- (-1040.138) (-1039.849) (-1040.073) [-1036.631] * (-1034.568) (-1038.309) [-1035.653] (-1038.054) -- 0:00:02
Average standard deviation of split frequencies: 0.000961
980500 -- (-1043.103) [-1041.194] (-1044.862) (-1041.677) * (-1040.424) (-1039.233) [-1040.380] (-1042.129) -- 0:00:02
981000 -- (-1040.792) (-1043.640) (-1046.979) [-1039.482] * [-1039.379] (-1046.473) (-1036.429) (-1038.209) -- 0:00:02
981500 -- (-1036.960) (-1040.781) [-1041.462] (-1038.704) * (-1048.617) (-1039.261) (-1038.955) [-1037.638] -- 0:00:02
982000 -- [-1039.822] (-1041.588) (-1041.389) (-1039.518) * (-1043.828) (-1040.682) [-1037.702] (-1047.303) -- 0:00:02
982500 -- (-1040.570) (-1038.875) (-1038.823) [-1036.143] * (-1044.159) [-1035.652] (-1041.064) (-1039.295) -- 0:00:02
983000 -- [-1046.249] (-1044.213) (-1040.486) (-1038.112) * (-1040.847) [-1034.293] (-1039.466) (-1041.942) -- 0:00:02
983500 -- (-1041.117) [-1036.675] (-1038.706) (-1033.477) * (-1037.821) (-1037.959) (-1048.078) [-1044.078] -- 0:00:02
984000 -- (-1043.635) (-1041.619) [-1037.077] (-1038.640) * (-1045.413) (-1036.814) (-1035.897) [-1041.523] -- 0:00:02
984500 -- (-1043.741) (-1042.006) (-1036.098) [-1039.671] * (-1043.791) (-1037.771) (-1036.453) [-1037.702] -- 0:00:02
985000 -- (-1040.928) (-1043.621) (-1037.977) [-1034.552] * (-1038.130) [-1041.590] (-1036.394) (-1040.061) -- 0:00:02
Average standard deviation of split frequencies: 0.000000
985500 -- [-1038.738] (-1041.795) (-1041.987) (-1036.833) * [-1037.670] (-1042.579) (-1037.373) (-1034.971) -- 0:00:01
986000 -- (-1038.908) (-1036.975) [-1041.771] (-1043.088) * (-1045.130) (-1042.898) (-1035.110) [-1036.727] -- 0:00:01
986500 -- (-1040.040) [-1043.446] (-1050.804) (-1036.319) * (-1037.306) (-1043.437) (-1038.386) [-1037.424] -- 0:00:01
987000 -- (-1044.145) [-1039.666] (-1045.196) (-1036.700) * (-1041.874) (-1042.768) (-1041.589) [-1037.403] -- 0:00:01
987500 -- (-1039.712) [-1038.387] (-1036.559) (-1043.401) * (-1044.182) (-1036.187) [-1039.901] (-1045.119) -- 0:00:01
988000 -- (-1041.484) [-1045.534] (-1039.907) (-1041.246) * (-1046.506) (-1037.030) (-1037.412) [-1040.106] -- 0:00:01
988500 -- (-1042.924) (-1043.713) [-1035.403] (-1040.536) * (-1040.658) [-1036.846] (-1039.076) (-1038.110) -- 0:00:01
989000 -- (-1038.648) (-1039.291) (-1037.947) [-1037.172] * [-1037.033] (-1037.557) (-1039.696) (-1037.134) -- 0:00:01
989500 -- (-1040.082) [-1039.643] (-1036.890) (-1040.187) * [-1037.746] (-1043.943) (-1039.600) (-1040.489) -- 0:00:01
990000 -- (-1036.681) (-1036.333) [-1042.602] (-1038.243) * (-1037.227) (-1035.642) [-1037.695] (-1045.829) -- 0:00:01
Average standard deviation of split frequencies: 0.000476
990500 -- (-1041.210) (-1036.653) [-1040.930] (-1039.437) * (-1042.450) (-1038.672) [-1036.042] (-1042.019) -- 0:00:01
991000 -- (-1037.402) [-1041.036] (-1038.939) (-1043.172) * (-1042.848) (-1038.034) (-1036.495) [-1037.304] -- 0:00:01
991500 -- (-1034.472) (-1038.011) [-1035.166] (-1049.410) * [-1040.906] (-1040.610) (-1037.891) (-1042.546) -- 0:00:01
992000 -- (-1038.132) (-1042.706) (-1040.084) [-1036.286] * (-1035.347) (-1042.824) (-1043.098) [-1041.283] -- 0:00:01
992500 -- (-1040.849) (-1038.722) (-1038.843) [-1034.710] * (-1042.906) (-1044.494) [-1039.090] (-1038.323) -- 0:00:01
993000 -- [-1045.248] (-1040.393) (-1041.342) (-1037.373) * [-1035.240] (-1039.743) (-1044.293) (-1039.725) -- 0:00:00
993500 -- (-1044.536) [-1039.191] (-1038.540) (-1041.554) * (-1038.508) [-1041.814] (-1042.599) (-1038.764) -- 0:00:00
994000 -- (-1040.181) [-1041.436] (-1038.556) (-1041.742) * (-1035.427) (-1042.783) [-1038.836] (-1035.076) -- 0:00:00
994500 -- [-1040.667] (-1040.968) (-1036.769) (-1039.012) * (-1037.101) (-1033.065) (-1041.564) [-1039.420] -- 0:00:00
995000 -- (-1043.633) (-1043.767) [-1034.139] (-1039.144) * (-1036.801) (-1043.461) [-1044.336] (-1036.185) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
995500 -- (-1037.462) [-1045.768] (-1037.524) (-1039.322) * (-1041.370) (-1036.256) [-1040.135] (-1044.079) -- 0:00:00
996000 -- (-1038.061) (-1041.800) [-1040.623] (-1042.669) * [-1043.934] (-1034.783) (-1036.724) (-1039.211) -- 0:00:00
996500 -- (-1034.526) (-1041.847) (-1039.562) [-1035.305] * (-1040.686) (-1040.477) (-1035.120) [-1035.924] -- 0:00:00
997000 -- (-1037.359) (-1038.761) [-1037.317] (-1044.572) * (-1038.564) [-1039.261] (-1040.258) (-1038.901) -- 0:00:00
997500 -- [-1035.765] (-1035.745) (-1041.095) (-1046.489) * [-1044.133] (-1037.422) (-1037.946) (-1036.396) -- 0:00:00
998000 -- (-1032.554) (-1038.818) (-1048.111) [-1038.696] * (-1040.877) (-1039.192) [-1037.032] (-1032.694) -- 0:00:00
998500 -- (-1037.940) (-1036.200) [-1040.908] (-1042.059) * (-1041.063) (-1037.749) (-1037.715) [-1039.024] -- 0:00:00
999000 -- [-1037.427] (-1043.142) (-1037.209) (-1036.160) * (-1036.798) (-1037.426) (-1035.702) [-1037.574] -- 0:00:00
999500 -- (-1038.324) (-1037.462) [-1039.555] (-1034.979) * (-1035.414) (-1037.780) (-1036.414) [-1038.485] -- 0:00:00
1000000 -- [-1037.244] (-1035.493) (-1039.011) (-1039.250) * (-1039.820) [-1039.742] (-1039.187) (-1034.697) -- 0:00:00
Average standard deviation of split frequencies: 0.000471
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1037.243558 -- 12.648728
Chain 1 -- -1037.243558 -- 12.648728
Chain 2 -- -1035.493087 -- 8.830748
Chain 2 -- -1035.493089 -- 8.830748
Chain 3 -- -1039.011468 -- 13.681852
Chain 3 -- -1039.011468 -- 13.681852
Chain 4 -- -1039.249567 -- 12.100126
Chain 4 -- -1039.249567 -- 12.100126
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1039.820118 -- 11.862511
Chain 1 -- -1039.820118 -- 11.862511
Chain 2 -- -1039.741847 -- 12.590846
Chain 2 -- -1039.741847 -- 12.590846
Chain 3 -- -1039.187036 -- 12.231574
Chain 3 -- -1039.187036 -- 12.231574
Chain 4 -- -1034.697461 -- 9.998905
Chain 4 -- -1034.697461 -- 9.998905
Analysis completed in 2 mins 17 seconds
Analysis used 137.01 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1031.13
Likelihood of best state for "cold" chain of run 2 was -1031.09
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
47.9 % ( 30 %) Dirichlet(Revmat{all})
68.9 % ( 56 %) Slider(Revmat{all})
27.5 % ( 25 %) Dirichlet(Pi{all})
29.5 % ( 22 %) Slider(Pi{all})
61.7 % ( 26 %) Multiplier(Alpha{1,2})
46.5 % ( 31 %) Multiplier(Alpha{3})
68.2 % ( 56 %) Slider(Pinvar{all})
13.7 % ( 13 %) NNI(Tau{all},V{all})
12.0 % ( 15 %) ParsSPR(Tau{all},V{all})
26.3 % ( 20 %) Multiplier(V{all})
44.5 % ( 41 %) Nodeslider(V{all})
26.2 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
48.0 % ( 30 %) Dirichlet(Revmat{all})
67.7 % ( 47 %) Slider(Revmat{all})
28.2 % ( 27 %) Dirichlet(Pi{all})
29.4 % ( 29 %) Slider(Pi{all})
61.7 % ( 35 %) Multiplier(Alpha{1,2})
47.0 % ( 22 %) Multiplier(Alpha{3})
67.6 % ( 44 %) Slider(Pinvar{all})
13.8 % ( 25 %) NNI(Tau{all},V{all})
12.2 % ( 13 %) ParsSPR(Tau{all},V{all})
26.3 % ( 31 %) Multiplier(V{all})
44.7 % ( 45 %) Nodeslider(V{all})
25.8 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.85 0.71 0.59
2 | 166275 0.86 0.73
3 | 166208 166421 0.87
4 | 166687 167427 166982
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.71 0.59
2 | 166940 0.86 0.73
3 | 166409 166614 0.87
4 | 166896 166486 166655
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1037.17
| 11 |
| 2 1 |
| 2 1 |
| 1 2 2 2 1 1 1 2 222 2 |
| 1 1 2 2 * 1 2 1 |
| 2 21 2 2 2 2 12 22 1 1 1 2 ** 1 |
| 1 2 21 2 1 21 221 2 12 2 2 |
| 1 12 1 12 1 11 * |
| 2 2 * 1 1 2 22 1 2 2 1 2 |
| 12 1 1 2 11 2 22 11|
|* 1 1 1 1 2 1 1 2 2|
| 1 2 1 1 |
| 1 2 |
| 2 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1040.09
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1035.92 -1044.26
2 -1035.96 -1043.89
--------------------------------------
TOTAL -1035.94 -1044.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.296314 0.005023 0.177940 0.435425 0.286058 1098.03 1229.73 1.001
r(A<->C){all} 0.138782 0.003262 0.034008 0.248868 0.132041 808.73 849.64 1.000
r(A<->G){all} 0.086346 0.000991 0.035768 0.153983 0.081752 973.27 974.56 1.000
r(A<->T){all} 0.107468 0.002986 0.005152 0.207251 0.102866 733.34 803.64 1.000
r(C<->G){all} 0.013681 0.000107 0.000005 0.032937 0.011321 1100.05 1214.25 1.000
r(C<->T){all} 0.635538 0.005972 0.485295 0.781848 0.639666 689.59 727.72 1.000
r(G<->T){all} 0.018185 0.000181 0.000053 0.044197 0.015610 817.34 941.24 1.001
pi(A){all} 0.173761 0.000236 0.144738 0.205147 0.173821 1127.93 1271.42 1.002
pi(C){all} 0.198794 0.000245 0.167595 0.228583 0.198441 1184.73 1321.69 1.000
pi(G){all} 0.466851 0.000450 0.425953 0.509315 0.466315 1188.60 1195.86 1.002
pi(T){all} 0.160594 0.000203 0.132885 0.187525 0.160227 922.19 1148.58 1.000
alpha{1,2} 0.064853 0.003857 0.000113 0.164661 0.052184 1299.89 1339.59 1.000
alpha{3} 1.505476 0.495366 0.425647 2.957427 1.359816 1501.00 1501.00 1.000
pinvar{all} 0.311574 0.017644 0.024958 0.523511 0.324855 1501.00 1501.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 2695 0.897735 0.000471 0.897402 0.898068 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.021891 0.000146 0.000471 0.043724 0.020158 1.000 2
length{all}[2] 0.013132 0.000043 0.001970 0.026249 0.012322 1.000 2
length{all}[3] 0.012894 0.000040 0.001561 0.025156 0.011944 1.000 2
length{all}[4] 0.230987 0.004397 0.123451 0.361441 0.220885 1.001 2
length{all}[5] 0.018670 0.000111 0.000534 0.038204 0.017254 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000471
Maximum standard deviation of split frequencies = 0.000471
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /------------------------------------ C2 (2)
\-----------------90----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/------- C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /---- C2 (2)
\-----+
\---- C3 (3)
|---------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 4 ls = 597
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sites with gaps or missing data are removed.
81 ambiguity characters in seq. 1
78 ambiguity characters in seq. 2
60 ambiguity characters in seq. 3
42 ambiguity characters in seq. 4
31 sites are removed. 35 36 37 38 39 40 50 51 52 57 58 59 102 103 104 105 129 169 187 188 189 190 191 192 193 194 195 196 197 198 199
Sequences read..
Counting site patterns.. 0:00
68 patterns at 168 / 168 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
66368 bytes for conP
9248 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 4, (2, 3)); MP score: 59
0.040172 0.321937 0.040925 0.021036 0.034044 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -944.729123
Iterating by ming2
Initial: fx= 944.729123
x= 0.04017 0.32194 0.04093 0.02104 0.03404 0.30000 1.30000
1 h-m-p 0.0000 0.0092 99.6213 ++++CYCCC 934.442804 4 0.0029 23 | 0/7
2 h-m-p 0.0003 0.0016 247.8328 +YYCCCC 921.256693 5 0.0011 42 | 0/7
3 h-m-p 0.0001 0.0003 236.0074 YCYCCC 920.143841 5 0.0001 60 | 0/7
4 h-m-p 0.0004 0.0018 40.0584 CCCCC 919.866035 4 0.0004 78 | 0/7
5 h-m-p 0.0003 0.0036 51.3583 YCCC 919.426544 3 0.0007 93 | 0/7
6 h-m-p 0.0003 0.0038 114.4457 YCCC 918.709376 3 0.0006 108 | 0/7
7 h-m-p 0.0036 0.0634 18.1802 +YCYYCCC 911.311611 6 0.0411 129 | 0/7
8 h-m-p 0.1930 0.9649 0.1602 YCYCCC 908.672486 5 0.5147 147 | 0/7
9 h-m-p 0.3007 8.0000 0.2742 +CYCCC 904.793876 4 1.4821 172 | 0/7
10 h-m-p 0.3984 1.9919 0.3885 CYCCCC 902.883666 5 0.7531 198 | 0/7
11 h-m-p 0.4707 2.3535 0.5118 YCCCC 899.620244 4 1.1171 222 | 0/7
12 h-m-p 1.6000 8.0000 0.2528 YYCCC 898.324533 4 2.4646 245 | 0/7
13 h-m-p 1.6000 8.0000 0.2035 CCCC 897.997209 3 1.9247 268 | 0/7
14 h-m-p 1.6000 8.0000 0.0782 CYC 897.962642 2 1.7064 288 | 0/7
15 h-m-p 1.6000 8.0000 0.0319 YC 897.960987 1 1.1795 306 | 0/7
16 h-m-p 1.6000 8.0000 0.0028 C 897.960892 0 1.3942 323 | 0/7
17 h-m-p 1.6000 8.0000 0.0003 C 897.960889 0 1.4736 340 | 0/7
18 h-m-p 1.6000 8.0000 0.0001 Y 897.960889 0 1.1593 357 | 0/7
19 h-m-p 1.6000 8.0000 0.0000 C 897.960889 0 1.6000 374 | 0/7
20 h-m-p 1.6000 8.0000 0.0000 Y 897.960889 0 0.4000 391 | 0/7
21 h-m-p 1.3584 8.0000 0.0000 ----------------.. | 0/7
22 h-m-p 0.0160 8.0000 0.0003 ------------- | 0/7
23 h-m-p 0.0160 8.0000 0.0003 -------------
Out..
lnL = -897.960889
479 lfun, 479 eigenQcodon, 2395 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 4, (2, 3)); MP score: 59
0.040172 0.321937 0.040925 0.021036 0.034044 3.297061 0.755520 0.234606
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 2.622544
np = 8
lnL0 = -895.723822
Iterating by ming2
Initial: fx= 895.723822
x= 0.04017 0.32194 0.04093 0.02104 0.03404 3.29706 0.75552 0.23461
1 h-m-p 0.0000 0.0016 28.3037 ++YCCC 895.598034 3 0.0003 28 | 0/8
2 h-m-p 0.0004 0.0104 19.5716 +YCCCC 895.144276 4 0.0031 55 | 0/8
3 h-m-p 0.0002 0.0012 180.5320 +YCCC 894.337430 3 0.0007 80 | 0/8
4 h-m-p 0.0004 0.0018 51.4282 CCCC 894.128685 3 0.0006 105 | 0/8
5 h-m-p 0.0003 0.0014 40.9822 YCCC 893.983007 3 0.0006 129 | 0/8
6 h-m-p 0.0000 0.0002 139.9838 ++ 893.743733 m 0.0002 148 | 1/8
7 h-m-p 0.0000 0.0019 244.4948 +CYCC 893.351063 3 0.0002 173 | 1/8
8 h-m-p 0.1831 8.0000 0.2737 +CCCC 893.033641 3 0.9655 198 | 1/8
9 h-m-p 1.6000 8.0000 0.0147 CCC 892.996778 2 2.0824 220 | 1/8
10 h-m-p 1.6000 8.0000 0.0183 +YC 892.953365 1 4.1778 240 | 1/8
11 h-m-p 1.1593 8.0000 0.0661 CC 892.945455 1 1.2572 260 | 1/8
12 h-m-p 1.6000 8.0000 0.0021 YC 892.945377 1 0.8718 279 | 1/8
13 h-m-p 1.6000 8.0000 0.0004 Y 892.945376 0 1.0256 297 | 1/8
14 h-m-p 1.6000 8.0000 0.0000 Y 892.945376 0 0.9630 315 | 1/8
15 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/8
16 h-m-p 0.0160 8.0000 0.0005 -------------
Out..
lnL = -892.945376
377 lfun, 1131 eigenQcodon, 3770 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 4, (2, 3)); MP score: 59
initial w for M2:NSpselection reset.
0.040172 0.321937 0.040925 0.021036 0.034044 3.537877 1.079469 0.409056 0.257593 2.430889
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 1.869573
np = 10
lnL0 = -897.752500
Iterating by ming2
Initial: fx= 897.752500
x= 0.04017 0.32194 0.04093 0.02104 0.03404 3.53788 1.07947 0.40906 0.25759 2.43089
1 h-m-p 0.0000 0.0036 32.7663 ++YCCC 897.583716 3 0.0003 32 | 0/10
2 h-m-p 0.0003 0.0057 34.9549 +CCCC 897.097618 3 0.0013 62 | 0/10
3 h-m-p 0.0003 0.0023 145.8684 YCCC 896.302961 3 0.0006 90 | 0/10
4 h-m-p 0.0004 0.0020 107.5125 YCCCC 895.350253 4 0.0009 120 | 0/10
5 h-m-p 0.0003 0.0014 68.7608 ++ 894.129027 m 0.0014 143 | 1/10
6 h-m-p 0.0086 0.9976 4.4903 ++CCCC 890.750684 3 0.1837 174 | 1/10
7 h-m-p 0.0249 0.1245 7.4252 CC 890.695695 1 0.0062 198 | 1/10
8 h-m-p 0.0350 5.5126 1.3110 +++YCCC 888.974677 3 1.7245 228 | 0/10
9 h-m-p 0.0210 0.1048 49.2762 CYC 888.894240 2 0.0036 253 | 0/10
10 h-m-p 0.1907 8.0000 0.9307 +YCCC 888.483194 3 1.3958 282 | 0/10
11 h-m-p 1.6000 8.0000 0.7544 CCC 888.241921 2 2.2632 309 | 0/10
12 h-m-p 1.6000 8.0000 0.6082 YCC 888.114975 2 1.1530 335 | 0/10
13 h-m-p 0.9034 8.0000 0.7762 YC 888.050459 1 1.8104 359 | 0/10
14 h-m-p 1.6000 8.0000 0.3140 CYC 888.036775 2 1.7191 385 | 0/10
15 h-m-p 1.6000 8.0000 0.1758 CC 888.035410 1 1.3142 410 | 0/10
16 h-m-p 1.6000 8.0000 0.0114 C 888.035246 0 1.4324 433 | 0/10
17 h-m-p 1.6000 8.0000 0.0054 +YC 888.035152 1 4.0994 458 | 0/10
18 h-m-p 1.4207 8.0000 0.0157 ++ 888.034557 m 8.0000 481 | 0/10
19 h-m-p 0.5962 8.0000 0.2109 +C 888.033058 0 2.3849 505 | 0/10
20 h-m-p 1.6000 8.0000 0.1842 +CC 888.029367 1 5.9260 531 | 0/10
21 h-m-p 1.6000 8.0000 0.2544 CC 888.028430 1 2.3526 556 | 0/10
22 h-m-p 1.6000 8.0000 0.2671 YC 888.027904 1 3.0806 580 | 0/10
23 h-m-p 1.6000 8.0000 0.5108 C 888.027676 0 1.4087 603 | 0/10
24 h-m-p 1.6000 8.0000 0.3339 C 888.027564 0 2.2400 626 | 0/10
25 h-m-p 1.6000 8.0000 0.3538 C 888.027502 0 2.3980 649 | 0/10
26 h-m-p 1.6000 8.0000 0.3448 Y 888.027476 0 2.7458 672 | 0/10
27 h-m-p 1.6000 8.0000 0.3500 C 888.027466 0 2.3438 695 | 0/10
28 h-m-p 1.6000 8.0000 0.3433 Y 888.027462 0 2.8356 718 | 0/10
29 h-m-p 1.6000 8.0000 0.3512 C 888.027460 0 2.3279 741 | 0/10
30 h-m-p 1.6000 8.0000 0.3433 Y 888.027459 0 2.8304 764 | 0/10
31 h-m-p 1.6000 8.0000 0.3397 C 888.027459 0 2.2996 787 | 0/10
32 h-m-p 1.6000 8.0000 0.3420 Y 888.027459 0 2.9361 810 | 0/10
33 h-m-p 1.6000 8.0000 0.3471 C 888.027459 0 2.2582 833 | 0/10
34 h-m-p 1.6000 8.0000 0.3126 Y 888.027459 0 2.7418 856 | 0/10
35 h-m-p 1.6000 8.0000 0.1432 C 888.027459 0 0.4000 879 | 0/10
36 h-m-p 0.2602 8.0000 0.2202 C 888.027459 0 0.2602 902 | 0/10
37 h-m-p 0.3018 8.0000 0.1899 Y 888.027459 0 0.5815 925 | 0/10
38 h-m-p 0.7074 8.0000 0.1560 +C 888.027459 0 2.8298 949 | 0/10
39 h-m-p 1.6000 8.0000 0.1400 Y 888.027459 0 3.4591 972 | 0/10
40 h-m-p 1.6000 8.0000 0.0484 C 888.027459 0 1.6000 995 | 0/10
41 h-m-p 0.1241 8.0000 0.6234 --Y 888.027459 0 0.0019 1020 | 0/10
42 h-m-p 1.6000 8.0000 0.0007 ----------------.. | 0/10
43 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -888.027459
1092 lfun, 4368 eigenQcodon, 16380 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -893.793801 S = -845.376036 -42.892761
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 68 patterns 0:08
did 20 / 68 patterns 0:08
did 30 / 68 patterns 0:08
did 40 / 68 patterns 0:08
did 50 / 68 patterns 0:08
did 60 / 68 patterns 0:08
did 68 / 68 patterns 0:08
Time used: 0:08
Model 3: discrete
TREE # 1
(1, 4, (2, 3)); MP score: 59
0.040172 0.321937 0.040925 0.021036 0.034044 3.692334 0.408838 0.998206 0.195220 0.424257 0.641842
ntime & nrate & np: 5 4 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 2.462891
np = 11
lnL0 = -897.526396
Iterating by ming2
Initial: fx= 897.526396
x= 0.04017 0.32194 0.04093 0.02104 0.03404 3.69233 0.40884 0.99821 0.19522 0.42426 0.64184
1 h-m-p 0.0000 0.0015 26.7822 ++CCCC 897.430971 3 0.0003 35 | 0/11
2 h-m-p 0.0006 0.0201 10.5563 +YC 897.333621 1 0.0020 62 | 0/11
3 h-m-p 0.0004 0.0031 53.6575 CCC 897.239793 2 0.0004 91 | 0/11
4 h-m-p 0.0010 0.0126 22.4747 CYC 897.219911 2 0.0003 119 | 0/11
5 h-m-p 0.0005 0.0169 11.6911 +YC 897.055026 1 0.0049 146 | 0/11
6 h-m-p 0.0001 0.0007 207.3051 ++ 896.255883 m 0.0007 171 | 1/11
7 h-m-p 0.0074 0.0591 8.9122 +CYCCC 895.720710 4 0.0430 205 | 1/11
8 h-m-p 0.0012 0.0059 22.1326 YCCC 895.684797 3 0.0022 234 | 1/11
9 h-m-p 0.0858 6.6606 0.5718 +CC 895.471362 1 0.5120 261 | 0/11
10 h-m-p 0.0708 0.9509 4.1369 YCCC 895.212782 3 0.1352 290 | 0/11
11 h-m-p 0.0682 0.3410 1.0980 YCCC 895.109399 3 0.1613 320 | 0/11
12 h-m-p 0.0564 0.2822 0.6817 ++ 894.926225 m 0.2822 345 | 1/11
13 h-m-p 0.0028 0.1512 66.6527 +YCCC 894.353284 3 0.0205 376 | 1/11
14 h-m-p 0.8100 8.0000 1.6878 YCCC 893.895573 3 0.4313 405 | 1/11
15 h-m-p 1.6000 8.0000 0.3225 YCCC 893.757533 3 0.6468 434 | 1/11
16 h-m-p 1.1131 8.0000 0.1874 ----------------.. | 1/11
17 h-m-p 0.0000 0.0049 71.2856 ++CYCCC 893.297083 4 0.0002 505 | 1/11
18 h-m-p 0.0005 0.0026 18.9471 YCCC 893.246926 3 0.0003 534 | 1/11
19 h-m-p 0.0005 0.0059 11.3731 YC 893.234170 1 0.0003 559 | 1/11
20 h-m-p 0.0004 0.1856 10.9925 ++YCCC 892.837953 3 0.0131 590 | 1/11
21 h-m-p 0.0013 0.0065 45.4608 CCC 892.803556 2 0.0003 618 | 1/11
22 h-m-p 0.0005 0.1302 26.6005 ++YC 891.703219 1 0.0167 645 | 1/11
23 h-m-p 0.1644 8.0000 2.7082 YCCC 890.345645 3 0.3895 674 | 0/11
24 h-m-p 0.0323 1.6490 32.6509 CCC 890.223278 2 0.0127 702 | 0/11
25 h-m-p 0.5961 7.7241 0.6960 +YYCCC 889.134293 4 3.4321 734 | 0/11
26 h-m-p 0.4984 2.4919 0.8466 +CC 888.457388 1 1.7183 762 | 0/11
27 h-m-p 0.1912 0.9561 1.1939 +CC 888.348619 1 0.7108 790 | 0/11
28 h-m-p 0.0305 0.1523 1.2216 ++ 888.316083 m 0.1523 815 | 1/11
29 h-m-p 0.0871 8.0000 1.9994 ++CYC 888.055280 2 1.6863 845 | 1/11
30 h-m-p 1.6000 8.0000 0.4905 YCC 888.035292 2 1.1716 872 | 1/11
31 h-m-p 1.6000 8.0000 0.1977 YC 888.029020 1 1.0383 897 | 1/11
32 h-m-p 0.9112 8.0000 0.2253 YC 888.027472 1 1.7543 922 | 1/11
33 h-m-p 1.6000 8.0000 0.0019 Y 888.027462 0 1.1122 946 | 1/11
34 h-m-p 1.6000 8.0000 0.0011 C 888.027461 0 1.6964 970 | 1/11
35 h-m-p 1.6000 8.0000 0.0002 C 888.027461 0 1.8166 994 | 1/11
36 h-m-p 1.6000 8.0000 0.0000 C 888.027461 0 1.6000 1018 | 1/11
37 h-m-p 1.3930 8.0000 0.0001 Y 888.027461 0 1.0290 1042 | 1/11
38 h-m-p 1.6000 8.0000 0.0000 Y 888.027461 0 0.9362 1066 | 0/11
39 h-m-p 0.0927 8.0000 0.0002 --------------.. | 1/11
40 h-m-p 0.0160 8.0000 0.0001 --Y 888.027461 0 0.0003 1129
Out..
lnL = -888.027461
1130 lfun, 4520 eigenQcodon, 16950 P(t)
Time used: 0:14
Model 7: beta
TREE # 1
(1, 4, (2, 3)); MP score: 59
0.040172 0.321937 0.040925 0.021036 0.034044 3.692336 0.996708 1.805788
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 2.553305
np = 8
lnL0 = -896.454889
Iterating by ming2
Initial: fx= 896.454889
x= 0.04017 0.32194 0.04093 0.02104 0.03404 3.69234 0.99671 1.80579
1 h-m-p 0.0000 0.0014 28.0215 ++CCCC 896.350893 3 0.0003 29 | 0/8
2 h-m-p 0.0006 0.0148 10.8211 YC 896.289724 1 0.0012 49 | 0/8
3 h-m-p 0.0003 0.0032 39.0896 CCC 896.223075 2 0.0004 72 | 0/8
4 h-m-p 0.0010 0.0160 14.9223 CCC 896.211933 2 0.0002 95 | 0/8
5 h-m-p 0.0015 0.0212 2.3390 C 896.210919 0 0.0004 114 | 0/8
6 h-m-p 0.0018 0.9001 1.1912 +++CYCCC 896.080816 4 0.1973 143 | 0/8
7 h-m-p 0.1755 1.2744 1.3386 +YYYYYYYYCC 895.428579 10 0.7586 174 | 0/8
8 h-m-p 0.0129 0.0647 12.8055 CYCYCC 895.295678 5 0.0225 201 | 0/8
9 h-m-p 0.0728 0.3638 2.5385 +YCYCYYCYC 893.639960 8 0.3524 233 | 0/8
10 h-m-p 0.0035 0.0173 1.2144 YYYCYC 893.634835 5 0.0061 259 | 0/8
11 h-m-p 0.0063 0.0501 1.1873 ++ 893.544124 m 0.0501 278 | 1/8
12 h-m-p 0.0005 0.0026 43.3254 CCYYC 893.512710 4 0.0006 303 | 1/8
13 h-m-p 0.0288 1.9747 0.8480 --------------.. | 1/8
14 h-m-p 0.0000 0.0074 21.4226 +YYYYYY 893.508907 5 0.0001 357 | 1/8
15 h-m-p 0.0005 0.0124 2.6284 YC 893.508012 1 0.0003 376 | 1/8
16 h-m-p 0.0009 0.4327 2.9855 CC 893.504813 1 0.0013 396 | 1/8
17 h-m-p 0.0003 0.0315 12.2754 +CC 893.493214 1 0.0012 417 | 1/8
18 h-m-p 0.0006 0.0158 25.3009 CC 893.483603 1 0.0005 437 | 1/8
19 h-m-p 0.0011 0.0264 11.3968 YC 893.478821 1 0.0006 456 | 1/8
20 h-m-p 0.0030 1.4894 15.7645 ++CYCC 892.971272 3 0.0541 481 | 1/8
21 h-m-p 1.6000 8.0000 0.0179 YC 892.967245 1 1.1195 500 | 1/8
22 h-m-p 1.6000 8.0000 0.0054 C 892.967204 0 1.4164 518 | 1/8
23 h-m-p 1.6000 8.0000 0.0007 Y 892.967203 0 1.1346 536 | 1/8
24 h-m-p 1.6000 8.0000 0.0000 ++ 892.967203 m 8.0000 554 | 1/8
25 h-m-p 0.8971 8.0000 0.0000 +C 892.967203 0 3.6407 573 | 1/8
26 h-m-p 1.6000 8.0000 0.0000 ++ 892.967202 m 8.0000 591 | 1/8
27 h-m-p 1.6000 8.0000 0.0001 Y 892.967202 0 1.2774 609 | 1/8
28 h-m-p 1.6000 8.0000 0.0000 C 892.967202 0 1.6000 627 | 1/8
29 h-m-p 1.6000 8.0000 0.0000 Y 892.967202 0 0.7372 645 | 1/8
30 h-m-p 1.6000 8.0000 0.0000 Y 892.967202 0 0.4000 663 | 1/8
31 h-m-p 0.1519 8.0000 0.0000 ---------------.. | 1/8
32 h-m-p 0.0160 8.0000 0.0000 C 892.967202 0 0.0040 712 | 1/8
33 h-m-p 0.0160 8.0000 0.0000 ---C 892.967202 0 0.0001 733
Out..
lnL = -892.967202
734 lfun, 8074 eigenQcodon, 36700 P(t)
Time used: 0:26
Model 8: beta&w>1
TREE # 1
(1, 4, (2, 3)); MP score: 59
initial w for M8:NSbetaw>1 reset.
0.040172 0.321937 0.040925 0.021036 0.034044 3.554108 0.900000 0.709770 1.329016 2.821721
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 2.199040
np = 10
lnL0 = -893.587169
Iterating by ming2
Initial: fx= 893.587169
x= 0.04017 0.32194 0.04093 0.02104 0.03404 3.55411 0.90000 0.70977 1.32902 2.82172
1 h-m-p 0.0000 0.0023 29.8678 ++YC 893.429031 1 0.0004 28 | 0/10
2 h-m-p 0.0004 0.0042 29.9934 YCCC 893.183815 3 0.0009 56 | 0/10
3 h-m-p 0.0004 0.0026 61.5422 YCCC 893.033038 3 0.0003 84 | 0/10
4 h-m-p 0.0008 0.0047 25.8957 YCC 892.958440 2 0.0005 110 | 0/10
5 h-m-p 0.0013 0.0265 10.0201 YCCC 892.860312 3 0.0028 138 | 0/10
6 h-m-p 0.0003 0.0088 92.3892 +YCCC 892.312714 3 0.0021 167 | 0/10
7 h-m-p 0.0024 0.0119 47.4171 ++ 889.777199 m 0.0119 190 | 0/10
8 h-m-p 0.7176 8.0000 0.7843 CYCC 889.260856 3 0.9247 218 | 0/10
9 h-m-p 0.1481 0.7407 0.5541 +YCCC 889.172495 3 0.3985 247 | 0/10
10 h-m-p 0.0826 0.8396 2.6744 +YYYCC 888.851854 4 0.3069 276 | 0/10
11 h-m-p 1.0539 5.2693 0.6085 CCCCC 888.625733 4 1.4297 307 | 0/10
12 h-m-p 1.6000 8.0000 0.4897 YCCC 888.457383 3 0.7743 335 | 0/10
13 h-m-p 0.5074 8.0000 0.7474 +YCCCCC 888.250410 5 2.4922 368 | 0/10
14 h-m-p 1.6000 8.0000 0.6916 YCC 888.155568 2 1.0347 394 | 0/10
15 h-m-p 0.8334 8.0000 0.8588 YCCC 888.105527 3 1.6314 422 | 0/10
16 h-m-p 1.6000 8.0000 0.3154 C 888.090598 0 1.5991 445 | 0/10
17 h-m-p 1.6000 8.0000 0.2400 YCC 888.087910 2 1.2105 471 | 0/10
18 h-m-p 1.6000 8.0000 0.0192 C 888.087230 0 1.6995 494 | 0/10
19 h-m-p 1.6000 8.0000 0.0180 ++ 888.086303 m 8.0000 517 | 0/10
20 h-m-p 1.6000 8.0000 0.0404 ++ 888.080992 m 8.0000 540 | 0/10
21 h-m-p 0.6158 8.0000 0.5248 +YCC 888.066842 2 3.8617 567 | 0/10
22 h-m-p 1.6000 8.0000 0.5773 CCC 888.055498 2 2.0811 594 | 0/10
23 h-m-p 1.2743 8.0000 0.9427 YC 888.049245 1 2.1368 618 | 0/10
24 h-m-p 1.6000 8.0000 1.1316 +YC 888.041948 1 4.2816 643 | 0/10
25 h-m-p 1.6000 8.0000 1.8182 CC 888.038165 1 2.4006 668 | 0/10
26 h-m-p 1.6000 8.0000 2.4516 YC 888.035292 1 3.8577 692 | 0/10
27 h-m-p 1.6000 8.0000 3.9355 CC 888.033529 1 2.3062 717 | 0/10
28 h-m-p 1.6000 8.0000 5.4086 YC 888.032249 1 3.1727 741 | 0/10
29 h-m-p 1.1561 5.7805 8.3661 YC 888.031342 1 2.5525 765 | 0/10
30 h-m-p 0.4933 2.4664 10.9497 ++ 888.030721 m 2.4664 788 | 1/10
31 h-m-p 0.4914 8.0000 9.0700 -------------C 888.030721 0 0.0000 824 | 1/10
32 h-m-p 0.0160 8.0000 0.0108 +++Y 888.030699 0 0.8079 849 | 1/10
33 h-m-p 1.6000 8.0000 0.0031 C 888.030698 0 0.5425 871 | 1/10
34 h-m-p 1.6000 8.0000 0.0009 ------C 888.030698 0 0.0001 899
Out..
lnL = -888.030698
900 lfun, 10800 eigenQcodon, 49500 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -892.865859 S = -845.380018 -42.718380
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 68 patterns 0:43
did 20 / 68 patterns 0:43
did 30 / 68 patterns 0:43
did 40 / 68 patterns 0:43
did 50 / 68 patterns 0:43
did 60 / 68 patterns 0:43
did 68 / 68 patterns 0:44
Time used: 0:44
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=199
D_melanogaster_CG5172-PD MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGG---GGYGGGGGG-
D_sechellia_CG5172-PD MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGG------GGYGGGGGG-
D_simulans_CG5172-PD MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGGGGGGQSGYGGGGGG-
D_yakuba_CG5172-PD MRRAVILVFVCCLLIAVASAGLLGGGGGGGGYGGGGGGGQGGYGGGGGGG
**:*************::***** ********** .********
D_melanogaster_CG5172-PD --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
D_sechellia_CG5172-PD --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
D_simulans_CG5172-PD --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG
D_yakuba_CG5172-PD GGQGGWQKNGGGGGGHGGGGHGGGGQGGYGGGSQGGHGGGGQGGWQKNGG
*.*: **** :***********.**********************
D_melanogaster_CG5172-PD G----GGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
D_sechellia_CG5172-PD GGHGGGGKGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
D_simulans_CG5172-PD GGHGGGGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW
D_yakuba_CG5172-PD GGHGGGGQGGYGGGNQGGHGGQGGYGGG-QGGGGHASKSLAGNRGSSVSW
* **:******************** :********************
D_melanogaster_CG5172-PD QGGNGGNKNGGGGGGGGG-LYGGGGGGGGKQHGGGWooooooooooooo
D_sechellia_CG5172-PD QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGWoooooooooooo-
D_simulans_CG5172-PD QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGWoooooo-------
D_yakuba_CG5172-PD QGGNGGNKHGGGGGGGGGGLYGGGGGGGGKQHGGGW-------------
********:********* *****************
>D_melanogaster_CG5172-PD ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCCTGCTGATCGCCTT AACCTCAGCCGGTTTGCTGGGCGGTGGAGGCGGTGGTGGTGGCTACGGCG GTGGTGGTGGT---------GGTGGCTACGGCGGTGGTGGTGGTGGT--- ------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAACGG AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGAGGCGGTAGCC AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA GGT------------GGTGGACAAGGAGGCTATGGAGGTGGCAATCAAGG TGGCCACGGAGGACAAGGAGGTTATGGCGGCGGCGGTCATGGAGGCGGTG GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG CAGGGCGGAAATGGAGGCAACAAGAACGGAGGCGGCGGAGGAGGTGGTGG TGGC---CTGTACGGTGGTGGTGGCGGTGGAGGTGGCAAACAACATGGCG GTGGCTGG--------------------------------------- >D_sechellia_CG5172-PD ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCTTGCTGATCGCCGT GGCCTCAGCCGGTTTGCTGACCGGTGGAGGTGGTGGTGGTGGCTACGGCG GT------------------GGTGGCTACGGCGGTGGTGGTGGTGGT--- ------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAATGG AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGCGGCGGTAGCC AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA GGTGGTCATGGAGGTGGTGGAAAAGGAGGCTATGGAGGTGGAAACCAAGG TGGCCACGGAGGACAAGGAGGCTATGGCGGTGGTGGCCATGGAGGCGGTG GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG CAGGGCGGAAATGGAGGCAACAAGCACGGTGGCGGCGGAGGAGGTGGTGG TGGC---CTGTACGGTGGTGGTGGCGGTGGAGGTGGCAAACAACATGGCG GTGGCTGG--------------------------------------- >D_simulans_CG5172-PD ATGCGTCACGCTGTGATCCTTGTTTTCGTGTGTTGCTTGCTGATCGCCGT GGCCTCAGCCGGTTTGCTGACCGGTGGAGGTGGTGGTGGTGGCTACGGCG GTGGTGGTGGTGGTGGTCAGAGCGGCTACGGCGGTGGTGGTGGTGGT--- ------CAGAGCGGCTAC---------GGCGGCGGTGGCCAAAAGAACGG AGGAGGCGGCCATGGAGGTGGCGGCCAGGGAAGCTACGGCGGCGGTAGCC AAGGTGGACATGGAGGCGGTGGCCAAGGAGGTTGGCAGAAGAACGGAGGA GGTGGTCATGGAGGTGGTGGACAAGGAGGCTACGGAGGTGGCAACCAAGG TGGCCACGGAGGACAAGGAGGCTACGGCGGTGGCGGTCATGGAGGCGGTG GCCATGCAAGCAAGTCCTTGGCCGGCAATCGCGGTAGTTCCGTGTCCTGG CAGGGCGGAAATGGAGGCAACAAGCACGGTGGCGGCGGAGGAGGTGGTGG TGGC---CTGTACGGTGGTGGTGGCGGCGGAGGTGGCAAACAACATGGCG GTGGCTGG--------------------------------------- >D_yakuba_CG5172-PD ATGCGTCGCGCTGTAATCCTTGTGTTCGTGTGCTGCCTGCTGATCGCCGT GGCTTCGGCTGGCTTGCTGGGCGGTGGAGGCGGTGGTGGTGGCTACGGCG GCGGTGGTGGCGGTGGTCAGGGTGGCTACGGCGGTGGTGGCGGAGGAGGC GGTGGTCAAGGCGGCTGGCAGAAGAACGGAGGAGGCGGCGGTGGCCATGG AGGTGGTGGTCATGGAGGTGGCGGCCAGGGAGGCTACGGCGGCGGTAGCC AAGGTGGACATGGAGGCGGGGGCCAAGGAGGCTGGCAGAAGAACGGAGGA GGCGGCCATGGAGGCGGTGGACAAGGAGGCTACGGAGGTGGCAATCAAGG TGGCCACGGAGGACAAGGAGGCTATGGCGGCGGA---CAAGGAGGCGGTG GCCATGCCAGCAAGTCCTTGGCCGGCAATCGCGGCAGTTCCGTGTCCTGG CAGGGCGGAAATGGAGGCAACAAGCACGGAGGCGGCGGCGGAGGAGGTGG TGGTGGCCTGTACGGCGGTGGCGGCGGTGGAGGTGGCAAACAGCACGGCG GTGGCTGG---------------------------------------
>D_melanogaster_CG5172-PD MRHAVILVFVCCLLIALTSAGLLGGGGGGGGYGGGGG---GGYGGGGGG- --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG G----GGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW QGGNGGNKNGGGGGGGGG-LYGGGGGGGGKQHGGGW >D_sechellia_CG5172-PD MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGG------GGYGGGGGG- --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG GGHGGGGKGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGW >D_simulans_CG5172-PD MRHAVILVFVCCLLIAVASAGLLTGGGGGGGYGGGGGGGQSGYGGGGGG- --QSGY---GGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKNGG GGHGGGGQGGYGGGNQGGHGGQGGYGGGGHGGGGHASKSLAGNRGSSVSW QGGNGGNKHGGGGGGGGG-LYGGGGGGGGKQHGGGW >D_yakuba_CG5172-PD MRRAVILVFVCCLLIAVASAGLLGGGGGGGGYGGGGGGGQGGYGGGGGGG GGQGGWQKNGGGGGGHGGGGHGGGGQGGYGGGSQGGHGGGGQGGWQKNGG GGHGGGGQGGYGGGNQGGHGGQGGYGGG-QGGGGHASKSLAGNRGSSVSW QGGNGGNKHGGGGGGGGGGLYGGGGGGGGKQHGGGW
#NEXUS
[ID: 2014305490]
begin taxa;
dimensions ntax=4;
taxlabels
D_melanogaster_CG5172-PD
D_sechellia_CG5172-PD
D_simulans_CG5172-PD
D_yakuba_CG5172-PD
;
end;
begin trees;
translate
1 D_melanogaster_CG5172-PD,
2 D_sechellia_CG5172-PD,
3 D_simulans_CG5172-PD,
4 D_yakuba_CG5172-PD
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02015844,4:0.2208849,(2:0.01232246,3:0.01194411)0.898:0.01725368);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02015844,4:0.2208849,(2:0.01232246,3:0.01194411):0.01725368);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1035.92 -1044.26
2 -1035.96 -1043.89
--------------------------------------
TOTAL -1035.94 -1044.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/166/CG5172-PD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.296314 0.005023 0.177940 0.435425 0.286058 1098.03 1229.73 1.001
r(A<->C){all} 0.138782 0.003262 0.034008 0.248868 0.132041 808.73 849.64 1.000
r(A<->G){all} 0.086346 0.000991 0.035768 0.153983 0.081752 973.27 974.56 1.000
r(A<->T){all} 0.107468 0.002986 0.005152 0.207251 0.102866 733.34 803.64 1.000
r(C<->G){all} 0.013681 0.000107 0.000005 0.032937 0.011321 1100.05 1214.25 1.000
r(C<->T){all} 0.635538 0.005972 0.485295 0.781848 0.639666 689.59 727.72 1.000
r(G<->T){all} 0.018185 0.000181 0.000053 0.044197 0.015610 817.34 941.24 1.001
pi(A){all} 0.173761 0.000236 0.144738 0.205147 0.173821 1127.93 1271.42 1.002
pi(C){all} 0.198794 0.000245 0.167595 0.228583 0.198441 1184.73 1321.69 1.000
pi(G){all} 0.466851 0.000450 0.425953 0.509315 0.466315 1188.60 1195.86 1.002
pi(T){all} 0.160594 0.000203 0.132885 0.187525 0.160227 922.19 1148.58 1.000
alpha{1,2} 0.064853 0.003857 0.000113 0.164661 0.052184 1299.89 1339.59 1.000
alpha{3} 1.505476 0.495366 0.425647 2.957427 1.359816 1501.00 1501.00 1.000
pinvar{all} 0.311574 0.017644 0.024958 0.523511 0.324855 1501.00 1501.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/166/CG5172-PD/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 168
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 | Ser TCT 0 0 0 0 | Tyr TAT 2 2 0 1 | Cys TGT 1 1 1 0
TTC 1 1 1 1 | TCC 3 3 3 3 | TAC 5 5 7 5 | TGC 1 1 1 2
Leu TTA 1 0 0 0 | TCA 1 1 1 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 2 3 3 2 | TCG 0 0 0 1 | TAG 0 0 0 0 | Trp TGG 3 3 3 4
------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 | Pro CCT 0 0 0 0 | His CAT 5 5 5 4 | Arg CGT 1 1 1 1
CTC 0 0 0 0 | CCC 0 0 0 0 | CAC 2 3 3 3 | CGC 1 1 1 2
CTA 0 0 0 0 | CCA 0 0 0 0 | Gln CAA 7 6 7 7 | CGA 0 0 0 0
CTG 4 3 3 4 | CCG 0 0 0 0 | CAG 4 4 4 4 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 | Thr ACT 0 0 0 0 | Asn AAT 3 3 2 3 | Ser AGT 1 1 1 1
ATC 2 2 2 2 | ACC 1 1 1 0 | AAC 4 3 4 2 | AGC 4 4 5 2
ATA 0 0 0 0 | ACA 0 0 0 0 | Lys AAA 1 2 1 1 | Arg AGA 0 0 0 0
Met ATG 1 1 1 1 | ACG 0 0 0 0 | AAG 4 4 4 3 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 0 | Ala GCT 1 1 1 3 | Asp GAT 0 0 0 0 | Gly GGT 34 37 34 25
GTC 0 0 0 0 | GCC 3 4 4 3 | GAC 0 0 0 0 | GGC 35 32 35 44
GTA 0 0 0 1 | GCA 1 1 1 0 | Glu GAA 0 0 0 0 | GGA 24 23 22 27
GTG 3 4 4 4 | GCG 0 0 0 0 | GAG 0 0 0 0 | GGG 0 0 0 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG5172-PD
position 1: T:0.11905 C:0.14881 A:0.12500 G:0.60714
position 2: T:0.09524 C:0.05952 A:0.22024 G:0.62500
position 3: T:0.29762 C:0.36905 A:0.20833 G:0.12500
Average T:0.17063 C:0.19246 A:0.18452 G:0.45238
#2: D_sechellia_CG5172-PD
position 1: T:0.11905 C:0.14286 A:0.12500 G:0.61310
position 2: T:0.09524 C:0.06548 A:0.22024 G:0.61905
position 3: T:0.31548 C:0.35714 A:0.19643 G:0.13095
Average T:0.17659 C:0.18849 A:0.18056 G:0.45437
#3: D_simulans_CG5172-PD
position 1: T:0.11905 C:0.14881 A:0.12500 G:0.60714
position 2: T:0.09524 C:0.06548 A:0.22024 G:0.61905
position 3: T:0.27976 C:0.39881 A:0.19048 G:0.13095
Average T:0.16468 C:0.20437 A:0.17857 G:0.45238
#4: D_yakuba_CG5172-PD
position 1: T:0.11310 C:0.15476 A:0.08929 G:0.64286
position 2: T:0.09524 C:0.05952 A:0.19643 G:0.64881
position 3: T:0.23214 C:0.41071 A:0.21429 G:0.14286
Average T:0.14683 C:0.20833 A:0.16667 G:0.47817
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 5 | Cys C TGT 3
TTC 4 | TCC 12 | TAC 22 | TGC 5
Leu L TTA 1 | TCA 3 | *** * TAA 0 | *** * TGA 0
TTG 10 | TCG 1 | TAG 0 | Trp W TGG 13
------------------------------------------------------------------------------
Leu L CTT 4 | Pro P CCT 0 | His H CAT 19 | Arg R CGT 4
CTC 0 | CCC 0 | CAC 11 | CGC 5
CTA 0 | CCA 0 | Gln Q CAA 27 | CGA 0
CTG 14 | CCG 0 | CAG 16 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 11 | Ser S AGT 4
ATC 8 | ACC 3 | AAC 13 | AGC 15
ATA 0 | ACA 0 | Lys K AAA 5 | Arg R AGA 0
Met M ATG 4 | ACG 0 | AAG 15 | AGG 0
------------------------------------------------------------------------------
Val V GTT 3 | Ala A GCT 6 | Asp D GAT 0 | Gly G GGT 130
GTC 0 | GCC 14 | GAC 0 | GGC 146
GTA 1 | GCA 3 | Glu E GAA 0 | GGA 96
GTG 15 | GCG 0 | GAG 0 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11756 C:0.14881 A:0.11607 G:0.61756
position 2: T:0.09524 C:0.06250 A:0.21429 G:0.62798
position 3: T:0.28125 C:0.38393 A:0.20238 G:0.13244
Average T:0.16468 C:0.19841 A:0.17758 G:0.45933
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG5172-PD
D_sechellia_CG5172-PD 0.2002 (0.0167 0.0832)
D_simulans_CG5172-PD 0.1818 (0.0166 0.0915) 0.1055 (0.0055 0.0521)
D_yakuba_CG5172-PD 0.1349 (0.0431 0.3193) 0.1258 (0.0430 0.3420) 0.1174 (0.0430 0.3660)
Model 0: one-ratio
TREE # 1: (1, 4, (2, 3)); MP score: 59
check convergence..
lnL(ntime: 5 np: 7): -897.960889 +0.000000
5..1 5..4 5..6 6..2 6..3
0.038616 0.342010 0.038798 0.021953 0.028854 3.297061 0.390441
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.47023
(1: 0.038616, 4: 0.342010, (2: 0.021953, 3: 0.028854): 0.038798);
(D_melanogaster_CG5172-PD: 0.038616, D_yakuba_CG5172-PD: 0.342010, (D_sechellia_CG5172-PD: 0.021953, D_simulans_CG5172-PD: 0.028854): 0.038798);
Detailed output identifying parameters
kappa (ts/tv) = 3.29706
omega (dN/dS) = 0.39044
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.039 266.9 237.1 0.3904 0.0074 0.0190 2.0 4.5
5..4 0.342 266.9 237.1 0.3904 0.0657 0.1683 17.5 39.9
5..6 0.039 266.9 237.1 0.3904 0.0075 0.0191 2.0 4.5
6..2 0.022 266.9 237.1 0.3904 0.0042 0.0108 1.1 2.6
6..3 0.029 266.9 237.1 0.3904 0.0055 0.0142 1.5 3.4
tree length for dN: 0.0904
tree length for dS: 0.2315
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 59
check convergence..
lnL(ntime: 5 np: 8): -892.945376 +0.000000
5..1 5..4 5..6 6..2 6..3
0.040764 0.373301 0.036730 0.021937 0.028578 3.537877 0.681679 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.50131
(1: 0.040764, 4: 0.373301, (2: 0.021937, 3: 0.028578): 0.036730);
(D_melanogaster_CG5172-PD: 0.040764, D_yakuba_CG5172-PD: 0.373301, (D_sechellia_CG5172-PD: 0.021937, D_simulans_CG5172-PD: 0.028578): 0.036730);
Detailed output identifying parameters
kappa (ts/tv) = 3.53788
dN/dS (w) for site classes (K=2)
p: 0.68168 0.31832
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.041 266.7 237.3 0.3183 0.0068 0.0213 1.8 5.0
5..4 0.373 266.7 237.3 0.3183 0.0620 0.1946 16.5 46.2
5..6 0.037 266.7 237.3 0.3183 0.0061 0.0192 1.6 4.5
6..2 0.022 266.7 237.3 0.3183 0.0036 0.0114 1.0 2.7
6..3 0.029 266.7 237.3 0.3183 0.0047 0.0149 1.3 3.5
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 59
check convergence..
lnL(ntime: 5 np: 10): -888.027459 +0.000000
5..1 5..4 5..6 6..2 6..3
0.051068 0.444129 0.039022 0.025895 0.032318 3.692334 0.941615 0.000000 0.137846 10.079732
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.59243
(1: 0.051068, 4: 0.444129, (2: 0.025895, 3: 0.032318): 0.039022);
(D_melanogaster_CG5172-PD: 0.051068, D_yakuba_CG5172-PD: 0.444129, (D_sechellia_CG5172-PD: 0.025895, D_simulans_CG5172-PD: 0.032318): 0.039022);
Detailed output identifying parameters
kappa (ts/tv) = 3.69233
dN/dS (w) for site classes (K=3)
p: 0.94161 0.00000 0.05839
w: 0.13785 1.00000 10.07973
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.051 266.5 237.5 0.7183 0.0144 0.0200 3.8 4.7
5..4 0.444 266.5 237.5 0.7183 0.1250 0.1740 33.3 41.3
5..6 0.039 266.5 237.5 0.7183 0.0110 0.0153 2.9 3.6
6..2 0.026 266.5 237.5 0.7183 0.0073 0.0101 1.9 2.4
6..3 0.032 266.5 237.5 0.7183 0.0091 0.0127 2.4 3.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.611 6.215
24 G 0.997** 10.050
35 G 0.525 5.354
47 Y 0.966* 9.742
52 Q 0.995** 10.028
53 K 0.996** 10.044
92 Q 0.524 5.343
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.501 4.132 +- 3.852
24 G 0.944 7.464 +- 2.621
47 Y 0.800 6.391 +- 3.370
52 Q 0.929 7.355 +- 2.726
53 K 0.937 7.399 +- 2.672
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.581 0.321 0.083 0.013 0.002 0.000 0.000 0.000 0.000 0.000
w2: 0.005 0.017 0.039 0.064 0.092 0.119 0.143 0.162 0.176 0.184
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.005
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.026
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.042 0.086
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.024 0.151 0.144
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.003 0.017 0.080 0.273 0.131
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 3: discrete (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 59
lnL(ntime: 5 np: 11): -888.027461 +0.000000
5..1 5..4 5..6 6..2 6..3
0.051068 0.444129 0.039022 0.025895 0.032318 3.692336 0.000065 0.941550 0.000001 0.137856 10.079828
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.59243
(1: 0.051068, 4: 0.444129, (2: 0.025895, 3: 0.032318): 0.039022);
(D_melanogaster_CG5172-PD: 0.051068, D_yakuba_CG5172-PD: 0.444129, (D_sechellia_CG5172-PD: 0.025895, D_simulans_CG5172-PD: 0.032318): 0.039022);
Detailed output identifying parameters
kappa (ts/tv) = 3.69234
dN/dS (w) for site classes (K=3)
p: 0.00006 0.94155 0.05838
w: 0.00000 0.13786 10.07983
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.051 266.5 237.5 0.7183 0.0144 0.0200 3.8 4.7
5..4 0.444 266.5 237.5 0.7183 0.1250 0.1740 33.3 41.3
5..6 0.039 266.5 237.5 0.7183 0.0110 0.0153 2.9 3.6
6..2 0.026 266.5 237.5 0.7183 0.0073 0.0101 1.9 2.4
6..3 0.032 266.5 237.5 0.7183 0.0091 0.0127 2.4 3.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.611 6.215
24 G 0.997** 10.051
35 G 0.525 5.354
47 Y 0.966* 9.742
52 Q 0.995** 10.028
53 K 0.996** 10.045
92 Q 0.524 5.343
Time used: 0:14
Model 7: beta (10 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 59
lnL(ntime: 5 np: 8): -892.967202 +0.000000
5..1 5..4 5..6 6..2 6..3
0.040622 0.373862 0.036496 0.021821 0.028416 3.554108 0.005000 0.011679
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.50122
(1: 0.040622, 4: 0.373862, (2: 0.021821, 3: 0.028416): 0.036496);
(D_melanogaster_CG5172-PD: 0.040622, D_yakuba_CG5172-PD: 0.373862, (D_sechellia_CG5172-PD: 0.021821, D_simulans_CG5172-PD: 0.028416): 0.036496);
Detailed output identifying parameters
kappa (ts/tv) = 3.55411
Parameters in M7 (beta):
p = 0.00500 q = 0.01168
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.041 266.7 237.3 0.3000 0.0065 0.0215 1.7 5.1
5..4 0.374 266.7 237.3 0.3000 0.0594 0.1979 15.8 47.0
5..6 0.036 266.7 237.3 0.3000 0.0058 0.0193 1.5 4.6
6..2 0.022 266.7 237.3 0.3000 0.0035 0.0116 0.9 2.7
6..3 0.028 266.7 237.3 0.3000 0.0045 0.0150 1.2 3.6
Time used: 0:26
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 59
lnL(ntime: 5 np: 10): -888.030698 +0.000000
5..1 5..4 5..6 6..2 6..3
0.051190 0.443530 0.038989 0.025923 0.032381 3.677485 0.942944 16.601291 99.000000 10.293419
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.59201
(1: 0.051190, 4: 0.443530, (2: 0.025923, 3: 0.032381): 0.038989);
(D_melanogaster_CG5172-PD: 0.051190, D_yakuba_CG5172-PD: 0.443530, (D_sechellia_CG5172-PD: 0.025923, D_simulans_CG5172-PD: 0.032381): 0.038989);
Detailed output identifying parameters
kappa (ts/tv) = 3.67748
Parameters in M8 (beta&w>1):
p0 = 0.94294 p = 16.60129 q = 99.00000
(p1 = 0.05706) w = 10.29342
dN/dS (w) for site classes (K=11)
p: 0.09429 0.09429 0.09429 0.09429 0.09429 0.09429 0.09429 0.09429 0.09429 0.09429 0.05706
w: 0.09390 0.11017 0.12061 0.12935 0.13750 0.14566 0.15436 0.16437 0.17737 0.20035 10.29342
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.051 266.6 237.4 0.7225 0.0144 0.0200 3.9 4.7
5..4 0.444 266.6 237.4 0.7225 0.1252 0.1733 33.4 41.1
5..6 0.039 266.6 237.4 0.7225 0.0110 0.0152 2.9 3.6
6..2 0.026 266.6 237.4 0.7225 0.0073 0.0101 2.0 2.4
6..3 0.032 266.6 237.4 0.7225 0.0091 0.0127 2.4 3.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.597 6.202
24 G 0.997** 10.260
35 G 0.511 5.333
47 Y 0.961* 9.899
52 Q 0.994** 10.234
53 K 0.996** 10.252
92 Q 0.507 5.293
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.533 4.383 +- 4.009
24 G 0.969* 7.734 +- 2.428
47 Y 0.859 6.897 +- 3.205
52 Q 0.959* 7.658 +- 2.522
53 K 0.966* 7.703 +- 2.458
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.112 0.883
p : 0.452 0.310 0.144 0.058 0.022 0.009 0.004 0.002 0.001 0.000
q : 0.001 0.029 0.059 0.077 0.093 0.111 0.129 0.148 0.167 0.186
ws: 0.004 0.015 0.034 0.056 0.084 0.115 0.144 0.169 0.185 0.194
Time used: 0:44
Model 1: NearlyNeutral -892.945376
Model 2: PositiveSelection -888.027459
Model 0: one-ratio -897.960889
Model 3: discrete -888.027461
Model 7: beta -892.967202
Model 8: beta&w>1 -888.030698
Model 0 vs 1 10.031025999999883
Model 2 vs 1 9.835833999999977
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.611 6.215
24 G 0.997** 10.050
35 G 0.525 5.354
47 Y 0.966* 9.742
52 Q 0.995** 10.028
53 K 0.996** 10.044
92 Q 0.524 5.343
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.501 4.132 +- 3.852
24 G 0.944 7.464 +- 2.621
47 Y 0.800 6.391 +- 3.370
52 Q 0.929 7.355 +- 2.726
53 K 0.937 7.399 +- 2.672
Model 8 vs 7 9.873008000000027
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.597 6.202
24 G 0.997** 10.260
35 G 0.511 5.333
47 Y 0.961* 9.899
52 Q 0.994** 10.234
53 K 0.996** 10.252
92 Q 0.507 5.293
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5172-PD)
Pr(w>1) post mean +- SE for w
17 L 0.533 4.383 +- 4.009
24 G 0.969* 7.734 +- 2.428
47 Y 0.859 6.897 +- 3.205
52 Q 0.959* 7.658 +- 2.522
53 K 0.966* 7.703 +- 2.458
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
