--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 08 15:40:22 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/166/CG5157-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1333.88 -1345.39
2 -1333.57 -1343.99
--------------------------------------
TOTAL -1333.71 -1344.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.782904 0.008735 0.609100 0.966890 0.775981 1480.48 1490.74 1.000
r(A<->C){all} 0.072984 0.000483 0.033537 0.117809 0.070899 1158.01 1158.66 1.000
r(A<->G){all} 0.271650 0.002069 0.186489 0.364233 0.269257 640.36 745.49 1.000
r(A<->T){all} 0.148092 0.001407 0.077244 0.220917 0.145749 818.40 909.47 1.000
r(C<->G){all} 0.131101 0.000789 0.079258 0.186107 0.129670 614.63 825.78 1.001
r(C<->T){all} 0.323568 0.002656 0.226810 0.425021 0.320781 742.61 826.80 1.000
r(G<->T){all} 0.052605 0.000597 0.009429 0.101796 0.049546 1020.94 1029.90 1.001
pi(A){all} 0.290388 0.000488 0.246440 0.332570 0.290917 1191.03 1295.76 1.000
pi(C){all} 0.280306 0.000461 0.241257 0.324293 0.280062 874.68 1049.33 1.000
pi(G){all} 0.257499 0.000437 0.215769 0.296684 0.257256 1137.64 1162.26 1.000
pi(T){all} 0.171806 0.000323 0.135921 0.206246 0.171047 1130.54 1162.26 1.000
alpha{1,2} 0.275464 0.006078 0.153402 0.426597 0.261891 1501.00 1501.00 1.000
alpha{3} 1.914358 0.495246 0.816722 3.375295 1.781559 1363.06 1432.03 1.001
pinvar{all} 0.102394 0.005213 0.000047 0.242077 0.089959 1091.67 1256.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1278.486734
Model 2: PositiveSelection -1278.486734
Model 0: one-ratio -1294.026152
Model 3: discrete -1276.364701
Model 7: beta -1276.451307
Model 8: beta&w>1 -1276.451313
Model 0 vs 1 31.078835999999683
Model 2 vs 1 0.0
Model 8 vs 7 1.1999999969702912E-5
>C1
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPTAN
TISEDPEPAKNSSSGFCCC
>C2
MSQLYEISEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPAAH
TISRRSRTREEELLRFCCC
>C3
MSQLYDLSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGSAKPAAN
TISGDPEPAKKSSSGFCCC
>C4
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSIGAAKPTEN
TILADPEPAKKSSSGFCCC
>C5
MSQLYELSEVEQQNGKNGKPCWLIIKGNVYDVTKFLAEHPGGGDVLLEYG
GKDATKAFKQAGHSSDAEKELKNYKIGEINSAAPIQVQPTSITAAKVTEN
TISGDPEPAKKSSSGFCCC
>C6
MSQLYELSEVAVQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYG
GKDATKAFKQAGHSADAEKELKNYKIGEINSAAPIQIQPTSIAASKPAEN
TISEDPKPAEKSSSGFCCC
>C7
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYA
GKDATKAFKQAGHSSDAEKDLKKFKIGEINSAAPIQTQPTSNAATKPAEN
TITEDPEPAKKSSSGFCCC
>C8
MSQLYEVSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEALLEYG
GKDASKAFKQAGHSSDAEKDLKNFKIGEINSAAPIQIQPTSLAASKPTEN
TITGDPEPAKKSSSGFCCC
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=119
C1 MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYG
C2 MSQLYEISEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
C3 MSQLYDLSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
C4 MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
C5 MSQLYELSEVEQQNGKNGKPCWLIIKGNVYDVTKFLAEHPGGGDVLLEYG
C6 MSQLYELSEVAVQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYG
C7 MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYA
C8 MSQLYEVSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEALLEYG
*****::*** ************************.*****.:.****.
C1 GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPTAN
C2 GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPAAH
C3 GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGSAKPAAN
C4 GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSIGAAKPTEN
C5 GKDATKAFKQAGHSSDAEKELKNYKIGEINSAAPIQVQPTSITAAKVTEN
C6 GKDATKAFKQAGHSADAEKELKNYKIGEINSAAPIQIQPTSIAASKPAEN
C7 GKDATKAFKQAGHSSDAEKDLKKFKIGEINSAAPIQTQPTSNAATKPAEN
C8 GKDASKAFKQAGHSSDAEKDLKNFKIGEINSAAPIQIQPTSLAASKPTEN
****:*********:****:**::************ **** ::* : :
C1 TISEDPEPAKNSSSGFCCC
C2 TISRRSRTREEELLRFCCC
C3 TISGDPEPAKKSSSGFCCC
C4 TILADPEPAKKSSSGFCCC
C5 TISGDPEPAKKSSSGFCCC
C6 TISEDPKPAEKSSSGFCCC
C7 TITEDPEPAKKSSSGFCCC
C8 TITGDPEPAKKSSSGFCCC
** ... ::. ****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 8 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 119 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 119 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6676]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [6676]--->[6664]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/166/CG5157-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.399 Mb, Max= 30.630 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPTAN
TISEDPEPAKNSSSGFCCC
>C2
MSQLYEISEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPAAH
TISRRSRTREEELLRFCCC
>C3
MSQLYDLSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGSAKPAAN
TISGDPEPAKKSSSGFCCC
>C4
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSIGAAKPTEN
TILADPEPAKKSSSGFCCC
>C5
MSQLYELSEVEQQNGKNGKPCWLIIKGNVYDVTKFLAEHPGGGDVLLEYG
GKDATKAFKQAGHSSDAEKELKNYKIGEINSAAPIQVQPTSITAAKVTEN
TISGDPEPAKKSSSGFCCC
>C6
MSQLYELSEVAVQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYG
GKDATKAFKQAGHSADAEKELKNYKIGEINSAAPIQIQPTSIAASKPAEN
TISEDPKPAEKSSSGFCCC
>C7
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYA
GKDATKAFKQAGHSSDAEKDLKKFKIGEINSAAPIQTQPTSNAATKPAEN
TITEDPEPAKKSSSGFCCC
>C8
MSQLYEVSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEALLEYG
GKDASKAFKQAGHSSDAEKDLKNFKIGEINSAAPIQIQPTSLAASKPTEN
TITGDPEPAKKSSSGFCCC
FORMAT of file /tmp/tmp8654120202018682899aln Not Supported[FATAL:T-COFFEE]
>C1
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPTAN
TISEDPEPAKNSSSGFCCC
>C2
MSQLYEISEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPAAH
TISRRSRTREEELLRFCCC
>C3
MSQLYDLSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGSAKPAAN
TISGDPEPAKKSSSGFCCC
>C4
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSIGAAKPTEN
TILADPEPAKKSSSGFCCC
>C5
MSQLYELSEVEQQNGKNGKPCWLIIKGNVYDVTKFLAEHPGGGDVLLEYG
GKDATKAFKQAGHSSDAEKELKNYKIGEINSAAPIQVQPTSITAAKVTEN
TISGDPEPAKKSSSGFCCC
>C6
MSQLYELSEVAVQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYG
GKDATKAFKQAGHSADAEKELKNYKIGEINSAAPIQIQPTSIAASKPAEN
TISEDPKPAEKSSSGFCCC
>C7
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYA
GKDATKAFKQAGHSSDAEKDLKKFKIGEINSAAPIQTQPTSNAATKPAEN
TITEDPEPAKKSSSGFCCC
>C8
MSQLYEVSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEALLEYG
GKDASKAFKQAGHSSDAEKDLKNFKIGEINSAAPIQIQPTSLAASKPTEN
TITGDPEPAKKSSSGFCCC
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:119 S:100 BS:119
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# PW_SEQ_DISTANCES
BOT 0 1 86.55 C1 C2 86.55
TOP 1 0 86.55 C2 C1 86.55
BOT 0 2 94.96 C1 C3 94.96
TOP 2 0 94.96 C3 C1 94.96
BOT 0 3 94.96 C1 C4 94.96
TOP 3 0 94.96 C4 C1 94.96
BOT 0 4 89.92 C1 C5 89.92
TOP 4 0 89.92 C5 C1 89.92
BOT 0 5 87.39 C1 C6 87.39
TOP 5 0 87.39 C6 C1 87.39
BOT 0 6 89.08 C1 C7 89.08
TOP 6 0 89.08 C7 C1 89.08
BOT 0 7 89.08 C1 C8 89.08
TOP 7 0 89.08 C8 C1 89.08
BOT 1 2 86.55 C2 C3 86.55
TOP 2 1 86.55 C3 C2 86.55
BOT 1 3 84.87 C2 C4 84.87
TOP 3 1 84.87 C4 C2 84.87
BOT 1 4 79.83 C2 C5 79.83
TOP 4 1 79.83 C5 C2 79.83
BOT 1 5 80.67 C2 C6 80.67
TOP 5 1 80.67 C6 C2 80.67
BOT 1 6 79.83 C2 C7 79.83
TOP 6 1 79.83 C7 C2 79.83
BOT 1 7 79.83 C2 C8 79.83
TOP 7 1 79.83 C8 C2 79.83
BOT 2 3 94.12 C3 C4 94.12
TOP 3 2 94.12 C4 C3 94.12
BOT 2 4 89.92 C3 C5 89.92
TOP 4 2 89.92 C5 C3 89.92
BOT 2 5 87.39 C3 C6 87.39
TOP 5 2 87.39 C6 C3 87.39
BOT 2 6 89.08 C3 C7 89.08
TOP 6 2 89.08 C7 C3 89.08
BOT 2 7 89.08 C3 C8 89.08
TOP 7 2 89.08 C8 C3 89.08
BOT 3 4 92.44 C4 C5 92.44
TOP 4 3 92.44 C5 C4 92.44
BOT 3 5 89.08 C4 C6 89.08
TOP 5 3 89.08 C6 C4 89.08
BOT 3 6 89.92 C4 C7 89.92
TOP 6 3 89.92 C7 C4 89.92
BOT 3 7 91.60 C4 C8 91.60
TOP 7 3 91.60 C8 C4 91.60
BOT 4 5 89.08 C5 C6 89.08
TOP 5 4 89.08 C6 C5 89.08
BOT 4 6 87.39 C5 C7 87.39
TOP 6 4 87.39 C7 C5 87.39
BOT 4 7 88.24 C5 C8 88.24
TOP 7 4 88.24 C8 C5 88.24
BOT 5 6 89.92 C6 C7 89.92
TOP 6 5 89.92 C7 C6 89.92
BOT 5 7 89.08 C6 C8 89.08
TOP 7 5 89.08 C8 C6 89.08
BOT 6 7 91.60 C7 C8 91.60
TOP 7 6 91.60 C8 C7 91.60
AVG 0 C1 * 90.28
AVG 1 C2 * 82.59
AVG 2 C3 * 90.16
AVG 3 C4 * 91.00
AVG 4 C5 * 88.12
AVG 5 C6 * 87.52
AVG 6 C7 * 88.12
AVG 7 C8 * 88.36
TOT TOT * 88.27
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCACAGTTGTACGAACTCTCGGAGGTGGCCCAGCAGAACGGCAAGAA
C2 ATGTCACAGTTGTACGAAATCTCCGAGGTGGCCCAGCAGAACGGCAAGAA
C3 ATGTCACAGTTGTACGATCTCTCCGAGGTGGCCCAGCAGAACGGCAAGAA
C4 ATGTCACAGTTGTACGAACTCTCCGAAGTGGCCCAGCAGAACGGCAAGAA
C5 ATGTCACAGTTGTACGAACTCTCCGAGGTGGAACAGCAGAACGGCAAGAA
C6 ATGTCACAGTTGTACGAACTCTCCGAGGTGGCCGTGCAGAATGGCAAGAA
C7 ATGTCACAATTGTACGAACTCTCTGAGGTGGCCCAGCAGAATGGCAAGAA
C8 ATGTCCCAGTTGTACGAAGTTTCCGAGGTGGCCCAGCAGAATGGCAAGAA
*****.**.********: * ** **.****.. :****** ********
C1 TGGCAAACCCTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA
C2 TGGCAAACCGTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA
C3 TGGCAAGCCCTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA
C4 TGGCAAACCTTGCTGGCTAATCATTAAGGGGAACGTCTACGATGTAACCA
C5 TGGCAAACCTTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA
C6 CGGCAAACCCTGCTGGCTGATCATCAAGGGAAACGTCTACGATGTGACCA
C7 TGGCAAACCTTGCTGGCTGATCATCAAGGGAAACGTCTACGATGTAACCA
C8 TGGCAAACCCTGCTGGCTGATCATCAAGGGAAACGTATACGACGTGACCA
*****.** ********.***** *****.***** ***** **.****
C1 AGTTCCTCGGCGAGCATCCTGGCGGCAGTGAAGCACTACTCGAATATGGC
C2 AGTTCCTTGGCGAGCATCCTGGCGGCGGCGAAGCACTGCTCGAATACGGC
C3 AGTTCCTGGGCGAGCATCCTGGCGGCGGCGAAGCACTGCTCGAATACGGC
C4 AGTTTCTGGGCGAACATCCTGGTGGCGGCGAAGCACTACTCGAATACGGC
C5 AGTTCCTGGCCGAACATCCTGGCGGCGGCGATGTACTGCTGGAATACGGC
C6 AGTTCCTCAGCGAACATCCTGGCGGTGGCGAAGTACTCCTCGAATATGGC
C7 AGTTTCTGAGCGAACATCCAGGCGGTGGCGAAGTACTCCTCGAATACGCC
C8 AGTTCCTGAGCGAGCATCCTGGCGGTGGCGAAGCACTCCTCGAATACGGC
**** ** . ***.*****:** ** .* **:* *** ** ***** * *
C1 GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCATTCCTCCGACGC
C2 GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCACTCCTCCGATGC
C3 GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCACTCCTCCGATGC
C4 GGCAAGGATGCTACCAAGGCGTTCAAGCAAGCAGGCCACTCCTCCGATGC
C5 GGCAAGGATGCTACCAAGGCCTTCAAGCAAGCAGGCCACTCGTCCGATGC
C6 GGCAAGGATGCCACCAAGGCCTTCAAGCAAGCGGGACACTCCGCCGATGC
C7 GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGACACTCATCCGATGC
C8 GGCAAGGATGCCAGCAAGGCCTTCAAGCAGGCTGGACACTCCTCCGATGC
*********** * ****** ********.** **.** ** **** **
C1 AGAAAAGGATCTAAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCAC
C2 CGAAAAGGATCTGAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCGC
C3 CGAAAAGGATCTGAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCGC
C4 CGAAAAGGACCTGAAGAACTACAAAATTGGAGAAATTAACTCAGCTGCAC
C5 CGAAAAGGAACTGAAGAACTACAAAATTGGAGAAATTAACTCAGCTGCAC
C6 CGAAAAGGAACTAAAAAACTACAAAATCGGAGAAATTAACTCTGCTGCAC
C7 CGAAAAGGATCTAAAGAAGTTCAAAATCGGAGAAATCAATTCAGCTGCAC
C8 CGAAAAGGATCTGAAGAACTTTAAAATCGGAGAAATAAATTCAGCGGCGC
.******** **.**.** *: ***** ******** ** **:** **.*
C1 CCATTCAAGTGCAGCCAACGTCCAATGGTGCAGCAAAGCCGACGGCAAAC
C2 CCATTCAAGTGCAGCCCACGTCCAACGGTGCAGCAAAGCCGGCGGCCCAC
C3 CCATTCAAGTGCAGCCCACGTCCAATGGTTCAGCAAAGCCGGCGGCCAAC
C4 CCATTCAAGTCCAGCCCACGTCCATTGGTGCAGCAAAACCCACGGAAAAC
C5 CCATTCAGGTCCAGCCCACGTCCATTACTGCAGCGAAAGTCACGGAGAAC
C6 CCATTCAAATTCAGCCCACTTCCATTGCTGCATCGAAACCGGCGGAAAAC
C7 CCATTCAAACGCAACCAACGTCTAATGCTGCCACAAAACCAGCGGAAAAC
C8 CCATTCAAATCCAGCCCACGTCCCTTGCTGCATCGAAGCCAACGGAAAAC
*******.. **.**.** ** .: . * *. *.**. .***. .**
C1 ACAATATCCGAAGATCCCGAACCCGCGAAGAATAGCTCCTCCGGTTTCTG
C2 ACAATATCCCGGAGATCCCGAACCCGCGAAGAAGAGCTCCTCCGTTTCTG
C3 ACAATATCCGGCGATCCCGAACCCGCGAAGAAGAGCTCCTCCGGTTTCTG
C4 ACAATTTTAGCAGATCCCGAACCCGCGAAGAAGAGCTCTTCAGGCTTCTG
C5 ACAATATCTGGAGATCCCGAACCCGCGAAGAAGAGCTCTTCCGGATTCTG
C6 ACAATATCAGAAGATCCCAAGCCGGCGGAGAAAAGCTCTTCCGGCTTCTG
C7 ACAATAACTGAAGATCCCGAACCCGCGAAGAAGAGCTCTTCCGGTTTCTG
C8 ACAATAACCGGAGATCCGGAGCCCGCGAAGAAGAGCTCTTCCGGTTTCTG
*****:: ..: * ...* .*..* .. . * *****
C1 TTGCTGC
C2 TTGCTGC
C3 TTGCTGC
C4 CTGCTGC
C5 CTGCTGC
C6 CTGCTGC
C7 CTGCTGC
C8 CTGCTGC
******
>C1
ATGTCACAGTTGTACGAACTCTCGGAGGTGGCCCAGCAGAACGGCAAGAA
TGGCAAACCCTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA
AGTTCCTCGGCGAGCATCCTGGCGGCAGTGAAGCACTACTCGAATATGGC
GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCATTCCTCCGACGC
AGAAAAGGATCTAAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCAC
CCATTCAAGTGCAGCCAACGTCCAATGGTGCAGCAAAGCCGACGGCAAAC
ACAATATCCGAAGATCCCGAACCCGCGAAGAATAGCTCCTCCGGTTTCTG
TTGCTGC
>C2
ATGTCACAGTTGTACGAAATCTCCGAGGTGGCCCAGCAGAACGGCAAGAA
TGGCAAACCGTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA
AGTTCCTTGGCGAGCATCCTGGCGGCGGCGAAGCACTGCTCGAATACGGC
GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCACTCCTCCGATGC
CGAAAAGGATCTGAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCGC
CCATTCAAGTGCAGCCCACGTCCAACGGTGCAGCAAAGCCGGCGGCCCAC
ACAATATCCCGGAGATCCCGAACCCGCGAAGAAGAGCTCCTCCGTTTCTG
TTGCTGC
>C3
ATGTCACAGTTGTACGATCTCTCCGAGGTGGCCCAGCAGAACGGCAAGAA
TGGCAAGCCCTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA
AGTTCCTGGGCGAGCATCCTGGCGGCGGCGAAGCACTGCTCGAATACGGC
GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCACTCCTCCGATGC
CGAAAAGGATCTGAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCGC
CCATTCAAGTGCAGCCCACGTCCAATGGTTCAGCAAAGCCGGCGGCCAAC
ACAATATCCGGCGATCCCGAACCCGCGAAGAAGAGCTCCTCCGGTTTCTG
TTGCTGC
>C4
ATGTCACAGTTGTACGAACTCTCCGAAGTGGCCCAGCAGAACGGCAAGAA
TGGCAAACCTTGCTGGCTAATCATTAAGGGGAACGTCTACGATGTAACCA
AGTTTCTGGGCGAACATCCTGGTGGCGGCGAAGCACTACTCGAATACGGC
GGCAAGGATGCTACCAAGGCGTTCAAGCAAGCAGGCCACTCCTCCGATGC
CGAAAAGGACCTGAAGAACTACAAAATTGGAGAAATTAACTCAGCTGCAC
CCATTCAAGTCCAGCCCACGTCCATTGGTGCAGCAAAACCCACGGAAAAC
ACAATTTTAGCAGATCCCGAACCCGCGAAGAAGAGCTCTTCAGGCTTCTG
CTGCTGC
>C5
ATGTCACAGTTGTACGAACTCTCCGAGGTGGAACAGCAGAACGGCAAGAA
TGGCAAACCTTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA
AGTTCCTGGCCGAACATCCTGGCGGCGGCGATGTACTGCTGGAATACGGC
GGCAAGGATGCTACCAAGGCCTTCAAGCAAGCAGGCCACTCGTCCGATGC
CGAAAAGGAACTGAAGAACTACAAAATTGGAGAAATTAACTCAGCTGCAC
CCATTCAGGTCCAGCCCACGTCCATTACTGCAGCGAAAGTCACGGAGAAC
ACAATATCTGGAGATCCCGAACCCGCGAAGAAGAGCTCTTCCGGATTCTG
CTGCTGC
>C6
ATGTCACAGTTGTACGAACTCTCCGAGGTGGCCGTGCAGAATGGCAAGAA
CGGCAAACCCTGCTGGCTGATCATCAAGGGAAACGTCTACGATGTGACCA
AGTTCCTCAGCGAACATCCTGGCGGTGGCGAAGTACTCCTCGAATATGGC
GGCAAGGATGCCACCAAGGCCTTCAAGCAAGCGGGACACTCCGCCGATGC
CGAAAAGGAACTAAAAAACTACAAAATCGGAGAAATTAACTCTGCTGCAC
CCATTCAAATTCAGCCCACTTCCATTGCTGCATCGAAACCGGCGGAAAAC
ACAATATCAGAAGATCCCAAGCCGGCGGAGAAAAGCTCTTCCGGCTTCTG
CTGCTGC
>C7
ATGTCACAATTGTACGAACTCTCTGAGGTGGCCCAGCAGAATGGCAAGAA
TGGCAAACCTTGCTGGCTGATCATCAAGGGAAACGTCTACGATGTAACCA
AGTTTCTGAGCGAACATCCAGGCGGTGGCGAAGTACTCCTCGAATACGCC
GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGACACTCATCCGATGC
CGAAAAGGATCTAAAGAAGTTCAAAATCGGAGAAATCAATTCAGCTGCAC
CCATTCAAACGCAACCAACGTCTAATGCTGCCACAAAACCAGCGGAAAAC
ACAATAACTGAAGATCCCGAACCCGCGAAGAAGAGCTCTTCCGGTTTCTG
CTGCTGC
>C8
ATGTCCCAGTTGTACGAAGTTTCCGAGGTGGCCCAGCAGAATGGCAAGAA
TGGCAAACCCTGCTGGCTGATCATCAAGGGAAACGTATACGACGTGACCA
AGTTCCTGAGCGAGCATCCTGGCGGTGGCGAAGCACTCCTCGAATACGGC
GGCAAGGATGCCAGCAAGGCCTTCAAGCAGGCTGGACACTCCTCCGATGC
CGAAAAGGATCTGAAGAACTTTAAAATCGGAGAAATAAATTCAGCGGCGC
CCATTCAAATCCAGCCCACGTCCCTTGCTGCATCGAAGCCAACGGAAAAC
ACAATAACCGGAGATCCGGAGCCCGCGAAGAAGAGCTCTTCCGGTTTCTG
CTGCTGC
>C1
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPTAN
TISEDPEPAKNSSSGFCCC
>C2
MSQLYEISEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPAAH
TISRRSRTREEELLRFCCC
>C3
MSQLYDLSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGSAKPAAN
TISGDPEPAKKSSSGFCCC
>C4
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSIGAAKPTEN
TILADPEPAKKSSSGFCCC
>C5
MSQLYELSEVEQQNGKNGKPCWLIIKGNVYDVTKFLAEHPGGGDVLLEYG
GKDATKAFKQAGHSSDAEKELKNYKIGEINSAAPIQVQPTSITAAKVTEN
TISGDPEPAKKSSSGFCCC
>C6
MSQLYELSEVAVQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYG
GKDATKAFKQAGHSADAEKELKNYKIGEINSAAPIQIQPTSIAASKPAEN
TISEDPKPAEKSSSGFCCC
>C7
MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYA
GKDATKAFKQAGHSSDAEKDLKKFKIGEINSAAPIQTQPTSNAATKPAEN
TITEDPEPAKKSSSGFCCC
>C8
MSQLYEVSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEALLEYG
GKDASKAFKQAGHSSDAEKDLKNFKIGEINSAAPIQIQPTSLAASKPTEN
TITGDPEPAKKSSSGFCCC
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 8 taxa and 357 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478619134
Setting output file names to "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1986501058
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2318246733
Seed = 1518588125
Swapseed = 1478619134
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 25 unique site patterns
Division 2 has 22 unique site patterns
Division 3 has 70 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1598.623713 -- -24.349928
Chain 2 -- -1567.115569 -- -24.349928
Chain 3 -- -1554.672932 -- -24.349928
Chain 4 -- -1606.290663 -- -24.349928
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1550.513687 -- -24.349928
Chain 2 -- -1612.668796 -- -24.349928
Chain 3 -- -1601.973294 -- -24.349928
Chain 4 -- -1578.132027 -- -24.349928
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1598.624] (-1567.116) (-1554.673) (-1606.291) * [-1550.514] (-1612.669) (-1601.973) (-1578.132)
500 -- (-1373.109) (-1371.856) [-1361.168] (-1364.693) * (-1355.459) (-1362.095) (-1365.284) [-1362.873] -- 0:00:00
1000 -- (-1354.927) (-1355.787) (-1350.280) [-1351.530] * (-1346.304) (-1343.307) [-1343.598] (-1359.485) -- 0:00:00
1500 -- (-1356.128) (-1356.906) [-1338.713] (-1354.850) * (-1347.596) (-1345.177) [-1345.074] (-1358.168) -- 0:00:00
2000 -- (-1343.103) (-1346.439) (-1338.889) [-1339.655] * (-1345.225) [-1339.213] (-1346.319) (-1356.848) -- 0:08:19
2500 -- [-1341.671] (-1349.891) (-1339.501) (-1342.278) * (-1350.449) [-1342.261] (-1338.506) (-1352.703) -- 0:06:39
3000 -- (-1334.372) [-1336.219] (-1338.284) (-1335.616) * [-1340.331] (-1338.343) (-1342.708) (-1351.444) -- 0:05:32
3500 -- (-1342.214) (-1335.679) (-1336.986) [-1336.310] * [-1336.173] (-1336.674) (-1340.810) (-1347.534) -- 0:04:44
4000 -- (-1344.126) (-1336.091) (-1335.454) [-1335.644] * (-1335.973) [-1338.362] (-1341.473) (-1343.774) -- 0:04:09
4500 -- (-1348.875) (-1336.540) (-1339.876) [-1338.927] * (-1344.969) (-1337.729) [-1339.408] (-1336.680) -- 0:03:41
5000 -- (-1349.718) (-1339.567) (-1340.168) [-1336.364] * (-1342.760) [-1334.581] (-1341.842) (-1339.121) -- 0:06:38
Average standard deviation of split frequencies: 0.078567
5500 -- (-1336.865) (-1346.453) (-1335.643) [-1340.235] * (-1339.682) [-1334.595] (-1336.046) (-1340.519) -- 0:06:01
6000 -- (-1333.864) [-1340.796] (-1340.305) (-1342.935) * (-1340.860) (-1335.516) (-1338.328) [-1334.475] -- 0:05:31
6500 -- (-1346.050) (-1340.734) [-1339.509] (-1335.919) * (-1338.187) (-1339.734) [-1333.533] (-1343.482) -- 0:05:05
7000 -- (-1337.645) (-1345.360) (-1343.335) [-1334.744] * [-1346.260] (-1338.602) (-1335.529) (-1336.019) -- 0:04:43
7500 -- (-1338.590) (-1339.321) (-1344.110) [-1335.410] * (-1340.133) (-1332.376) [-1331.248] (-1334.484) -- 0:04:24
8000 -- (-1337.629) (-1334.616) (-1351.387) [-1339.994] * (-1342.786) [-1338.603] (-1337.902) (-1340.151) -- 0:04:08
8500 -- (-1349.388) (-1343.904) (-1355.553) [-1333.761] * [-1342.600] (-1338.344) (-1332.790) (-1345.026) -- 0:05:49
9000 -- (-1342.897) (-1333.218) (-1339.044) [-1334.294] * (-1335.642) [-1338.220] (-1345.710) (-1348.161) -- 0:05:30
9500 -- (-1341.113) (-1347.946) [-1339.760] (-1350.335) * (-1340.484) (-1335.512) (-1343.593) [-1342.093] -- 0:05:12
10000 -- (-1337.656) (-1342.219) (-1342.217) [-1337.445] * [-1333.644] (-1334.708) (-1345.390) (-1335.566) -- 0:04:57
Average standard deviation of split frequencies: 0.070711
10500 -- [-1333.063] (-1342.985) (-1349.045) (-1335.954) * [-1335.238] (-1340.862) (-1333.190) (-1347.626) -- 0:04:42
11000 -- (-1336.385) (-1349.887) (-1340.436) [-1338.984] * [-1337.399] (-1336.867) (-1338.964) (-1343.316) -- 0:04:29
11500 -- [-1342.680] (-1338.487) (-1334.291) (-1334.741) * (-1340.139) (-1341.618) [-1340.962] (-1343.360) -- 0:05:43
12000 -- (-1337.507) [-1338.724] (-1341.716) (-1340.758) * (-1344.651) (-1336.655) (-1337.373) [-1348.150] -- 0:05:29
12500 -- (-1342.541) (-1338.347) [-1339.807] (-1343.629) * (-1331.421) (-1334.776) [-1339.843] (-1343.012) -- 0:05:16
13000 -- [-1337.065] (-1350.532) (-1335.538) (-1337.700) * [-1338.919] (-1336.227) (-1342.381) (-1331.340) -- 0:05:03
13500 -- (-1342.493) (-1339.132) (-1340.923) [-1337.405] * [-1335.680] (-1345.535) (-1342.038) (-1335.024) -- 0:04:52
14000 -- (-1337.882) [-1334.758] (-1340.216) (-1339.530) * (-1333.971) (-1340.506) [-1341.479] (-1341.866) -- 0:04:41
14500 -- [-1335.143] (-1346.863) (-1335.604) (-1337.893) * [-1333.815] (-1348.502) (-1340.130) (-1337.558) -- 0:04:31
15000 -- [-1329.976] (-1340.896) (-1341.821) (-1336.760) * (-1335.535) (-1337.204) (-1353.387) [-1337.054] -- 0:05:28
Average standard deviation of split frequencies: 0.039284
15500 -- (-1340.302) [-1336.915] (-1338.746) (-1342.434) * [-1338.491] (-1343.666) (-1333.897) (-1337.474) -- 0:05:17
16000 -- (-1339.699) [-1345.935] (-1339.612) (-1335.519) * (-1334.013) [-1336.522] (-1337.134) (-1343.090) -- 0:05:07
16500 -- (-1340.307) (-1342.490) (-1342.542) [-1338.613] * (-1333.928) (-1342.811) (-1346.564) [-1332.516] -- 0:04:58
17000 -- (-1339.553) (-1338.337) [-1339.271] (-1340.695) * (-1335.061) [-1333.485] (-1339.849) (-1346.022) -- 0:04:49
17500 -- [-1331.914] (-1342.484) (-1336.829) (-1334.334) * [-1332.161] (-1335.924) (-1344.770) (-1346.045) -- 0:05:36
18000 -- (-1333.222) (-1338.624) [-1337.407] (-1347.342) * (-1344.594) (-1334.862) [-1341.325] (-1341.325) -- 0:05:27
18500 -- (-1343.970) (-1347.878) (-1333.295) [-1340.782] * (-1343.312) [-1337.266] (-1341.237) (-1346.770) -- 0:05:18
19000 -- [-1331.059] (-1343.373) (-1341.361) (-1338.200) * (-1339.189) (-1341.888) [-1338.164] (-1351.524) -- 0:05:09
19500 -- [-1337.295] (-1342.410) (-1334.881) (-1336.620) * [-1338.497] (-1345.130) (-1337.345) (-1341.058) -- 0:05:01
20000 -- (-1334.280) (-1335.484) [-1331.437] (-1333.670) * (-1337.717) (-1341.874) (-1336.846) [-1340.798] -- 0:04:54
Average standard deviation of split frequencies: 0.051322
20500 -- [-1336.570] (-1343.117) (-1332.649) (-1338.090) * (-1340.934) (-1344.020) (-1335.733) [-1348.453] -- 0:05:34
21000 -- (-1335.420) (-1339.787) [-1332.863] (-1340.941) * [-1334.977] (-1344.803) (-1336.554) (-1336.382) -- 0:05:26
21500 -- [-1341.850] (-1345.823) (-1345.054) (-1337.836) * (-1340.084) (-1344.353) (-1336.100) [-1338.987] -- 0:05:18
22000 -- (-1335.101) [-1339.172] (-1336.213) (-1333.507) * [-1332.700] (-1345.580) (-1335.782) (-1337.860) -- 0:05:11
22500 -- (-1337.977) (-1340.456) [-1334.339] (-1332.935) * [-1335.276] (-1341.953) (-1339.222) (-1337.327) -- 0:05:04
23000 -- [-1335.455] (-1342.836) (-1346.171) (-1337.316) * (-1342.819) (-1338.937) (-1335.919) [-1339.288] -- 0:04:57
23500 -- (-1340.011) [-1338.482] (-1337.570) (-1335.064) * [-1335.423] (-1349.371) (-1341.964) (-1335.663) -- 0:04:50
24000 -- (-1339.050) (-1339.388) [-1339.747] (-1338.785) * (-1333.376) [-1337.876] (-1344.965) (-1334.416) -- 0:05:25
24500 -- (-1350.474) [-1338.721] (-1335.852) (-1337.591) * (-1340.991) (-1342.469) [-1336.425] (-1335.148) -- 0:05:18
25000 -- (-1342.134) [-1337.187] (-1338.152) (-1340.767) * [-1337.604] (-1355.428) (-1335.424) (-1340.384) -- 0:05:12
Average standard deviation of split frequencies: 0.052378
25500 -- (-1336.663) (-1342.838) [-1339.564] (-1337.883) * (-1342.450) [-1351.322] (-1337.791) (-1340.227) -- 0:05:05
26000 -- (-1339.412) [-1339.011] (-1338.487) (-1338.878) * [-1336.647] (-1350.554) (-1337.687) (-1331.937) -- 0:04:59
26500 -- [-1334.025] (-1342.754) (-1339.567) (-1334.550) * (-1336.074) (-1339.725) [-1336.971] (-1347.371) -- 0:04:53
27000 -- (-1334.025) [-1338.375] (-1334.062) (-1341.222) * (-1336.660) (-1340.455) [-1337.473] (-1348.970) -- 0:05:24
27500 -- (-1336.952) (-1338.418) [-1340.824] (-1338.608) * (-1338.092) (-1352.830) [-1334.100] (-1339.900) -- 0:05:18
28000 -- (-1339.603) [-1337.812] (-1332.651) (-1337.994) * (-1342.797) (-1349.699) [-1335.772] (-1336.461) -- 0:05:12
28500 -- (-1338.096) [-1334.035] (-1341.039) (-1343.921) * (-1344.097) (-1344.008) (-1337.869) [-1344.563] -- 0:05:06
29000 -- (-1338.204) (-1333.288) (-1343.817) [-1337.625] * [-1349.592] (-1335.506) (-1338.518) (-1335.016) -- 0:05:01
29500 -- [-1332.918] (-1348.825) (-1338.810) (-1333.303) * (-1345.642) (-1340.267) (-1335.971) [-1334.235] -- 0:04:56
30000 -- (-1340.401) (-1339.741) [-1341.130] (-1331.681) * (-1337.302) [-1342.807] (-1336.982) (-1342.901) -- 0:05:23
Average standard deviation of split frequencies: 0.038430
30500 -- [-1339.059] (-1344.499) (-1344.519) (-1345.197) * (-1333.441) (-1344.606) [-1340.083] (-1349.026) -- 0:05:17
31000 -- [-1339.412] (-1336.144) (-1334.927) (-1341.269) * [-1341.375] (-1338.632) (-1344.094) (-1336.599) -- 0:05:12
31500 -- (-1336.966) (-1334.151) (-1332.710) [-1338.810] * (-1339.295) (-1337.496) [-1338.591] (-1334.129) -- 0:05:07
32000 -- (-1340.225) [-1332.562] (-1335.978) (-1336.964) * [-1336.842] (-1340.256) (-1335.629) (-1341.037) -- 0:05:02
32500 -- (-1338.552) (-1333.214) (-1337.034) [-1333.332] * (-1332.938) [-1338.688] (-1339.350) (-1334.115) -- 0:04:57
33000 -- (-1340.751) (-1338.004) (-1334.004) [-1332.455] * (-1334.458) [-1339.066] (-1347.241) (-1343.840) -- 0:04:53
33500 -- (-1345.735) [-1340.839] (-1336.412) (-1337.636) * (-1337.873) (-1346.679) (-1350.483) [-1341.802] -- 0:05:17
34000 -- [-1339.378] (-1345.145) (-1340.779) (-1336.480) * (-1342.562) (-1342.545) (-1341.500) [-1338.705] -- 0:05:12
34500 -- (-1341.285) [-1336.982] (-1335.844) (-1344.046) * (-1344.095) (-1339.699) (-1345.483) [-1340.830] -- 0:05:07
35000 -- (-1337.482) (-1349.742) (-1341.360) [-1336.184] * (-1337.078) [-1340.345] (-1336.562) (-1339.744) -- 0:05:03
Average standard deviation of split frequencies: 0.045831
35500 -- (-1334.698) (-1335.272) [-1332.611] (-1336.788) * [-1336.526] (-1340.566) (-1334.291) (-1342.728) -- 0:04:58
36000 -- [-1338.278] (-1334.358) (-1340.021) (-1337.518) * [-1336.400] (-1339.373) (-1339.495) (-1342.701) -- 0:04:54
36500 -- (-1344.841) [-1332.633] (-1341.962) (-1340.086) * [-1332.077] (-1343.246) (-1337.515) (-1342.081) -- 0:04:50
37000 -- (-1337.671) [-1336.077] (-1339.291) (-1345.914) * (-1337.495) (-1340.212) [-1333.635] (-1338.036) -- 0:05:12
37500 -- (-1333.808) [-1345.723] (-1339.138) (-1338.803) * (-1334.219) (-1338.601) [-1335.480] (-1336.663) -- 0:05:08
38000 -- (-1343.629) [-1332.638] (-1336.960) (-1338.157) * [-1336.065] (-1339.343) (-1332.548) (-1342.617) -- 0:05:03
38500 -- (-1335.614) [-1335.851] (-1339.217) (-1338.260) * (-1346.702) [-1336.632] (-1337.667) (-1342.231) -- 0:04:59
39000 -- (-1335.181) [-1338.783] (-1336.387) (-1339.308) * (-1342.105) [-1341.327] (-1337.255) (-1343.424) -- 0:04:55
39500 -- (-1331.343) [-1335.459] (-1336.591) (-1339.828) * [-1341.497] (-1337.536) (-1345.024) (-1334.051) -- 0:04:51
40000 -- (-1339.354) [-1333.302] (-1337.540) (-1349.832) * (-1344.413) (-1339.795) [-1336.117] (-1341.838) -- 0:05:12
Average standard deviation of split frequencies: 0.026496
40500 -- (-1338.616) [-1341.965] (-1333.215) (-1339.718) * (-1340.616) (-1340.593) [-1343.402] (-1347.179) -- 0:05:07
41000 -- [-1336.379] (-1334.960) (-1333.396) (-1336.461) * (-1337.543) (-1345.108) (-1345.136) [-1342.588] -- 0:05:04
41500 -- (-1343.186) (-1340.291) (-1336.515) [-1339.836] * (-1340.541) (-1332.536) [-1342.320] (-1339.071) -- 0:05:00
42000 -- (-1341.369) [-1334.100] (-1341.338) (-1339.360) * (-1342.933) (-1344.325) (-1339.839) [-1335.798] -- 0:04:56
42500 -- (-1338.129) (-1340.965) (-1334.679) [-1334.742] * [-1341.800] (-1346.158) (-1348.265) (-1342.028) -- 0:04:52
43000 -- [-1338.446] (-1341.047) (-1333.066) (-1341.538) * (-1352.718) [-1336.055] (-1346.879) (-1341.803) -- 0:05:11
43500 -- (-1340.587) (-1339.429) [-1334.009] (-1340.245) * [-1338.978] (-1339.114) (-1338.146) (-1336.813) -- 0:05:07
44000 -- (-1336.939) (-1342.336) [-1334.633] (-1333.679) * (-1340.830) (-1343.314) (-1340.219) [-1346.045] -- 0:05:04
44500 -- [-1338.044] (-1335.972) (-1345.265) (-1339.927) * (-1334.316) (-1343.815) [-1337.580] (-1343.663) -- 0:05:00
45000 -- (-1335.493) (-1336.784) [-1342.979] (-1343.047) * (-1333.588) (-1335.460) (-1341.143) [-1337.728] -- 0:04:57
Average standard deviation of split frequencies: 0.033306
45500 -- (-1340.669) (-1334.447) [-1335.929] (-1340.439) * (-1338.339) (-1338.136) (-1334.486) [-1333.536] -- 0:04:53
46000 -- (-1338.838) (-1341.614) [-1343.176] (-1337.611) * (-1345.522) (-1331.678) [-1344.598] (-1332.151) -- 0:05:11
46500 -- (-1337.111) (-1342.115) (-1339.468) [-1332.528] * [-1336.979] (-1339.949) (-1339.644) (-1345.645) -- 0:05:07
47000 -- (-1338.217) [-1338.130] (-1335.411) (-1342.094) * (-1340.432) (-1343.812) [-1336.569] (-1347.606) -- 0:05:04
47500 -- (-1335.808) [-1342.559] (-1340.164) (-1335.323) * [-1342.211] (-1353.804) (-1331.048) (-1336.507) -- 0:05:00
48000 -- (-1344.569) (-1341.154) (-1350.940) [-1351.437] * [-1335.106] (-1347.046) (-1338.444) (-1345.511) -- 0:04:57
48500 -- (-1350.869) (-1338.235) (-1338.531) [-1337.895] * (-1335.621) [-1346.187] (-1338.023) (-1336.798) -- 0:04:54
49000 -- (-1340.251) (-1334.618) (-1340.997) [-1345.478] * (-1334.648) (-1346.790) (-1337.526) [-1334.863] -- 0:04:51
49500 -- (-1336.900) (-1339.797) (-1341.619) [-1340.543] * (-1339.205) (-1350.809) [-1337.591] (-1338.968) -- 0:05:07
50000 -- (-1339.883) (-1344.703) (-1332.340) [-1334.212] * (-1344.816) [-1337.996] (-1337.753) (-1342.950) -- 0:05:04
Average standard deviation of split frequencies: 0.039077
50500 -- (-1342.762) [-1334.341] (-1339.128) (-1343.240) * [-1339.085] (-1338.130) (-1333.679) (-1339.215) -- 0:05:00
51000 -- (-1337.227) (-1337.028) [-1336.332] (-1340.513) * [-1335.489] (-1337.234) (-1347.452) (-1337.640) -- 0:04:57
51500 -- (-1335.308) (-1336.083) (-1342.045) [-1337.199] * (-1336.712) [-1342.658] (-1343.422) (-1338.569) -- 0:04:54
52000 -- (-1337.732) (-1338.819) (-1333.202) [-1341.804] * (-1343.050) (-1339.618) (-1340.016) [-1329.490] -- 0:04:51
52500 -- (-1341.811) (-1343.321) (-1339.140) [-1332.751] * (-1336.898) [-1340.964] (-1337.199) (-1337.741) -- 0:04:48
53000 -- [-1341.208] (-1341.448) (-1331.704) (-1336.887) * (-1334.343) [-1335.478] (-1338.578) (-1339.949) -- 0:05:03
53500 -- (-1334.413) (-1346.371) (-1342.906) [-1336.659] * [-1341.718] (-1338.505) (-1346.543) (-1342.634) -- 0:05:00
54000 -- (-1336.058) (-1346.570) (-1348.144) [-1336.190] * (-1339.960) [-1335.237] (-1336.009) (-1338.808) -- 0:04:57
54500 -- [-1337.677] (-1341.446) (-1337.237) (-1337.434) * (-1338.989) (-1337.778) (-1340.460) [-1332.289] -- 0:04:54
55000 -- (-1339.105) (-1343.754) (-1337.983) [-1339.562] * (-1335.546) [-1340.950] (-1339.976) (-1334.069) -- 0:04:52
Average standard deviation of split frequencies: 0.037039
55500 -- [-1337.693] (-1343.629) (-1338.845) (-1337.634) * (-1338.215) [-1334.343] (-1345.638) (-1340.896) -- 0:04:49
56000 -- (-1346.632) [-1338.549] (-1337.587) (-1340.800) * (-1346.615) (-1338.348) (-1343.049) [-1334.930] -- 0:05:03
56500 -- (-1332.157) (-1339.125) [-1332.565] (-1344.683) * (-1338.788) (-1334.827) (-1347.928) [-1331.848] -- 0:05:00
57000 -- (-1339.489) (-1332.531) (-1338.746) [-1337.476] * [-1340.990] (-1337.419) (-1347.247) (-1336.693) -- 0:04:57
57500 -- (-1344.988) (-1347.514) [-1334.492] (-1341.440) * [-1342.134] (-1340.404) (-1337.727) (-1336.731) -- 0:04:55
58000 -- (-1335.475) [-1333.523] (-1335.756) (-1339.819) * (-1340.403) [-1337.494] (-1341.999) (-1348.069) -- 0:04:52
58500 -- (-1345.220) (-1337.592) (-1343.710) [-1333.159] * (-1343.036) [-1330.815] (-1344.682) (-1342.744) -- 0:04:49
59000 -- (-1342.681) (-1338.937) [-1335.831] (-1340.884) * (-1348.145) [-1332.507] (-1332.790) (-1336.264) -- 0:04:47
59500 -- [-1338.566] (-1337.712) (-1345.589) (-1340.829) * (-1351.091) (-1339.501) (-1338.156) [-1337.934] -- 0:05:00
60000 -- (-1345.337) (-1335.609) [-1340.560] (-1339.794) * (-1342.138) (-1337.387) (-1332.549) [-1334.564] -- 0:04:57
Average standard deviation of split frequencies: 0.027196
60500 -- [-1335.345] (-1340.367) (-1337.420) (-1340.247) * (-1338.434) (-1341.393) [-1333.694] (-1333.444) -- 0:04:55
61000 -- [-1332.697] (-1336.066) (-1340.645) (-1350.110) * [-1332.527] (-1334.506) (-1337.432) (-1345.908) -- 0:04:52
61500 -- (-1333.202) [-1333.760] (-1336.079) (-1348.894) * (-1343.452) [-1341.818] (-1341.786) (-1348.763) -- 0:04:49
62000 -- (-1338.105) (-1349.114) [-1334.510] (-1346.505) * [-1336.977] (-1340.168) (-1340.216) (-1347.054) -- 0:04:47
62500 -- (-1349.681) (-1336.471) [-1337.335] (-1334.382) * (-1335.404) [-1336.522] (-1346.320) (-1346.143) -- 0:04:45
63000 -- (-1341.323) (-1334.415) (-1341.809) [-1340.185] * (-1334.445) (-1337.676) (-1341.120) [-1345.970] -- 0:04:57
63500 -- (-1338.644) (-1335.045) [-1338.651] (-1344.953) * (-1339.838) (-1339.217) [-1338.248] (-1342.664) -- 0:04:54
64000 -- (-1343.965) (-1335.677) [-1335.800] (-1350.011) * [-1328.270] (-1336.445) (-1336.719) (-1337.234) -- 0:04:52
64500 -- (-1353.234) (-1334.582) [-1341.094] (-1338.107) * [-1335.137] (-1338.657) (-1338.522) (-1334.982) -- 0:04:50
65000 -- (-1335.449) (-1335.457) [-1342.754] (-1348.185) * [-1333.990] (-1344.406) (-1349.641) (-1338.175) -- 0:04:47
Average standard deviation of split frequencies: 0.022320
65500 -- (-1333.948) [-1333.613] (-1349.705) (-1335.806) * [-1341.058] (-1339.884) (-1342.685) (-1336.616) -- 0:04:45
66000 -- [-1334.004] (-1338.450) (-1341.873) (-1336.053) * [-1340.141] (-1341.043) (-1334.417) (-1341.105) -- 0:04:57
66500 -- (-1337.236) (-1333.021) (-1342.665) [-1337.348] * (-1345.208) (-1337.063) [-1333.365] (-1334.285) -- 0:04:54
67000 -- [-1342.358] (-1340.368) (-1339.144) (-1335.368) * (-1341.219) (-1338.258) (-1335.058) [-1339.487] -- 0:04:52
67500 -- (-1338.884) (-1339.323) (-1343.065) [-1336.132] * (-1346.036) [-1332.890] (-1339.699) (-1336.737) -- 0:04:50
68000 -- (-1335.056) (-1347.276) (-1331.887) [-1338.520] * (-1339.390) (-1350.789) (-1341.024) [-1330.531] -- 0:04:47
68500 -- (-1338.667) (-1343.243) (-1336.909) [-1334.049] * [-1336.794] (-1343.587) (-1336.541) (-1341.927) -- 0:04:45
69000 -- [-1338.833] (-1336.399) (-1340.715) (-1335.969) * (-1343.003) (-1346.576) (-1337.523) [-1332.425] -- 0:04:43
69500 -- [-1339.898] (-1346.205) (-1332.411) (-1337.083) * (-1337.138) [-1337.289] (-1344.783) (-1342.082) -- 0:04:54
70000 -- (-1337.000) (-1344.304) (-1337.449) [-1341.102] * [-1339.979] (-1341.457) (-1344.100) (-1340.853) -- 0:04:52
Average standard deviation of split frequencies: 0.020965
70500 -- (-1339.302) (-1339.404) [-1335.329] (-1341.588) * (-1341.703) [-1341.135] (-1339.315) (-1340.728) -- 0:04:50
71000 -- (-1337.433) (-1336.430) (-1337.500) [-1344.324] * [-1330.825] (-1351.368) (-1343.533) (-1344.648) -- 0:04:47
71500 -- (-1343.656) (-1345.420) [-1342.145] (-1339.963) * (-1333.657) [-1337.150] (-1339.725) (-1343.132) -- 0:04:45
72000 -- (-1339.284) (-1334.785) (-1341.230) [-1340.365] * [-1335.736] (-1355.046) (-1340.613) (-1338.028) -- 0:04:43
72500 -- (-1342.984) [-1335.987] (-1337.684) (-1344.420) * [-1337.961] (-1342.996) (-1345.157) (-1340.916) -- 0:04:41
73000 -- (-1340.877) [-1333.233] (-1333.766) (-1337.838) * (-1340.243) [-1336.712] (-1344.477) (-1338.686) -- 0:04:52
73500 -- [-1335.513] (-1338.365) (-1340.061) (-1341.783) * (-1344.214) (-1343.259) (-1331.875) [-1336.128] -- 0:04:49
74000 -- (-1337.962) [-1338.735] (-1347.014) (-1345.429) * (-1341.802) (-1343.148) (-1338.232) [-1336.752] -- 0:04:47
74500 -- (-1334.649) [-1336.555] (-1339.074) (-1342.438) * (-1341.816) [-1339.677] (-1340.477) (-1339.144) -- 0:04:45
75000 -- (-1339.115) (-1338.062) [-1334.753] (-1342.896) * (-1345.880) (-1345.585) [-1336.466] (-1343.911) -- 0:04:43
Average standard deviation of split frequencies: 0.015950
75500 -- [-1334.739] (-1340.532) (-1345.251) (-1330.492) * (-1341.677) (-1337.803) (-1334.915) [-1342.424] -- 0:04:41
76000 -- [-1341.792] (-1335.840) (-1349.461) (-1334.631) * (-1341.189) (-1342.456) [-1340.869] (-1338.060) -- 0:04:51
76500 -- (-1342.295) (-1336.330) (-1339.920) [-1338.187] * (-1339.090) (-1343.264) (-1339.041) [-1335.672] -- 0:04:49
77000 -- [-1338.160] (-1335.686) (-1339.215) (-1337.748) * [-1336.529] (-1341.847) (-1338.915) (-1340.812) -- 0:04:47
77500 -- (-1337.830) (-1339.745) [-1342.563] (-1334.366) * [-1333.034] (-1334.453) (-1342.104) (-1339.238) -- 0:04:45
78000 -- (-1341.884) (-1340.453) (-1337.777) [-1337.527] * (-1341.318) [-1336.729] (-1341.171) (-1347.765) -- 0:04:43
78500 -- (-1341.994) (-1343.725) (-1342.258) [-1339.218] * (-1339.526) (-1339.268) (-1334.131) [-1341.362] -- 0:04:41
79000 -- (-1338.411) (-1342.475) (-1346.210) [-1337.114] * (-1342.734) [-1335.856] (-1337.447) (-1332.005) -- 0:04:39
79500 -- (-1338.604) (-1337.255) (-1344.178) [-1338.127] * (-1354.128) (-1346.004) [-1337.777] (-1348.436) -- 0:04:49
80000 -- (-1342.253) (-1339.127) (-1352.254) [-1335.585] * (-1339.467) (-1346.887) [-1335.059] (-1351.326) -- 0:04:47
Average standard deviation of split frequencies: 0.009740
80500 -- (-1344.985) (-1336.120) [-1348.402] (-1342.446) * [-1336.359] (-1337.511) (-1339.083) (-1338.822) -- 0:04:45
81000 -- (-1335.901) (-1338.326) (-1346.299) [-1332.098] * (-1339.007) [-1343.311] (-1347.380) (-1348.445) -- 0:04:43
81500 -- [-1336.980] (-1343.720) (-1338.379) (-1341.028) * [-1338.760] (-1343.976) (-1337.292) (-1331.942) -- 0:04:41
82000 -- (-1337.133) [-1333.911] (-1343.840) (-1345.948) * (-1342.205) (-1341.770) (-1342.033) [-1334.783] -- 0:04:39
82500 -- [-1327.727] (-1332.610) (-1339.715) (-1337.315) * (-1337.018) (-1342.666) (-1337.342) [-1334.524] -- 0:04:49
83000 -- (-1335.722) (-1345.205) [-1344.863] (-1333.847) * (-1339.489) (-1339.302) (-1341.292) [-1332.486] -- 0:04:47
83500 -- [-1336.159] (-1346.815) (-1339.073) (-1340.812) * (-1334.754) (-1342.089) [-1336.373] (-1338.719) -- 0:04:45
84000 -- (-1336.985) (-1342.946) [-1340.905] (-1340.684) * (-1334.945) (-1333.376) [-1335.357] (-1338.296) -- 0:04:43
84500 -- (-1338.229) (-1336.925) [-1330.666] (-1336.694) * (-1339.422) (-1340.906) [-1334.058] (-1346.163) -- 0:04:41
85000 -- [-1339.600] (-1341.660) (-1336.968) (-1336.804) * (-1331.768) (-1343.342) (-1341.316) [-1335.571] -- 0:04:39
Average standard deviation of split frequencies: 0.009136
85500 -- (-1336.896) (-1348.406) [-1334.003] (-1343.214) * (-1339.044) (-1343.068) (-1341.067) [-1337.066] -- 0:04:38
86000 -- [-1335.056] (-1338.274) (-1344.410) (-1354.057) * (-1339.951) (-1337.737) [-1341.217] (-1346.357) -- 0:04:46
86500 -- (-1337.663) [-1336.217] (-1336.710) (-1344.738) * (-1339.102) (-1344.094) [-1331.816] (-1339.294) -- 0:04:45
87000 -- (-1340.186) [-1331.860] (-1342.099) (-1342.117) * (-1349.725) [-1336.536] (-1337.000) (-1340.227) -- 0:04:43
87500 -- (-1335.041) [-1342.281] (-1344.767) (-1341.060) * (-1337.996) [-1335.539] (-1346.424) (-1340.765) -- 0:04:41
88000 -- (-1356.084) (-1330.429) [-1344.998] (-1344.472) * (-1339.424) [-1339.901] (-1346.602) (-1338.216) -- 0:04:39
88500 -- (-1348.246) (-1334.608) [-1332.629] (-1344.685) * [-1347.780] (-1332.341) (-1350.586) (-1339.861) -- 0:04:38
89000 -- (-1339.739) (-1341.445) [-1335.881] (-1345.230) * (-1334.905) [-1338.383] (-1344.037) (-1337.549) -- 0:04:36
89500 -- (-1339.517) (-1338.391) (-1339.552) [-1340.836] * (-1339.961) (-1337.006) (-1340.455) [-1336.047] -- 0:04:44
90000 -- (-1336.739) (-1339.028) [-1335.932] (-1343.489) * (-1342.253) [-1334.203] (-1339.121) (-1340.735) -- 0:04:43
Average standard deviation of split frequencies: 0.017331
90500 -- [-1339.940] (-1338.436) (-1338.444) (-1340.644) * (-1340.399) (-1337.962) (-1341.490) [-1338.923] -- 0:04:41
91000 -- (-1334.516) (-1336.551) [-1331.585] (-1345.150) * (-1340.721) [-1334.939] (-1337.847) (-1345.322) -- 0:04:39
91500 -- (-1341.412) (-1336.864) [-1337.850] (-1343.287) * [-1333.511] (-1334.213) (-1338.562) (-1336.786) -- 0:04:38
92000 -- (-1337.468) (-1343.149) [-1333.291] (-1340.017) * (-1335.304) (-1330.936) [-1336.408] (-1339.161) -- 0:04:36
92500 -- [-1334.373] (-1346.026) (-1336.266) (-1335.928) * [-1336.301] (-1339.991) (-1343.036) (-1348.338) -- 0:04:44
93000 -- (-1337.995) (-1340.253) (-1339.265) [-1333.471] * (-1341.676) [-1336.025] (-1344.678) (-1334.772) -- 0:04:42
93500 -- [-1335.143] (-1339.948) (-1342.943) (-1334.900) * (-1340.009) (-1336.134) (-1342.231) [-1335.678] -- 0:04:41
94000 -- [-1336.393] (-1333.664) (-1336.951) (-1337.683) * (-1341.470) (-1345.416) [-1339.742] (-1344.754) -- 0:04:39
94500 -- (-1332.935) (-1340.424) (-1334.690) [-1337.687] * (-1336.844) [-1339.159] (-1335.233) (-1337.563) -- 0:04:37
95000 -- (-1342.969) (-1336.915) [-1342.037] (-1340.284) * (-1336.833) (-1350.853) [-1343.579] (-1341.211) -- 0:04:36
Average standard deviation of split frequencies: 0.013328
95500 -- (-1342.159) (-1353.835) [-1338.929] (-1335.966) * [-1335.147] (-1337.931) (-1343.444) (-1333.377) -- 0:04:34
96000 -- (-1336.570) (-1339.060) [-1335.334] (-1341.684) * (-1335.606) [-1333.434] (-1350.447) (-1338.694) -- 0:04:42
96500 -- (-1334.920) (-1344.520) [-1338.905] (-1337.199) * [-1333.264] (-1337.967) (-1344.880) (-1338.428) -- 0:04:40
97000 -- (-1336.499) [-1344.006] (-1343.949) (-1329.921) * [-1335.502] (-1343.696) (-1340.497) (-1337.028) -- 0:04:39
97500 -- [-1342.981] (-1331.088) (-1354.019) (-1341.021) * [-1335.820] (-1344.304) (-1337.546) (-1343.026) -- 0:04:37
98000 -- (-1343.416) [-1336.339] (-1336.351) (-1338.001) * [-1343.873] (-1349.974) (-1336.739) (-1336.706) -- 0:04:36
98500 -- [-1336.453] (-1344.404) (-1339.406) (-1339.320) * (-1334.324) (-1342.719) (-1339.826) [-1340.257] -- 0:04:34
99000 -- (-1337.566) (-1336.105) [-1345.441] (-1344.524) * [-1335.497] (-1350.418) (-1343.212) (-1336.275) -- 0:04:42
99500 -- (-1341.753) [-1339.476] (-1339.787) (-1337.834) * (-1336.173) (-1350.129) (-1344.084) [-1340.745] -- 0:04:40
100000 -- (-1344.929) (-1341.264) (-1342.581) [-1345.813] * (-1342.149) (-1351.639) (-1335.989) [-1337.373] -- 0:04:39
Average standard deviation of split frequencies: 0.011373
100500 -- [-1333.500] (-1350.749) (-1342.957) (-1337.983) * (-1345.382) (-1344.583) (-1342.116) [-1341.692] -- 0:04:37
101000 -- (-1336.713) (-1347.832) (-1342.738) [-1332.057] * (-1349.121) [-1345.057] (-1341.172) (-1335.850) -- 0:04:35
101500 -- (-1344.852) [-1343.852] (-1336.693) (-1333.877) * (-1344.505) (-1337.651) (-1341.550) [-1336.196] -- 0:04:43
102000 -- (-1340.900) [-1342.165] (-1346.722) (-1335.662) * (-1341.565) (-1345.623) (-1345.141) [-1333.979] -- 0:04:41
102500 -- (-1339.242) [-1336.952] (-1337.961) (-1336.352) * (-1340.476) (-1339.526) [-1332.994] (-1347.357) -- 0:04:40
103000 -- [-1337.354] (-1339.783) (-1338.087) (-1343.367) * (-1339.369) [-1335.149] (-1339.746) (-1332.326) -- 0:04:38
103500 -- (-1337.907) (-1341.996) [-1335.139] (-1335.333) * (-1338.920) (-1337.668) [-1330.935] (-1337.054) -- 0:04:37
104000 -- (-1342.674) (-1342.903) [-1338.154] (-1336.185) * (-1340.783) (-1340.835) (-1339.611) [-1336.375] -- 0:04:35
104500 -- [-1334.147] (-1336.084) (-1339.375) (-1339.929) * (-1337.946) [-1337.333] (-1338.115) (-1344.797) -- 0:04:42
105000 -- (-1338.795) (-1342.762) [-1342.871] (-1342.847) * (-1341.445) [-1336.358] (-1340.844) (-1341.431) -- 0:04:41
Average standard deviation of split frequencies: 0.007783
105500 -- (-1352.167) (-1336.414) [-1335.813] (-1337.912) * (-1337.479) (-1340.477) (-1346.823) [-1335.722] -- 0:04:39
106000 -- (-1337.818) (-1338.896) [-1333.071] (-1344.448) * (-1344.508) (-1338.817) [-1333.680] (-1341.469) -- 0:04:38
106500 -- [-1344.288] (-1339.217) (-1348.943) (-1350.345) * (-1339.215) (-1332.780) (-1338.956) [-1341.603] -- 0:04:36
107000 -- [-1338.187] (-1338.702) (-1344.780) (-1350.001) * (-1335.923) (-1332.587) (-1337.600) [-1336.827] -- 0:04:35
107500 -- (-1343.989) (-1340.316) [-1342.220] (-1337.418) * [-1343.592] (-1338.854) (-1342.625) (-1338.757) -- 0:04:33
108000 -- (-1339.379) (-1343.203) [-1342.384] (-1340.679) * (-1335.680) [-1336.685] (-1332.733) (-1338.376) -- 0:04:40
108500 -- (-1339.615) (-1342.422) [-1338.473] (-1334.931) * (-1337.566) [-1337.900] (-1343.718) (-1331.865) -- 0:04:39
109000 -- (-1339.306) (-1340.375) [-1337.056] (-1343.867) * (-1334.698) (-1339.932) [-1335.797] (-1336.916) -- 0:04:37
109500 -- (-1336.505) (-1329.428) [-1341.343] (-1346.553) * (-1337.509) (-1333.022) (-1341.390) [-1338.605] -- 0:04:36
110000 -- (-1333.862) (-1335.382) (-1337.925) [-1335.148] * [-1335.996] (-1346.236) (-1340.447) (-1343.139) -- 0:04:35
Average standard deviation of split frequencies: 0.012171
110500 -- (-1336.751) [-1339.979] (-1339.332) (-1337.615) * (-1334.125) (-1352.707) (-1342.945) [-1340.889] -- 0:04:33
111000 -- (-1342.821) (-1340.126) (-1344.645) [-1349.689] * (-1349.221) (-1340.475) (-1342.882) [-1346.059] -- 0:04:32
111500 -- (-1333.792) [-1345.822] (-1336.878) (-1343.669) * [-1340.858] (-1334.593) (-1335.107) (-1340.305) -- 0:04:38
112000 -- (-1343.868) (-1348.807) [-1338.405] (-1339.994) * (-1336.586) (-1343.073) [-1338.572] (-1336.592) -- 0:04:37
112500 -- (-1350.236) (-1347.869) [-1343.657] (-1350.050) * (-1341.641) [-1340.030] (-1334.571) (-1342.768) -- 0:04:36
113000 -- (-1347.564) (-1334.094) [-1340.129] (-1345.232) * (-1342.609) [-1330.949] (-1338.308) (-1337.029) -- 0:04:34
113500 -- (-1344.337) (-1340.681) [-1337.313] (-1349.061) * (-1342.178) (-1335.686) (-1347.648) [-1334.723] -- 0:04:33
114000 -- (-1346.762) (-1342.302) [-1340.359] (-1344.015) * (-1335.466) (-1342.730) (-1349.616) [-1343.694] -- 0:04:32
114500 -- (-1337.775) (-1347.232) (-1338.127) [-1343.553] * (-1338.478) (-1337.713) (-1346.216) [-1336.885] -- 0:04:30
115000 -- (-1349.391) [-1341.051] (-1343.910) (-1343.876) * (-1337.975) [-1337.745] (-1342.699) (-1346.752) -- 0:04:37
Average standard deviation of split frequencies: 0.012191
115500 -- (-1331.905) (-1339.902) (-1333.188) [-1341.842] * (-1342.201) (-1340.592) [-1343.875] (-1341.194) -- 0:04:35
116000 -- (-1338.186) [-1339.295] (-1347.471) (-1337.197) * (-1342.388) (-1336.748) [-1336.772] (-1354.407) -- 0:04:34
116500 -- [-1342.635] (-1340.848) (-1334.343) (-1336.114) * [-1341.994] (-1338.706) (-1336.301) (-1343.161) -- 0:04:33
117000 -- (-1337.866) (-1336.400) (-1332.148) [-1336.698] * [-1334.714] (-1341.451) (-1339.597) (-1331.649) -- 0:04:31
117500 -- (-1338.093) (-1340.434) [-1332.539] (-1343.569) * (-1340.807) [-1342.154] (-1336.406) (-1342.937) -- 0:04:30
118000 -- (-1337.409) [-1338.330] (-1337.125) (-1337.822) * (-1340.152) [-1335.462] (-1343.158) (-1341.526) -- 0:04:29
118500 -- [-1341.796] (-1340.930) (-1338.600) (-1336.715) * (-1346.995) (-1334.968) (-1333.298) [-1336.133] -- 0:04:35
119000 -- (-1340.751) (-1338.086) (-1348.163) [-1337.289] * (-1336.073) [-1336.701] (-1331.201) (-1346.682) -- 0:04:33
119500 -- (-1339.799) (-1338.824) (-1335.710) [-1342.111] * (-1338.479) [-1337.712] (-1331.973) (-1339.177) -- 0:04:32
120000 -- (-1341.474) [-1336.943] (-1331.702) (-1336.077) * (-1334.449) (-1336.665) [-1338.739] (-1340.904) -- 0:04:31
Average standard deviation of split frequencies: 0.010255
120500 -- [-1335.822] (-1338.652) (-1338.749) (-1340.266) * (-1348.146) (-1339.833) [-1341.185] (-1338.735) -- 0:04:30
121000 -- (-1333.603) (-1336.822) [-1341.730] (-1339.929) * (-1343.398) (-1338.124) [-1337.365] (-1336.768) -- 0:04:28
121500 -- (-1333.464) [-1344.846] (-1340.776) (-1332.767) * [-1341.360] (-1339.851) (-1335.663) (-1340.764) -- 0:04:34
122000 -- (-1344.722) (-1335.907) (-1343.672) [-1334.909] * (-1340.098) (-1338.920) (-1335.199) [-1335.290] -- 0:04:33
122500 -- [-1348.886] (-1339.953) (-1334.599) (-1337.388) * [-1336.416] (-1339.222) (-1340.707) (-1335.953) -- 0:04:32
123000 -- [-1338.101] (-1345.839) (-1336.545) (-1343.658) * (-1330.659) (-1346.440) (-1337.649) [-1333.625] -- 0:04:30
123500 -- (-1339.461) [-1338.152] (-1335.567) (-1336.332) * [-1336.346] (-1336.847) (-1334.339) (-1345.520) -- 0:04:29
124000 -- (-1337.167) (-1346.338) [-1334.654] (-1334.840) * (-1347.328) [-1333.176] (-1346.406) (-1341.643) -- 0:04:28
124500 -- (-1340.527) [-1335.791] (-1336.084) (-1340.954) * [-1332.955] (-1341.869) (-1341.821) (-1340.675) -- 0:04:34
125000 -- (-1341.625) (-1339.214) (-1336.004) [-1335.776] * [-1338.874] (-1337.880) (-1341.777) (-1336.607) -- 0:04:33
Average standard deviation of split frequencies: 0.009353
125500 -- (-1334.175) (-1340.150) [-1338.207] (-1333.435) * (-1333.024) (-1335.555) (-1338.431) [-1336.004] -- 0:04:31
126000 -- (-1339.250) [-1339.210] (-1342.056) (-1342.448) * (-1337.529) (-1337.992) [-1338.637] (-1341.062) -- 0:04:30
126500 -- (-1332.001) (-1347.940) [-1337.461] (-1341.244) * (-1338.861) [-1334.932] (-1339.212) (-1336.263) -- 0:04:29
127000 -- (-1338.403) [-1341.224] (-1337.990) (-1340.706) * (-1340.353) [-1336.868] (-1337.934) (-1346.292) -- 0:04:28
127500 -- (-1346.341) (-1336.796) (-1338.618) [-1335.034] * [-1337.008] (-1342.990) (-1339.649) (-1343.376) -- 0:04:33
128000 -- (-1336.821) (-1343.418) (-1345.676) [-1335.884] * [-1339.648] (-1351.742) (-1337.733) (-1335.237) -- 0:04:32
128500 -- [-1335.116] (-1339.042) (-1354.754) (-1341.980) * (-1341.281) (-1345.280) (-1333.286) [-1339.466] -- 0:04:31
129000 -- (-1342.693) [-1337.716] (-1348.306) (-1351.245) * [-1338.023] (-1338.642) (-1334.513) (-1337.030) -- 0:04:30
129500 -- (-1334.733) (-1339.001) [-1335.949] (-1335.540) * (-1340.463) (-1336.241) [-1333.407] (-1339.033) -- 0:04:28
130000 -- (-1342.491) [-1348.873] (-1337.122) (-1350.387) * (-1337.791) [-1343.636] (-1338.104) (-1336.384) -- 0:04:27
Average standard deviation of split frequencies: 0.011725
130500 -- (-1339.528) (-1344.788) (-1338.939) [-1345.305] * (-1335.611) [-1332.099] (-1349.107) (-1336.651) -- 0:04:26
131000 -- (-1339.741) (-1347.896) [-1337.205] (-1343.182) * (-1339.808) (-1338.187) (-1337.193) [-1337.572] -- 0:04:31
131500 -- [-1339.227] (-1338.642) (-1342.145) (-1336.015) * (-1343.611) (-1338.083) [-1338.333] (-1338.306) -- 0:04:30
132000 -- (-1336.340) (-1350.455) [-1337.896] (-1333.987) * (-1342.740) (-1338.951) [-1333.325] (-1342.924) -- 0:04:29
132500 -- (-1351.625) [-1336.332] (-1337.132) (-1337.717) * (-1335.164) (-1347.578) [-1335.406] (-1334.707) -- 0:04:28
133000 -- (-1339.460) (-1341.188) (-1336.194) [-1342.045] * (-1340.446) [-1346.212] (-1334.237) (-1340.457) -- 0:04:27
133500 -- (-1342.437) (-1346.192) (-1333.488) [-1328.478] * [-1336.840] (-1337.233) (-1338.483) (-1337.477) -- 0:04:26
134000 -- (-1340.368) (-1340.257) [-1338.529] (-1335.257) * (-1338.365) (-1341.331) [-1343.233] (-1336.965) -- 0:04:24
134500 -- (-1334.844) [-1334.757] (-1342.910) (-1335.651) * (-1337.292) (-1341.901) (-1334.515) [-1336.169] -- 0:04:30
135000 -- (-1343.715) (-1333.504) (-1334.531) [-1342.359] * [-1341.675] (-1345.942) (-1340.942) (-1333.621) -- 0:04:29
Average standard deviation of split frequencies: 0.012132
135500 -- [-1340.745] (-1342.473) (-1335.256) (-1341.789) * (-1337.131) (-1337.866) (-1332.313) [-1331.238] -- 0:04:27
136000 -- [-1337.514] (-1337.797) (-1340.161) (-1336.245) * [-1342.321] (-1337.489) (-1335.462) (-1337.623) -- 0:04:26
136500 -- (-1332.827) [-1336.871] (-1343.308) (-1340.107) * (-1338.674) [-1335.973] (-1335.165) (-1335.814) -- 0:04:25
137000 -- (-1337.965) [-1337.911] (-1334.888) (-1340.599) * (-1336.049) (-1342.014) [-1340.212] (-1336.230) -- 0:04:24
137500 -- (-1346.396) (-1340.327) [-1332.965] (-1342.172) * (-1338.050) [-1334.796] (-1338.928) (-1340.481) -- 0:04:29
138000 -- (-1336.832) (-1336.561) (-1335.166) [-1343.096] * [-1333.183] (-1344.324) (-1336.911) (-1335.711) -- 0:04:28
138500 -- (-1345.033) [-1337.122] (-1336.513) (-1338.618) * [-1339.084] (-1345.316) (-1346.202) (-1338.623) -- 0:04:27
139000 -- (-1339.936) (-1341.228) (-1341.709) [-1337.797] * (-1341.573) (-1336.711) (-1338.617) [-1336.599] -- 0:04:26
139500 -- (-1352.552) (-1334.383) [-1335.936] (-1337.427) * (-1342.333) [-1332.691] (-1337.951) (-1337.013) -- 0:04:25
140000 -- (-1335.452) (-1333.784) [-1339.187] (-1342.110) * (-1341.137) (-1342.278) [-1337.304] (-1345.217) -- 0:04:24
Average standard deviation of split frequencies: 0.015918
140500 -- (-1337.672) (-1335.054) (-1340.563) [-1340.179] * (-1344.814) (-1334.223) [-1343.107] (-1341.038) -- 0:04:23
141000 -- [-1339.815] (-1339.452) (-1340.527) (-1337.657) * [-1335.275] (-1336.868) (-1341.177) (-1338.453) -- 0:04:28
141500 -- (-1343.305) (-1343.382) [-1338.410] (-1344.763) * [-1335.942] (-1337.808) (-1337.566) (-1339.073) -- 0:04:26
142000 -- (-1344.635) (-1338.825) (-1340.136) [-1334.857] * (-1334.127) (-1337.618) [-1335.441] (-1349.565) -- 0:04:25
142500 -- (-1340.648) [-1343.539] (-1340.848) (-1339.568) * (-1339.937) [-1339.129] (-1336.690) (-1336.634) -- 0:04:24
143000 -- [-1334.514] (-1349.088) (-1334.867) (-1338.607) * [-1336.179] (-1344.028) (-1342.263) (-1338.359) -- 0:04:23
143500 -- (-1337.819) (-1342.091) (-1337.714) [-1340.022] * [-1333.576] (-1345.683) (-1338.892) (-1335.920) -- 0:04:22
144000 -- [-1338.823] (-1345.191) (-1334.862) (-1347.102) * [-1334.973] (-1335.007) (-1340.422) (-1334.595) -- 0:04:21
144500 -- (-1339.200) (-1337.976) [-1333.564] (-1334.156) * [-1335.319] (-1339.148) (-1336.860) (-1340.319) -- 0:04:26
145000 -- (-1346.919) (-1341.894) [-1338.036] (-1335.382) * (-1336.154) (-1345.787) [-1339.939] (-1346.198) -- 0:04:25
Average standard deviation of split frequencies: 0.013319
145500 -- (-1341.107) [-1336.735] (-1336.960) (-1339.835) * (-1342.079) [-1334.032] (-1336.641) (-1335.802) -- 0:04:24
146000 -- (-1345.490) (-1342.973) [-1338.613] (-1340.480) * (-1342.793) (-1336.631) [-1337.838] (-1343.013) -- 0:04:23
146500 -- (-1335.253) (-1338.134) (-1333.890) [-1338.944] * [-1340.941] (-1338.287) (-1338.790) (-1340.794) -- 0:04:22
147000 -- [-1338.648] (-1338.482) (-1353.105) (-1334.035) * (-1345.839) [-1332.550] (-1341.217) (-1343.365) -- 0:04:21
147500 -- (-1339.237) (-1345.235) (-1337.832) [-1340.956] * (-1338.664) [-1333.506] (-1342.762) (-1339.329) -- 0:04:20
148000 -- [-1332.701] (-1335.180) (-1339.607) (-1331.307) * [-1341.206] (-1337.655) (-1340.463) (-1339.241) -- 0:04:24
148500 -- [-1333.816] (-1341.784) (-1340.704) (-1337.326) * [-1339.188] (-1336.109) (-1337.861) (-1347.464) -- 0:04:23
149000 -- (-1347.220) (-1343.962) [-1339.149] (-1348.267) * (-1332.836) (-1339.465) (-1342.728) [-1335.279] -- 0:04:22
149500 -- (-1338.082) [-1349.127] (-1336.894) (-1338.870) * [-1333.514] (-1344.638) (-1344.317) (-1344.126) -- 0:04:21
150000 -- (-1344.691) (-1341.659) [-1333.764] (-1343.762) * (-1347.884) [-1336.384] (-1339.696) (-1335.735) -- 0:04:20
Average standard deviation of split frequencies: 0.012515
150500 -- [-1334.770] (-1339.073) (-1331.598) (-1337.902) * (-1341.017) [-1335.628] (-1348.367) (-1340.057) -- 0:04:19
151000 -- (-1336.540) (-1341.070) (-1335.097) [-1333.478] * (-1344.532) (-1335.616) (-1344.088) [-1342.249] -- 0:04:24
151500 -- (-1337.630) (-1345.555) (-1347.618) [-1333.329] * (-1338.010) [-1338.383] (-1349.381) (-1349.016) -- 0:04:23
152000 -- (-1346.122) (-1336.781) [-1338.891] (-1335.397) * (-1337.063) (-1344.790) (-1339.796) [-1343.510] -- 0:04:22
152500 -- [-1337.753] (-1341.179) (-1345.479) (-1342.324) * (-1339.751) [-1335.086] (-1345.880) (-1340.619) -- 0:04:21
153000 -- [-1334.590] (-1333.686) (-1345.966) (-1345.232) * (-1347.975) (-1337.278) (-1350.669) [-1336.406] -- 0:04:20
153500 -- (-1338.947) (-1337.595) [-1339.336] (-1341.757) * [-1335.940] (-1340.884) (-1343.811) (-1336.879) -- 0:04:19
154000 -- [-1332.347] (-1337.626) (-1343.772) (-1333.291) * [-1338.143] (-1339.886) (-1338.225) (-1336.960) -- 0:04:23
154500 -- (-1334.937) (-1336.748) (-1334.089) [-1336.228] * [-1333.500] (-1341.832) (-1344.117) (-1339.067) -- 0:04:22
155000 -- [-1338.099] (-1344.150) (-1340.914) (-1339.134) * (-1340.999) [-1332.530] (-1349.833) (-1338.910) -- 0:04:21
Average standard deviation of split frequencies: 0.011332
155500 -- [-1335.606] (-1338.154) (-1340.173) (-1333.326) * [-1342.684] (-1350.017) (-1347.295) (-1338.896) -- 0:04:20
156000 -- (-1341.810) (-1340.156) [-1334.078] (-1346.988) * [-1341.946] (-1345.001) (-1339.972) (-1336.534) -- 0:04:19
156500 -- (-1339.886) (-1342.486) [-1333.354] (-1337.772) * (-1335.012) (-1336.456) (-1340.867) [-1343.335] -- 0:04:18
157000 -- (-1339.255) [-1333.779] (-1349.548) (-1330.274) * (-1340.414) [-1339.249] (-1335.138) (-1332.576) -- 0:04:17
157500 -- (-1336.404) (-1332.692) [-1343.838] (-1347.139) * (-1355.615) [-1338.832] (-1333.497) (-1336.556) -- 0:04:22
158000 -- (-1339.707) [-1335.978] (-1350.333) (-1346.202) * (-1337.703) (-1331.241) [-1335.511] (-1339.323) -- 0:04:21
158500 -- [-1336.090] (-1336.317) (-1342.715) (-1338.176) * (-1350.029) (-1340.897) (-1336.337) [-1340.385] -- 0:04:20
159000 -- [-1332.050] (-1343.354) (-1347.121) (-1335.104) * (-1346.400) (-1332.064) [-1336.986] (-1339.298) -- 0:04:19
159500 -- (-1336.698) [-1336.343] (-1336.441) (-1338.848) * (-1344.052) [-1334.743] (-1342.353) (-1331.849) -- 0:04:18
160000 -- (-1340.559) (-1338.643) (-1344.732) [-1341.471] * (-1342.897) (-1338.266) [-1337.293] (-1337.177) -- 0:04:17
Average standard deviation of split frequencies: 0.009536
160500 -- [-1339.614] (-1347.224) (-1341.095) (-1344.311) * (-1346.192) (-1341.021) [-1338.593] (-1343.565) -- 0:04:16
161000 -- (-1334.926) [-1333.346] (-1347.534) (-1346.918) * (-1339.068) [-1332.961] (-1339.779) (-1344.023) -- 0:04:20
161500 -- (-1342.801) [-1333.361] (-1343.730) (-1340.593) * (-1343.573) [-1336.995] (-1339.439) (-1333.962) -- 0:04:19
162000 -- [-1342.322] (-1346.724) (-1343.489) (-1334.100) * (-1340.654) [-1340.450] (-1334.807) (-1344.947) -- 0:04:18
162500 -- [-1337.435] (-1333.389) (-1337.633) (-1343.027) * (-1339.363) (-1345.906) (-1339.423) [-1335.832] -- 0:04:17
163000 -- [-1337.853] (-1334.512) (-1342.148) (-1335.020) * (-1340.738) [-1338.280] (-1339.353) (-1346.297) -- 0:04:16
163500 -- [-1338.753] (-1339.000) (-1340.583) (-1342.318) * (-1344.052) [-1339.700] (-1339.205) (-1345.423) -- 0:04:15
164000 -- (-1344.961) (-1339.778) [-1339.257] (-1350.263) * (-1344.862) [-1342.247] (-1351.194) (-1335.393) -- 0:04:19
164500 -- (-1338.514) (-1334.974) [-1343.881] (-1350.237) * (-1340.114) [-1333.987] (-1344.131) (-1340.144) -- 0:04:19
165000 -- (-1340.494) (-1333.150) (-1340.817) [-1336.892] * (-1343.955) [-1331.082] (-1344.203) (-1332.495) -- 0:04:18
Average standard deviation of split frequencies: 0.008164
165500 -- [-1333.720] (-1335.941) (-1333.673) (-1339.362) * (-1340.770) (-1337.157) [-1333.456] (-1338.555) -- 0:04:17
166000 -- (-1339.505) (-1345.809) (-1341.652) [-1338.378] * (-1344.549) (-1342.797) (-1334.628) [-1339.528] -- 0:04:16
166500 -- (-1336.841) [-1341.209] (-1339.834) (-1341.220) * (-1339.206) (-1344.046) (-1337.604) [-1336.259] -- 0:04:15
167000 -- (-1336.213) (-1333.354) [-1339.346] (-1341.873) * [-1340.902] (-1339.068) (-1346.710) (-1346.893) -- 0:04:14
167500 -- (-1338.310) (-1338.599) [-1341.965] (-1346.690) * [-1338.024] (-1335.669) (-1335.578) (-1339.889) -- 0:04:18
168000 -- (-1337.823) (-1343.383) [-1339.465] (-1343.988) * (-1345.337) (-1343.611) (-1339.331) [-1339.138] -- 0:04:17
168500 -- (-1337.268) (-1339.298) [-1338.124] (-1345.037) * (-1341.959) (-1333.998) [-1338.548] (-1338.617) -- 0:04:16
169000 -- (-1338.155) (-1337.450) [-1334.332] (-1340.371) * (-1344.565) (-1347.289) (-1338.737) [-1335.524] -- 0:04:15
169500 -- (-1345.896) [-1335.686] (-1339.273) (-1338.809) * [-1337.487] (-1340.451) (-1335.993) (-1336.701) -- 0:04:14
170000 -- (-1339.186) (-1342.813) (-1338.202) [-1337.461] * (-1337.914) (-1342.541) [-1339.534] (-1335.711) -- 0:04:13
Average standard deviation of split frequencies: 0.008977
170500 -- (-1337.142) [-1334.345] (-1335.450) (-1351.029) * [-1343.217] (-1337.377) (-1336.051) (-1340.454) -- 0:04:12
171000 -- (-1340.970) (-1338.969) [-1336.558] (-1338.468) * (-1333.065) (-1340.921) (-1339.878) [-1332.889] -- 0:04:16
171500 -- (-1338.652) (-1332.965) [-1342.873] (-1337.231) * (-1332.167) (-1336.426) [-1333.003] (-1335.821) -- 0:04:16
172000 -- (-1333.338) [-1332.069] (-1346.795) (-1338.373) * (-1335.636) [-1339.881] (-1344.545) (-1337.456) -- 0:04:15
172500 -- (-1334.935) (-1336.629) (-1344.271) [-1333.171] * [-1338.585] (-1340.891) (-1348.113) (-1338.651) -- 0:04:14
173000 -- (-1339.849) [-1332.515] (-1352.417) (-1333.694) * (-1338.172) (-1338.448) (-1339.806) [-1335.702] -- 0:04:13
173500 -- (-1340.136) (-1342.217) (-1345.740) [-1333.473] * (-1333.711) (-1345.341) [-1339.803] (-1337.716) -- 0:04:12
174000 -- (-1346.092) (-1336.582) (-1347.433) [-1341.192] * (-1342.416) (-1333.001) (-1333.830) [-1335.337] -- 0:04:11
174500 -- [-1340.097] (-1335.101) (-1339.789) (-1343.136) * (-1338.181) (-1338.695) (-1341.618) [-1332.929] -- 0:04:15
175000 -- (-1345.939) [-1338.116] (-1337.358) (-1342.974) * (-1339.869) (-1335.725) (-1343.668) [-1335.354] -- 0:04:14
Average standard deviation of split frequencies: 0.014397
175500 -- (-1333.451) (-1336.729) [-1336.157] (-1336.859) * [-1342.446] (-1347.269) (-1351.583) (-1337.066) -- 0:04:13
176000 -- (-1341.503) (-1331.400) (-1346.299) [-1341.130] * (-1331.217) (-1339.302) (-1344.266) [-1341.672] -- 0:04:12
176500 -- (-1335.406) [-1340.890] (-1338.969) (-1339.351) * (-1338.097) [-1337.153] (-1336.923) (-1338.602) -- 0:04:11
177000 -- (-1338.401) [-1339.968] (-1345.318) (-1339.889) * (-1333.524) (-1335.180) (-1337.293) [-1332.208] -- 0:04:11
177500 -- [-1338.888] (-1340.566) (-1336.954) (-1336.348) * [-1329.657] (-1345.148) (-1338.454) (-1339.819) -- 0:04:14
178000 -- (-1339.439) (-1333.748) [-1337.339] (-1337.905) * (-1335.181) (-1344.096) [-1338.670] (-1336.966) -- 0:04:13
178500 -- (-1343.984) (-1345.880) [-1344.963] (-1341.266) * (-1343.662) (-1355.484) (-1338.416) [-1334.551] -- 0:04:13
179000 -- (-1332.567) (-1333.010) (-1354.159) [-1332.099] * [-1336.969] (-1342.439) (-1337.790) (-1338.200) -- 0:04:12
179500 -- (-1334.866) (-1343.240) (-1351.578) [-1342.670] * (-1334.999) (-1347.265) [-1340.655] (-1344.073) -- 0:04:11
180000 -- [-1332.158] (-1340.999) (-1345.933) (-1339.771) * (-1339.204) [-1341.838] (-1346.499) (-1347.187) -- 0:04:10
Average standard deviation of split frequencies: 0.013699
180500 -- (-1336.956) (-1339.474) (-1342.052) [-1340.090] * [-1338.348] (-1332.455) (-1339.631) (-1337.482) -- 0:04:09
181000 -- [-1341.701] (-1336.492) (-1340.537) (-1335.762) * (-1343.689) [-1338.248] (-1339.430) (-1348.052) -- 0:04:13
181500 -- (-1338.751) (-1345.625) (-1339.354) [-1335.671] * [-1334.095] (-1340.384) (-1336.287) (-1347.431) -- 0:04:12
182000 -- (-1342.353) (-1333.667) (-1344.532) [-1339.208] * [-1337.982] (-1339.204) (-1334.566) (-1332.071) -- 0:04:11
182500 -- (-1337.736) [-1338.556] (-1340.080) (-1340.309) * (-1340.345) (-1338.821) (-1336.872) [-1338.847] -- 0:04:10
183000 -- [-1334.434] (-1335.446) (-1341.763) (-1336.545) * [-1341.800] (-1332.372) (-1337.512) (-1338.461) -- 0:04:10
183500 -- (-1344.315) [-1336.679] (-1336.396) (-1341.285) * [-1343.709] (-1341.339) (-1340.473) (-1341.719) -- 0:04:09
184000 -- [-1340.748] (-1340.541) (-1333.652) (-1339.966) * (-1333.365) [-1337.898] (-1337.283) (-1338.551) -- 0:04:08
184500 -- (-1336.325) (-1340.684) [-1336.822] (-1335.889) * (-1343.582) (-1339.067) (-1345.069) [-1339.892] -- 0:04:11
185000 -- (-1342.151) [-1336.715] (-1335.402) (-1336.028) * (-1343.290) [-1335.092] (-1341.018) (-1338.585) -- 0:04:11
Average standard deviation of split frequencies: 0.013939
185500 -- [-1336.036] (-1339.142) (-1343.699) (-1342.187) * (-1340.167) [-1342.822] (-1337.970) (-1337.856) -- 0:04:10
186000 -- (-1340.180) (-1344.711) [-1337.824] (-1338.871) * (-1348.998) [-1339.019] (-1342.039) (-1340.591) -- 0:04:09
186500 -- (-1341.775) [-1335.768] (-1333.893) (-1336.562) * [-1337.018] (-1339.627) (-1339.893) (-1337.081) -- 0:04:08
187000 -- (-1338.424) (-1335.666) (-1340.203) [-1335.472] * (-1339.170) (-1344.032) (-1339.301) [-1335.806] -- 0:04:07
187500 -- [-1331.988] (-1333.275) (-1338.155) (-1341.274) * (-1337.269) (-1346.268) [-1338.905] (-1334.984) -- 0:04:11
188000 -- [-1335.683] (-1342.428) (-1342.801) (-1337.100) * (-1346.696) (-1338.399) (-1345.107) [-1337.103] -- 0:04:10
188500 -- [-1335.494] (-1337.330) (-1338.424) (-1340.428) * (-1340.409) [-1339.901] (-1340.041) (-1337.714) -- 0:04:09
189000 -- (-1334.920) [-1341.495] (-1341.443) (-1336.984) * (-1341.096) (-1338.187) [-1341.175] (-1340.003) -- 0:04:08
189500 -- [-1337.791] (-1344.225) (-1337.416) (-1336.872) * (-1335.169) [-1335.952] (-1341.109) (-1343.112) -- 0:04:08
190000 -- [-1335.562] (-1339.950) (-1345.043) (-1340.991) * (-1336.367) [-1340.098] (-1340.977) (-1339.256) -- 0:04:07
Average standard deviation of split frequencies: 0.013598
190500 -- (-1333.151) (-1343.901) [-1337.295] (-1339.327) * [-1339.133] (-1335.300) (-1344.958) (-1338.734) -- 0:04:06
191000 -- [-1337.702] (-1344.017) (-1337.706) (-1343.608) * (-1333.720) (-1335.205) (-1340.642) [-1332.224] -- 0:04:09
191500 -- (-1349.914) (-1348.517) [-1331.831] (-1337.203) * [-1339.660] (-1334.628) (-1346.287) (-1335.828) -- 0:04:09
192000 -- (-1338.794) (-1345.211) [-1339.082] (-1332.066) * (-1345.932) [-1339.482] (-1347.692) (-1332.842) -- 0:04:08
192500 -- (-1341.278) (-1343.019) (-1339.740) [-1337.346] * (-1339.888) [-1342.815] (-1340.170) (-1335.761) -- 0:04:07
193000 -- (-1344.230) (-1352.233) [-1338.508] (-1333.341) * [-1345.125] (-1337.066) (-1335.419) (-1341.599) -- 0:04:06
193500 -- [-1331.019] (-1338.547) (-1348.873) (-1338.010) * (-1345.879) (-1340.947) (-1337.242) [-1335.161] -- 0:04:05
194000 -- [-1340.060] (-1348.800) (-1345.126) (-1339.005) * (-1337.329) [-1337.918] (-1337.233) (-1335.149) -- 0:04:05
194500 -- (-1340.599) [-1345.877] (-1348.443) (-1337.802) * (-1340.715) [-1343.466] (-1336.449) (-1340.166) -- 0:04:08
195000 -- (-1332.515) (-1342.026) [-1337.904] (-1341.495) * (-1335.466) [-1332.921] (-1344.810) (-1341.811) -- 0:04:07
Average standard deviation of split frequencies: 0.015805
195500 -- (-1337.243) [-1331.537] (-1340.478) (-1344.632) * [-1334.905] (-1338.252) (-1341.222) (-1341.767) -- 0:04:06
196000 -- [-1339.561] (-1335.517) (-1337.141) (-1336.105) * (-1338.516) [-1346.752] (-1342.430) (-1340.641) -- 0:04:06
196500 -- (-1334.395) [-1337.496] (-1340.698) (-1339.762) * (-1338.534) (-1344.158) (-1351.431) [-1335.897] -- 0:04:05
197000 -- (-1344.708) [-1337.422] (-1340.582) (-1344.465) * (-1337.099) (-1344.398) (-1335.258) [-1339.421] -- 0:04:04
197500 -- (-1336.163) (-1343.502) (-1333.307) [-1336.253] * (-1339.398) (-1347.450) (-1353.692) [-1341.799] -- 0:04:03
198000 -- [-1342.885] (-1339.148) (-1339.759) (-1342.413) * (-1343.553) [-1345.326] (-1338.937) (-1339.414) -- 0:04:07
198500 -- (-1346.316) (-1341.539) (-1340.454) [-1338.959] * (-1343.515) (-1337.913) (-1341.196) [-1338.030] -- 0:04:06
199000 -- (-1339.814) (-1335.665) [-1344.532] (-1338.886) * (-1342.720) [-1335.959] (-1338.703) (-1335.435) -- 0:04:05
199500 -- (-1336.933) (-1346.035) [-1338.403] (-1346.173) * (-1344.917) [-1334.543] (-1347.641) (-1338.093) -- 0:04:04
200000 -- (-1334.851) (-1345.877) [-1338.600] (-1336.099) * (-1337.050) (-1342.253) (-1346.312) [-1338.244] -- 0:04:04
Average standard deviation of split frequencies: 0.015438
200500 -- (-1337.461) [-1339.854] (-1338.732) (-1343.896) * (-1339.351) [-1339.984] (-1340.587) (-1345.164) -- 0:04:03
201000 -- [-1336.643] (-1332.820) (-1341.122) (-1341.107) * [-1335.773] (-1339.447) (-1345.997) (-1338.841) -- 0:04:06
201500 -- (-1337.498) (-1334.244) [-1335.635] (-1344.852) * [-1335.623] (-1344.708) (-1344.889) (-1339.698) -- 0:04:05
202000 -- (-1339.819) [-1338.457] (-1334.838) (-1340.987) * (-1342.921) (-1348.315) (-1346.604) [-1341.679] -- 0:04:04
202500 -- [-1336.799] (-1332.758) (-1338.734) (-1349.448) * (-1342.953) (-1348.065) [-1335.801] (-1351.562) -- 0:04:04
203000 -- (-1337.039) [-1340.314] (-1336.126) (-1341.205) * [-1338.636] (-1337.191) (-1349.547) (-1346.079) -- 0:04:03
203500 -- (-1338.894) (-1337.139) [-1333.727] (-1338.899) * (-1333.003) (-1336.798) (-1338.233) [-1343.769] -- 0:04:02
204000 -- (-1337.945) [-1338.538] (-1337.723) (-1333.039) * (-1339.934) (-1345.563) (-1334.188) [-1333.800] -- 0:04:01
204500 -- [-1339.854] (-1339.041) (-1341.938) (-1335.446) * (-1339.012) [-1336.074] (-1339.641) (-1333.621) -- 0:04:05
205000 -- (-1337.997) [-1332.434] (-1347.158) (-1340.747) * (-1335.145) [-1337.020] (-1337.479) (-1335.792) -- 0:04:04
Average standard deviation of split frequencies: 0.013076
205500 -- [-1337.009] (-1348.799) (-1335.086) (-1348.393) * [-1334.129] (-1338.920) (-1337.975) (-1338.219) -- 0:04:03
206000 -- (-1334.685) (-1345.361) (-1330.637) [-1344.908] * (-1334.312) (-1336.879) (-1336.536) [-1337.468] -- 0:04:02
206500 -- [-1344.781] (-1335.407) (-1337.580) (-1337.387) * [-1336.725] (-1346.809) (-1340.316) (-1339.404) -- 0:04:02
207000 -- (-1342.327) (-1346.358) [-1336.379] (-1337.913) * (-1348.469) (-1336.662) [-1338.626] (-1338.998) -- 0:04:01
207500 -- [-1342.344] (-1339.677) (-1337.102) (-1341.434) * (-1351.167) (-1341.197) (-1339.972) [-1332.304] -- 0:04:00
208000 -- (-1347.164) [-1336.289] (-1338.159) (-1339.531) * (-1343.565) [-1333.777] (-1340.006) (-1334.710) -- 0:04:03
208500 -- (-1345.219) (-1337.093) (-1342.422) [-1336.751] * (-1336.951) [-1336.598] (-1344.230) (-1338.099) -- 0:04:02
209000 -- [-1354.910] (-1342.957) (-1339.947) (-1345.661) * (-1347.283) (-1333.583) [-1340.890] (-1338.664) -- 0:04:02
209500 -- (-1335.744) [-1337.630] (-1338.686) (-1341.049) * (-1341.933) (-1333.348) (-1336.738) [-1337.472] -- 0:04:01
210000 -- [-1334.612] (-1334.639) (-1344.074) (-1340.595) * (-1338.378) (-1336.444) [-1342.178] (-1342.475) -- 0:04:00
Average standard deviation of split frequencies: 0.011508
210500 -- [-1337.372] (-1337.518) (-1343.221) (-1343.669) * (-1352.025) (-1337.504) [-1337.407] (-1339.020) -- 0:04:00
211000 -- (-1337.438) [-1333.971] (-1331.730) (-1335.629) * (-1338.811) [-1337.394] (-1336.804) (-1338.421) -- 0:04:03
211500 -- (-1336.814) (-1340.520) [-1334.308] (-1336.820) * [-1333.625] (-1335.633) (-1340.339) (-1341.864) -- 0:04:02
212000 -- [-1346.209] (-1341.064) (-1339.872) (-1336.314) * (-1335.584) (-1337.099) [-1338.782] (-1340.216) -- 0:04:01
212500 -- (-1339.169) [-1330.129] (-1342.048) (-1332.467) * [-1342.340] (-1342.559) (-1340.578) (-1335.330) -- 0:04:00
213000 -- (-1345.378) (-1333.744) [-1335.023] (-1334.500) * (-1341.383) (-1339.385) [-1336.683] (-1347.177) -- 0:04:00
213500 -- (-1341.580) (-1332.318) [-1335.013] (-1336.350) * (-1335.108) (-1340.382) [-1338.694] (-1337.104) -- 0:03:59
214000 -- (-1340.875) (-1337.429) [-1340.641] (-1333.370) * (-1335.949) [-1337.954] (-1331.510) (-1335.998) -- 0:03:58
214500 -- (-1343.866) [-1336.454] (-1335.107) (-1344.619) * (-1339.504) (-1337.672) [-1337.383] (-1338.563) -- 0:04:01
215000 -- (-1334.697) (-1341.703) (-1355.466) [-1344.107] * (-1347.132) (-1334.873) [-1340.119] (-1331.839) -- 0:04:00
Average standard deviation of split frequencies: 0.010912
215500 -- (-1335.855) (-1342.718) [-1332.557] (-1341.815) * (-1334.626) [-1336.009] (-1339.503) (-1338.496) -- 0:04:00
216000 -- [-1334.313] (-1338.755) (-1336.427) (-1341.482) * [-1342.176] (-1335.415) (-1339.858) (-1350.895) -- 0:03:59
216500 -- (-1341.421) (-1351.031) (-1330.441) [-1335.252] * (-1338.855) (-1339.321) [-1343.931] (-1343.432) -- 0:03:58
217000 -- (-1343.850) [-1342.108] (-1343.590) (-1334.177) * (-1350.369) (-1341.781) [-1333.016] (-1346.021) -- 0:03:58
217500 -- (-1343.304) (-1342.434) [-1335.098] (-1338.601) * (-1336.124) [-1338.557] (-1336.831) (-1339.593) -- 0:03:57
218000 -- (-1349.101) [-1340.143] (-1341.538) (-1335.704) * [-1333.795] (-1335.637) (-1340.322) (-1341.395) -- 0:04:00
218500 -- (-1343.778) (-1342.480) [-1339.739] (-1335.860) * (-1346.925) (-1337.169) [-1334.618] (-1340.040) -- 0:03:59
219000 -- (-1336.694) [-1341.643] (-1337.437) (-1338.983) * (-1334.836) (-1335.041) [-1333.956] (-1344.779) -- 0:03:58
219500 -- (-1343.689) [-1332.164] (-1337.798) (-1336.448) * (-1335.691) [-1334.841] (-1336.273) (-1339.558) -- 0:03:58
220000 -- (-1340.222) [-1339.796] (-1336.714) (-1337.159) * (-1338.059) [-1340.784] (-1334.218) (-1335.983) -- 0:03:57
Average standard deviation of split frequencies: 0.012818
220500 -- (-1336.096) [-1339.292] (-1338.689) (-1340.685) * (-1341.361) (-1337.817) [-1334.479] (-1345.176) -- 0:03:56
221000 -- (-1337.337) [-1337.246] (-1334.812) (-1340.013) * [-1336.585] (-1350.449) (-1333.702) (-1338.163) -- 0:03:59
221500 -- (-1337.831) (-1342.390) [-1335.943] (-1343.118) * [-1335.408] (-1336.919) (-1338.965) (-1337.115) -- 0:03:58
222000 -- (-1349.142) (-1341.676) (-1339.573) [-1341.298] * [-1338.594] (-1338.314) (-1341.636) (-1338.674) -- 0:03:58
222500 -- [-1337.164] (-1347.777) (-1341.392) (-1335.981) * (-1340.243) [-1333.208] (-1339.192) (-1335.511) -- 0:03:57
223000 -- (-1340.618) (-1337.829) [-1336.473] (-1337.146) * [-1336.462] (-1343.442) (-1340.641) (-1346.297) -- 0:03:56
223500 -- (-1336.188) (-1341.314) (-1336.395) [-1338.285] * (-1342.446) (-1346.091) (-1341.679) [-1335.916] -- 0:03:56
224000 -- (-1355.641) (-1339.684) [-1332.869] (-1336.911) * (-1334.682) (-1338.680) (-1336.959) [-1335.861] -- 0:03:55
224500 -- (-1338.929) [-1337.906] (-1338.252) (-1336.693) * (-1343.582) (-1335.262) (-1336.010) [-1333.388] -- 0:03:58
225000 -- (-1342.456) [-1333.888] (-1337.582) (-1335.589) * [-1336.232] (-1340.699) (-1335.612) (-1355.611) -- 0:03:57
Average standard deviation of split frequencies: 0.015495
225500 -- (-1335.893) (-1335.167) [-1344.887] (-1337.381) * (-1332.391) (-1343.491) (-1342.464) [-1335.253] -- 0:03:56
226000 -- (-1341.178) (-1337.083) (-1347.421) [-1334.579] * (-1334.702) (-1348.247) [-1336.386] (-1338.299) -- 0:03:56
226500 -- (-1343.219) (-1338.606) (-1346.115) [-1335.245] * (-1342.837) (-1339.752) (-1338.505) [-1339.041] -- 0:03:55
227000 -- (-1335.998) [-1342.502] (-1344.445) (-1336.615) * (-1345.690) (-1333.580) [-1340.490] (-1338.691) -- 0:03:54
227500 -- (-1331.689) [-1339.157] (-1346.491) (-1343.686) * (-1339.567) [-1335.964] (-1337.514) (-1343.011) -- 0:03:54
228000 -- (-1333.873) (-1339.589) [-1332.993] (-1338.539) * [-1338.285] (-1335.445) (-1336.754) (-1343.902) -- 0:03:57
228500 -- (-1333.680) (-1339.560) [-1332.800] (-1337.460) * (-1339.140) (-1338.592) [-1334.697] (-1338.004) -- 0:03:56
229000 -- (-1338.228) [-1340.360] (-1337.479) (-1342.373) * (-1330.468) [-1331.881] (-1335.895) (-1336.200) -- 0:03:55
229500 -- [-1336.012] (-1339.800) (-1338.882) (-1340.994) * (-1332.017) (-1337.256) [-1331.462] (-1339.942) -- 0:03:55
230000 -- (-1334.440) (-1338.668) [-1340.217] (-1340.703) * (-1338.241) (-1339.482) [-1333.369] (-1339.564) -- 0:03:54
Average standard deviation of split frequencies: 0.014598
230500 -- (-1351.294) [-1336.704] (-1335.622) (-1343.242) * (-1339.070) (-1340.217) [-1344.614] (-1341.645) -- 0:03:53
231000 -- (-1339.600) (-1339.561) [-1336.498] (-1345.672) * (-1334.167) [-1336.560] (-1342.203) (-1347.866) -- 0:03:53
231500 -- (-1334.647) (-1339.856) (-1340.258) [-1334.853] * [-1333.789] (-1339.610) (-1337.285) (-1342.991) -- 0:03:55
232000 -- (-1342.856) (-1339.365) (-1343.424) [-1330.741] * [-1338.347] (-1337.199) (-1337.979) (-1343.386) -- 0:03:55
232500 -- [-1336.403] (-1339.347) (-1346.466) (-1341.119) * (-1337.171) [-1337.348] (-1333.677) (-1336.666) -- 0:03:54
233000 -- (-1332.908) (-1356.579) [-1338.695] (-1339.971) * (-1345.016) (-1343.211) [-1339.728] (-1338.858) -- 0:03:53
233500 -- (-1340.337) (-1342.728) [-1334.092] (-1336.543) * (-1352.799) (-1343.292) (-1337.377) [-1331.681] -- 0:03:53
234000 -- [-1336.726] (-1336.207) (-1341.239) (-1334.511) * [-1347.663] (-1339.142) (-1338.924) (-1338.509) -- 0:03:52
234500 -- (-1341.118) [-1338.347] (-1337.356) (-1344.236) * (-1340.555) (-1334.705) [-1334.687] (-1336.641) -- 0:03:55
235000 -- (-1334.335) [-1336.015] (-1336.421) (-1344.674) * [-1331.781] (-1332.306) (-1343.901) (-1336.552) -- 0:03:54
Average standard deviation of split frequencies: 0.013982
235500 -- (-1340.885) (-1330.953) [-1333.909] (-1342.966) * (-1336.544) (-1335.012) (-1341.089) [-1335.767] -- 0:03:53
236000 -- (-1343.032) (-1338.544) (-1335.752) [-1332.780] * (-1339.583) (-1341.617) (-1334.740) [-1338.929] -- 0:03:53
236500 -- (-1346.439) (-1332.357) [-1342.057] (-1338.798) * (-1345.636) (-1346.745) (-1334.499) [-1340.927] -- 0:03:52
237000 -- (-1346.617) (-1347.970) (-1346.331) [-1343.867] * (-1339.274) (-1342.165) [-1330.797] (-1340.902) -- 0:03:51
237500 -- (-1348.367) (-1343.304) (-1345.939) [-1329.942] * (-1347.590) [-1335.177] (-1340.175) (-1340.212) -- 0:03:51
238000 -- (-1340.711) [-1339.517] (-1342.756) (-1336.077) * (-1346.289) [-1334.468] (-1334.976) (-1340.303) -- 0:03:53
238500 -- (-1338.913) (-1336.692) [-1342.340] (-1339.688) * [-1343.275] (-1334.575) (-1333.742) (-1336.871) -- 0:03:53
239000 -- (-1339.069) [-1341.076] (-1345.150) (-1333.124) * (-1342.180) (-1341.067) [-1341.361] (-1341.696) -- 0:03:52
239500 -- [-1341.594] (-1337.146) (-1331.560) (-1340.258) * [-1345.086] (-1346.108) (-1332.935) (-1341.103) -- 0:03:51
240000 -- (-1336.222) (-1338.144) (-1337.003) [-1337.008] * (-1342.406) (-1341.200) (-1334.557) [-1339.918] -- 0:03:51
Average standard deviation of split frequencies: 0.013711
240500 -- (-1332.134) (-1342.429) [-1334.146] (-1339.477) * (-1338.168) [-1348.250] (-1341.756) (-1335.871) -- 0:03:50
241000 -- (-1338.431) (-1344.074) (-1338.369) [-1343.468] * (-1337.768) [-1341.586] (-1329.239) (-1336.703) -- 0:03:49
241500 -- (-1339.189) (-1340.179) [-1334.417] (-1346.673) * (-1340.225) (-1343.817) [-1335.525] (-1347.613) -- 0:03:52
242000 -- (-1337.940) (-1350.218) [-1343.683] (-1343.435) * [-1331.848] (-1346.436) (-1337.712) (-1342.882) -- 0:03:51
242500 -- (-1339.607) (-1345.476) [-1337.300] (-1337.711) * (-1346.394) (-1337.943) (-1333.908) [-1339.659] -- 0:03:51
243000 -- (-1343.057) (-1344.679) (-1333.760) [-1334.408] * [-1339.601] (-1340.405) (-1336.627) (-1342.038) -- 0:03:50
243500 -- (-1332.606) (-1344.948) (-1339.276) [-1336.607] * (-1338.389) [-1334.185] (-1341.657) (-1343.065) -- 0:03:49
244000 -- (-1339.605) (-1342.954) [-1336.286] (-1336.569) * (-1339.122) [-1337.590] (-1335.987) (-1340.745) -- 0:03:49
244500 -- (-1343.167) (-1337.136) (-1342.001) [-1334.885] * (-1350.071) [-1341.060] (-1340.550) (-1336.262) -- 0:03:48
245000 -- (-1333.116) (-1340.526) [-1345.253] (-1339.776) * (-1336.095) (-1340.916) (-1335.172) [-1339.455] -- 0:03:51
Average standard deviation of split frequencies: 0.012593
245500 -- (-1341.563) [-1340.102] (-1346.783) (-1345.506) * (-1344.311) [-1337.436] (-1339.277) (-1344.207) -- 0:03:50
246000 -- (-1344.882) (-1335.730) [-1329.824] (-1332.609) * (-1342.005) (-1343.285) [-1344.223] (-1334.724) -- 0:03:49
246500 -- (-1341.433) [-1337.268] (-1339.090) (-1337.719) * [-1332.029] (-1348.309) (-1340.062) (-1335.751) -- 0:03:49
247000 -- (-1339.231) [-1336.057] (-1337.788) (-1343.334) * (-1332.308) (-1341.117) (-1344.994) [-1333.467] -- 0:03:48
247500 -- (-1337.186) (-1339.073) [-1336.532] (-1339.326) * (-1339.493) (-1338.835) [-1335.070] (-1342.359) -- 0:03:48
248000 -- (-1345.128) [-1335.863] (-1350.269) (-1338.847) * [-1336.852] (-1345.734) (-1343.191) (-1339.492) -- 0:03:50
248500 -- [-1336.890] (-1338.908) (-1349.079) (-1338.803) * (-1337.950) (-1335.347) [-1337.941] (-1336.770) -- 0:03:49
249000 -- [-1337.538] (-1340.353) (-1342.359) (-1343.068) * (-1355.660) (-1336.441) (-1337.496) [-1335.258] -- 0:03:49
249500 -- (-1332.842) (-1334.359) [-1335.083] (-1340.133) * [-1342.241] (-1343.662) (-1334.331) (-1340.355) -- 0:03:48
250000 -- (-1337.300) (-1342.253) [-1332.763] (-1349.535) * [-1343.794] (-1342.124) (-1341.647) (-1344.398) -- 0:03:48
Average standard deviation of split frequencies: 0.013433
250500 -- [-1335.743] (-1335.700) (-1338.739) (-1333.463) * (-1341.277) [-1340.917] (-1333.447) (-1349.384) -- 0:03:47
251000 -- (-1341.024) [-1338.397] (-1338.538) (-1335.650) * [-1335.185] (-1337.413) (-1336.111) (-1346.063) -- 0:03:46
251500 -- (-1337.591) (-1351.283) [-1337.563] (-1335.921) * [-1333.352] (-1331.501) (-1346.220) (-1337.325) -- 0:03:49
252000 -- (-1342.110) [-1334.073] (-1345.870) (-1340.799) * (-1339.841) (-1340.697) (-1335.245) [-1338.715] -- 0:03:48
252500 -- (-1335.015) [-1342.906] (-1340.240) (-1345.222) * (-1342.121) (-1337.422) (-1336.349) [-1333.758] -- 0:03:47
253000 -- (-1341.798) [-1338.580] (-1340.890) (-1348.566) * [-1331.640] (-1339.205) (-1330.763) (-1339.730) -- 0:03:47
253500 -- [-1338.902] (-1340.183) (-1339.092) (-1349.305) * (-1338.130) (-1336.212) [-1334.535] (-1342.354) -- 0:03:46
254000 -- (-1331.958) (-1345.406) [-1340.750] (-1342.230) * (-1340.316) [-1333.562] (-1334.114) (-1340.824) -- 0:03:46
254500 -- (-1344.775) (-1338.089) (-1346.057) [-1339.837] * (-1337.510) (-1341.519) [-1334.540] (-1346.052) -- 0:03:45
255000 -- (-1342.842) [-1339.546] (-1341.176) (-1337.480) * (-1343.199) [-1339.387] (-1336.596) (-1354.382) -- 0:03:47
Average standard deviation of split frequencies: 0.013942
255500 -- (-1340.327) (-1341.858) [-1334.411] (-1339.155) * (-1340.233) [-1338.017] (-1346.763) (-1340.639) -- 0:03:47
256000 -- (-1340.043) (-1342.234) [-1339.701] (-1344.300) * [-1338.273] (-1340.854) (-1340.250) (-1335.930) -- 0:03:46
256500 -- (-1338.051) (-1350.330) [-1340.000] (-1331.977) * (-1341.423) (-1337.052) [-1335.674] (-1343.120) -- 0:03:46
257000 -- (-1338.950) [-1335.615] (-1344.943) (-1339.969) * (-1335.277) [-1345.621] (-1335.938) (-1334.984) -- 0:03:45
257500 -- [-1340.063] (-1338.550) (-1343.195) (-1348.149) * [-1336.835] (-1332.910) (-1332.627) (-1345.293) -- 0:03:44
258000 -- (-1341.919) (-1339.302) (-1344.715) [-1331.920] * [-1334.092] (-1344.819) (-1335.645) (-1346.275) -- 0:03:47
258500 -- (-1340.158) [-1338.719] (-1347.058) (-1335.601) * (-1340.525) (-1343.652) (-1337.876) [-1337.352] -- 0:03:46
259000 -- (-1336.408) (-1332.227) (-1343.623) [-1332.518] * [-1337.622] (-1336.786) (-1339.129) (-1337.183) -- 0:03:46
259500 -- (-1341.306) [-1337.040] (-1343.216) (-1342.104) * (-1343.362) [-1342.172] (-1338.738) (-1343.585) -- 0:03:45
260000 -- (-1334.634) [-1336.913] (-1340.151) (-1342.898) * (-1338.525) (-1339.795) (-1334.092) [-1340.016] -- 0:03:44
Average standard deviation of split frequencies: 0.011109
260500 -- (-1339.118) (-1335.431) [-1335.040] (-1338.149) * [-1336.327] (-1334.325) (-1341.390) (-1340.067) -- 0:03:44
261000 -- (-1339.470) (-1346.014) [-1342.896] (-1338.808) * [-1333.828] (-1337.401) (-1348.213) (-1341.349) -- 0:03:43
261500 -- (-1336.963) [-1335.506] (-1333.629) (-1335.074) * [-1335.374] (-1338.482) (-1335.665) (-1336.880) -- 0:03:45
262000 -- (-1331.067) (-1344.874) [-1337.683] (-1345.986) * (-1335.269) (-1333.043) (-1339.224) [-1335.494] -- 0:03:45
262500 -- (-1340.345) [-1344.184] (-1338.728) (-1342.287) * (-1341.487) (-1340.708) [-1337.161] (-1336.993) -- 0:03:44
263000 -- (-1343.673) (-1339.497) (-1333.392) [-1334.335] * (-1341.899) [-1339.417] (-1340.594) (-1341.224) -- 0:03:44
263500 -- (-1335.152) (-1335.799) (-1334.598) [-1339.715] * (-1334.530) (-1344.642) [-1333.623] (-1339.324) -- 0:03:43
264000 -- (-1338.521) (-1340.407) [-1336.445] (-1336.644) * (-1343.948) (-1344.363) (-1343.749) [-1335.700] -- 0:03:43
264500 -- (-1337.996) [-1339.446] (-1340.999) (-1346.499) * [-1341.074] (-1332.918) (-1340.060) (-1341.895) -- 0:03:42
265000 -- (-1337.449) (-1336.751) [-1337.509] (-1342.765) * (-1350.459) (-1336.460) [-1335.897] (-1336.054) -- 0:03:44
Average standard deviation of split frequencies: 0.012405
265500 -- [-1331.254] (-1337.501) (-1340.527) (-1347.420) * (-1342.187) [-1341.001] (-1338.815) (-1342.452) -- 0:03:44
266000 -- (-1337.360) (-1329.698) [-1336.141] (-1340.438) * [-1339.290] (-1336.149) (-1348.895) (-1345.407) -- 0:03:43
266500 -- (-1352.555) [-1333.082] (-1338.590) (-1344.247) * (-1344.568) (-1345.056) [-1338.495] (-1333.157) -- 0:03:42
267000 -- (-1346.725) (-1340.337) [-1336.086] (-1345.464) * (-1343.694) (-1342.602) (-1339.358) [-1338.429] -- 0:03:42
267500 -- (-1345.420) (-1331.378) [-1341.940] (-1340.178) * (-1337.477) [-1338.808] (-1337.077) (-1332.448) -- 0:03:41
268000 -- (-1345.155) (-1337.993) [-1340.572] (-1331.240) * (-1342.057) (-1335.900) [-1333.551] (-1337.628) -- 0:03:41
268500 -- (-1343.025) [-1332.098] (-1334.031) (-1342.588) * (-1341.882) [-1330.203] (-1338.320) (-1339.010) -- 0:03:43
269000 -- [-1340.778] (-1335.185) (-1336.895) (-1333.421) * [-1334.533] (-1336.892) (-1341.076) (-1341.665) -- 0:03:42
269500 -- [-1336.491] (-1339.573) (-1336.270) (-1337.721) * (-1343.081) (-1349.740) [-1336.681] (-1337.885) -- 0:03:42
270000 -- (-1345.184) (-1344.412) [-1338.067] (-1336.302) * [-1339.243] (-1346.415) (-1335.211) (-1340.854) -- 0:03:41
Average standard deviation of split frequencies: 0.013933
270500 -- (-1336.064) [-1342.016] (-1342.341) (-1334.017) * (-1332.569) (-1332.243) [-1340.846] (-1339.600) -- 0:03:41
271000 -- (-1339.869) (-1339.208) [-1340.267] (-1337.464) * (-1342.879) [-1333.796] (-1339.169) (-1334.736) -- 0:03:40
271500 -- (-1337.818) (-1343.733) [-1339.018] (-1331.841) * (-1338.779) (-1340.864) (-1337.904) [-1335.618] -- 0:03:42
272000 -- (-1344.910) (-1347.489) (-1335.681) [-1336.937] * (-1349.868) (-1342.344) (-1338.712) [-1338.301] -- 0:03:42
272500 -- (-1341.908) [-1342.330] (-1337.902) (-1340.570) * (-1340.763) (-1333.696) [-1337.807] (-1345.982) -- 0:03:41
273000 -- [-1339.279] (-1342.460) (-1339.176) (-1334.685) * (-1335.997) (-1342.804) (-1347.788) [-1335.348] -- 0:03:41
273500 -- (-1340.962) (-1337.442) (-1348.114) [-1336.261] * (-1344.942) (-1347.570) (-1345.524) [-1336.716] -- 0:03:40
274000 -- (-1343.145) (-1342.110) [-1337.189] (-1336.984) * (-1338.944) [-1334.615] (-1345.581) (-1334.186) -- 0:03:39
274500 -- (-1340.635) [-1333.618] (-1344.559) (-1337.451) * (-1333.609) [-1334.353] (-1337.096) (-1333.834) -- 0:03:39
275000 -- (-1341.250) (-1340.615) (-1338.578) [-1336.901] * (-1342.033) [-1333.471] (-1342.723) (-1343.530) -- 0:03:41
Average standard deviation of split frequencies: 0.012688
275500 -- (-1333.866) (-1346.561) (-1342.435) [-1333.084] * (-1336.069) (-1340.194) (-1335.767) [-1335.780] -- 0:03:40
276000 -- [-1331.772] (-1340.429) (-1340.715) (-1343.842) * [-1333.369] (-1336.342) (-1334.423) (-1334.417) -- 0:03:40
276500 -- [-1340.021] (-1337.325) (-1343.907) (-1340.781) * [-1340.878] (-1339.004) (-1340.461) (-1337.420) -- 0:03:39
277000 -- [-1342.261] (-1347.221) (-1338.239) (-1341.816) * (-1343.342) (-1335.155) [-1336.331] (-1342.146) -- 0:03:39
277500 -- (-1340.087) (-1338.188) (-1336.498) [-1339.078] * (-1334.020) (-1337.670) [-1337.931] (-1348.187) -- 0:03:38
278000 -- [-1337.799] (-1339.976) (-1334.435) (-1337.421) * (-1342.796) (-1341.607) (-1340.620) [-1337.665] -- 0:03:38
278500 -- (-1335.656) (-1341.469) (-1344.121) [-1332.560] * (-1344.741) (-1343.634) (-1334.750) [-1344.846] -- 0:03:40
279000 -- [-1337.302] (-1343.239) (-1340.641) (-1334.116) * (-1337.880) (-1342.388) (-1345.028) [-1342.228] -- 0:03:39
279500 -- (-1344.507) (-1338.586) [-1338.606] (-1336.799) * (-1341.218) (-1334.742) [-1331.332] (-1330.753) -- 0:03:39
280000 -- (-1341.939) [-1334.691] (-1341.283) (-1344.313) * (-1333.813) [-1333.023] (-1333.181) (-1333.117) -- 0:03:38
Average standard deviation of split frequencies: 0.012717
280500 -- (-1341.134) [-1336.368] (-1337.507) (-1339.433) * (-1341.574) (-1347.553) (-1338.918) [-1338.230] -- 0:03:38
281000 -- [-1335.686] (-1336.084) (-1331.301) (-1352.610) * [-1335.946] (-1346.945) (-1333.547) (-1335.063) -- 0:03:37
281500 -- (-1345.335) (-1343.794) (-1350.029) [-1334.090] * (-1338.925) (-1345.037) (-1333.353) [-1338.253] -- 0:03:36
282000 -- [-1342.452] (-1344.048) (-1344.545) (-1338.112) * (-1345.180) (-1346.553) [-1338.682] (-1340.079) -- 0:03:38
282500 -- (-1339.412) [-1342.584] (-1342.772) (-1334.559) * (-1339.499) [-1336.865] (-1336.537) (-1339.785) -- 0:03:38
283000 -- (-1339.326) (-1338.667) (-1336.518) [-1335.768] * (-1334.378) (-1342.450) [-1338.724] (-1334.433) -- 0:03:37
283500 -- (-1341.720) (-1344.572) [-1341.341] (-1332.028) * [-1333.131] (-1337.701) (-1336.505) (-1333.988) -- 0:03:37
284000 -- (-1342.788) (-1334.919) [-1336.646] (-1336.510) * (-1346.161) [-1334.971] (-1335.208) (-1338.463) -- 0:03:36
284500 -- (-1339.882) (-1343.039) [-1336.870] (-1336.550) * [-1340.522] (-1337.740) (-1333.975) (-1339.609) -- 0:03:36
285000 -- (-1342.835) [-1333.939] (-1338.096) (-1341.415) * (-1335.376) [-1338.397] (-1334.581) (-1337.905) -- 0:03:38
Average standard deviation of split frequencies: 0.012009
285500 -- (-1342.879) [-1333.816] (-1339.262) (-1336.471) * (-1333.232) (-1342.021) (-1339.118) [-1334.568] -- 0:03:37
286000 -- (-1341.807) (-1336.083) (-1342.209) [-1341.300] * (-1342.042) (-1346.499) (-1333.172) [-1338.806] -- 0:03:37
286500 -- (-1340.199) [-1334.036] (-1339.583) (-1332.379) * (-1340.734) (-1343.971) [-1333.897] (-1347.714) -- 0:03:36
287000 -- [-1333.193] (-1341.106) (-1338.052) (-1335.391) * (-1340.010) (-1335.369) (-1338.745) [-1334.271] -- 0:03:36
287500 -- [-1336.471] (-1337.528) (-1339.336) (-1341.239) * [-1340.461] (-1346.742) (-1335.033) (-1343.870) -- 0:03:35
288000 -- [-1336.009] (-1335.753) (-1343.832) (-1343.500) * [-1337.513] (-1338.204) (-1339.717) (-1336.907) -- 0:03:35
288500 -- (-1338.418) (-1345.830) [-1337.390] (-1341.106) * (-1343.195) [-1330.466] (-1340.052) (-1346.094) -- 0:03:37
289000 -- [-1340.921] (-1336.810) (-1338.191) (-1344.620) * (-1342.767) (-1336.620) [-1338.211] (-1347.116) -- 0:03:36
289500 -- [-1338.361] (-1332.607) (-1339.179) (-1335.227) * (-1332.860) (-1341.334) [-1338.953] (-1337.771) -- 0:03:35
290000 -- [-1336.168] (-1339.420) (-1338.695) (-1338.180) * (-1345.299) (-1340.399) [-1342.245] (-1340.496) -- 0:03:35
Average standard deviation of split frequencies: 0.012279
290500 -- (-1340.688) (-1338.247) [-1332.188] (-1339.731) * [-1333.525] (-1338.450) (-1344.312) (-1342.995) -- 0:03:34
291000 -- (-1347.072) (-1338.902) [-1337.089] (-1340.393) * (-1336.355) (-1346.841) (-1343.198) [-1335.706] -- 0:03:34
291500 -- (-1337.560) (-1344.669) [-1340.831] (-1339.037) * (-1337.910) (-1343.020) (-1348.072) [-1339.219] -- 0:03:33
292000 -- (-1343.509) (-1337.105) (-1340.004) [-1335.194] * (-1342.360) [-1341.104] (-1346.403) (-1346.488) -- 0:03:35
292500 -- (-1340.815) (-1340.861) [-1335.592] (-1348.343) * (-1335.522) [-1336.880] (-1342.649) (-1338.828) -- 0:03:35
293000 -- (-1337.952) (-1340.344) (-1338.796) [-1333.768] * [-1336.166] (-1337.556) (-1339.250) (-1340.955) -- 0:03:34
293500 -- (-1341.458) (-1335.891) (-1336.584) [-1339.129] * (-1341.844) (-1340.390) (-1339.959) [-1338.184] -- 0:03:34
294000 -- [-1338.045] (-1339.503) (-1338.067) (-1334.427) * [-1336.295] (-1338.729) (-1342.456) (-1336.362) -- 0:03:33
294500 -- (-1337.600) (-1338.548) (-1343.543) [-1335.473] * (-1334.755) [-1342.564] (-1334.067) (-1339.578) -- 0:03:33
295000 -- (-1338.379) (-1342.301) (-1339.321) [-1337.835] * (-1336.221) (-1341.458) (-1350.162) [-1335.458] -- 0:03:32
Average standard deviation of split frequencies: 0.011831
295500 -- (-1334.360) [-1344.251] (-1346.059) (-1337.206) * (-1339.091) (-1337.100) [-1336.467] (-1349.403) -- 0:03:34
296000 -- (-1337.461) (-1341.171) (-1334.425) [-1332.682] * (-1341.920) (-1330.560) (-1337.805) [-1337.179] -- 0:03:34
296500 -- (-1337.600) (-1342.610) [-1336.323] (-1336.580) * (-1340.467) (-1346.268) (-1336.781) [-1339.598] -- 0:03:33
297000 -- (-1336.230) (-1337.632) (-1335.993) [-1350.056] * (-1347.274) (-1346.124) [-1343.464] (-1331.037) -- 0:03:33
297500 -- (-1338.430) (-1342.132) (-1349.912) [-1340.555] * (-1337.557) [-1338.289] (-1333.644) (-1342.790) -- 0:03:32
298000 -- (-1346.304) (-1349.915) (-1341.564) [-1334.384] * (-1344.779) (-1336.455) [-1337.283] (-1340.018) -- 0:03:32
298500 -- (-1335.492) (-1343.944) (-1353.880) [-1337.709] * [-1331.873] (-1335.611) (-1339.295) (-1342.291) -- 0:03:33
299000 -- [-1336.497] (-1342.637) (-1342.800) (-1339.989) * (-1348.090) (-1334.192) (-1346.324) [-1332.775] -- 0:03:33
299500 -- [-1334.754] (-1340.948) (-1347.091) (-1335.277) * (-1345.967) (-1343.382) (-1344.267) [-1339.021] -- 0:03:32
300000 -- [-1339.399] (-1334.929) (-1341.690) (-1335.535) * [-1335.774] (-1341.938) (-1338.275) (-1334.767) -- 0:03:32
Average standard deviation of split frequencies: 0.011647
300500 -- (-1346.340) (-1338.044) [-1339.331] (-1337.577) * [-1339.670] (-1341.915) (-1333.406) (-1333.525) -- 0:03:31
301000 -- (-1338.012) [-1331.146] (-1333.358) (-1338.024) * [-1334.277] (-1342.439) (-1336.290) (-1342.604) -- 0:03:31
301500 -- (-1342.250) [-1339.164] (-1346.442) (-1338.732) * (-1353.703) (-1345.305) (-1333.453) [-1336.748] -- 0:03:30
302000 -- (-1339.930) (-1333.385) (-1343.164) [-1342.137] * [-1340.047] (-1338.045) (-1342.202) (-1341.496) -- 0:03:32
302500 -- [-1338.033] (-1342.101) (-1336.508) (-1342.520) * (-1336.199) [-1338.320] (-1334.214) (-1339.037) -- 0:03:32
303000 -- [-1337.652] (-1337.386) (-1345.781) (-1334.334) * (-1340.034) [-1335.608] (-1335.212) (-1342.695) -- 0:03:31
303500 -- (-1339.356) [-1337.250] (-1345.713) (-1333.921) * [-1338.065] (-1348.193) (-1337.989) (-1341.954) -- 0:03:31
304000 -- (-1340.176) [-1336.010] (-1339.308) (-1341.321) * [-1332.167] (-1350.510) (-1344.080) (-1335.122) -- 0:03:30
304500 -- (-1333.081) (-1343.807) (-1334.810) [-1336.261] * (-1340.210) (-1340.325) (-1336.391) [-1340.411] -- 0:03:30
305000 -- (-1334.575) (-1336.136) [-1338.142] (-1335.807) * (-1349.079) (-1334.630) [-1333.698] (-1333.860) -- 0:03:29
Average standard deviation of split frequencies: 0.011224
305500 -- (-1339.252) (-1340.524) (-1340.825) [-1334.859] * (-1341.529) (-1335.042) [-1331.014] (-1344.479) -- 0:03:31
306000 -- (-1337.436) (-1346.192) (-1339.411) [-1337.829] * (-1341.841) (-1339.318) (-1335.378) [-1336.397] -- 0:03:30
306500 -- (-1338.662) (-1344.158) (-1342.645) [-1333.196] * (-1338.252) (-1345.460) (-1341.263) [-1336.018] -- 0:03:30
307000 -- (-1341.081) (-1339.308) [-1334.118] (-1341.671) * [-1336.924] (-1348.280) (-1339.354) (-1333.822) -- 0:03:29
307500 -- (-1339.561) (-1341.869) (-1337.000) [-1335.744] * (-1340.536) [-1335.314] (-1338.569) (-1342.773) -- 0:03:29
308000 -- (-1339.522) (-1349.796) [-1338.195] (-1334.153) * (-1341.909) (-1336.808) [-1335.199] (-1339.717) -- 0:03:28
308500 -- [-1339.311] (-1342.714) (-1340.911) (-1338.219) * (-1340.081) [-1341.976] (-1347.215) (-1349.839) -- 0:03:28
309000 -- (-1340.061) (-1344.273) [-1336.921] (-1340.612) * (-1339.619) (-1336.001) [-1340.206] (-1352.785) -- 0:03:30
309500 -- (-1338.490) (-1354.138) (-1343.871) [-1339.310] * (-1338.860) (-1338.073) [-1337.801] (-1343.538) -- 0:03:29
310000 -- [-1335.393] (-1345.117) (-1341.738) (-1335.670) * [-1336.902] (-1344.073) (-1332.159) (-1343.700) -- 0:03:29
Average standard deviation of split frequencies: 0.009971
310500 -- (-1337.083) (-1347.363) [-1335.984] (-1338.558) * (-1344.451) (-1340.269) [-1344.581] (-1343.486) -- 0:03:28
311000 -- (-1338.548) (-1339.063) [-1343.098] (-1342.397) * (-1347.829) [-1342.038] (-1338.953) (-1349.583) -- 0:03:28
311500 -- (-1331.372) [-1339.813] (-1338.319) (-1333.501) * [-1334.605] (-1337.806) (-1340.079) (-1341.153) -- 0:03:27
312000 -- (-1333.954) (-1341.894) [-1334.815] (-1342.217) * [-1340.831] (-1340.804) (-1341.468) (-1336.284) -- 0:03:29
312500 -- (-1342.506) (-1345.568) [-1339.054] (-1334.111) * (-1357.592) [-1338.952] (-1332.496) (-1340.219) -- 0:03:29
313000 -- (-1336.037) (-1336.510) [-1334.894] (-1350.984) * [-1336.602] (-1338.965) (-1341.200) (-1341.195) -- 0:03:28
313500 -- [-1340.099] (-1332.610) (-1340.329) (-1335.910) * (-1339.694) [-1334.139] (-1337.332) (-1338.283) -- 0:03:28
314000 -- (-1340.998) (-1334.199) [-1339.138] (-1336.880) * [-1337.563] (-1343.475) (-1338.310) (-1339.633) -- 0:03:27
314500 -- [-1335.235] (-1336.648) (-1345.196) (-1338.039) * (-1334.606) (-1338.000) [-1340.666] (-1343.667) -- 0:03:27
315000 -- [-1334.898] (-1332.709) (-1340.651) (-1337.110) * [-1340.036] (-1337.853) (-1335.596) (-1346.124) -- 0:03:26
Average standard deviation of split frequencies: 0.009803
315500 -- (-1336.399) [-1338.153] (-1342.999) (-1335.543) * [-1337.013] (-1339.055) (-1341.413) (-1340.550) -- 0:03:28
316000 -- (-1342.692) [-1338.000] (-1331.742) (-1350.197) * (-1338.004) (-1332.345) (-1342.660) [-1344.578] -- 0:03:27
316500 -- (-1345.658) (-1337.887) [-1337.465] (-1338.279) * (-1336.928) (-1339.812) [-1336.125] (-1340.678) -- 0:03:27
317000 -- [-1336.476] (-1334.391) (-1340.760) (-1346.139) * [-1339.673] (-1340.909) (-1344.823) (-1336.833) -- 0:03:26
317500 -- (-1337.221) (-1338.792) [-1335.501] (-1343.334) * (-1339.341) (-1345.756) (-1337.043) [-1343.097] -- 0:03:26
318000 -- (-1338.832) (-1341.253) [-1335.776] (-1340.894) * [-1333.870] (-1340.004) (-1342.108) (-1348.259) -- 0:03:25
318500 -- (-1344.874) [-1337.447] (-1334.255) (-1332.892) * (-1345.197) [-1344.502] (-1342.240) (-1335.234) -- 0:03:25
319000 -- (-1345.796) (-1337.948) [-1332.577] (-1339.270) * (-1341.136) (-1341.066) (-1334.663) [-1343.680] -- 0:03:27
319500 -- (-1342.531) (-1346.731) (-1335.988) [-1336.016] * (-1342.861) (-1339.869) (-1335.669) [-1339.205] -- 0:03:26
320000 -- (-1338.429) [-1334.246] (-1340.410) (-1346.127) * (-1347.431) (-1337.532) [-1338.958] (-1340.914) -- 0:03:26
Average standard deviation of split frequencies: 0.010291
320500 -- (-1340.047) (-1338.516) [-1340.393] (-1340.379) * (-1338.509) [-1337.693] (-1346.371) (-1332.680) -- 0:03:25
321000 -- (-1338.364) (-1349.161) [-1334.924] (-1346.510) * (-1339.346) [-1335.245] (-1339.216) (-1332.090) -- 0:03:25
321500 -- (-1336.994) [-1339.463] (-1333.437) (-1340.940) * (-1338.000) [-1344.690] (-1342.259) (-1338.452) -- 0:03:24
322000 -- (-1340.532) (-1335.580) (-1338.023) [-1340.842] * (-1336.585) (-1341.871) [-1336.691] (-1337.401) -- 0:03:24
322500 -- (-1339.857) (-1345.107) (-1334.391) [-1343.209] * (-1334.257) (-1343.317) (-1347.310) [-1337.913] -- 0:03:25
323000 -- (-1342.633) (-1345.873) [-1336.419] (-1336.127) * [-1336.406] (-1345.152) (-1336.529) (-1334.874) -- 0:03:25
323500 -- (-1339.189) (-1348.078) (-1337.545) [-1336.298] * (-1342.252) [-1336.246] (-1338.528) (-1336.991) -- 0:03:24
324000 -- (-1345.491) (-1340.055) (-1342.040) [-1332.132] * (-1340.573) (-1332.015) (-1339.200) [-1337.028] -- 0:03:24
324500 -- (-1333.168) (-1343.250) [-1342.363] (-1336.426) * [-1338.515] (-1343.322) (-1335.171) (-1333.804) -- 0:03:24
325000 -- [-1337.959] (-1347.432) (-1336.987) (-1334.769) * (-1332.705) (-1338.222) (-1339.115) [-1338.322] -- 0:03:23
Average standard deviation of split frequencies: 0.011775
325500 -- [-1333.741] (-1339.230) (-1338.280) (-1338.550) * (-1335.279) [-1339.471] (-1345.521) (-1339.309) -- 0:03:25
326000 -- (-1339.718) (-1336.499) (-1338.379) [-1339.083] * (-1344.275) (-1341.179) (-1336.652) [-1340.866] -- 0:03:24
326500 -- (-1338.429) [-1337.679] (-1332.437) (-1337.363) * (-1334.508) [-1336.257] (-1334.436) (-1340.681) -- 0:03:24
327000 -- [-1332.588] (-1338.150) (-1335.733) (-1348.225) * (-1340.426) [-1333.295] (-1346.512) (-1339.324) -- 0:03:23
327500 -- (-1339.590) [-1335.162] (-1337.353) (-1348.427) * (-1337.285) (-1337.074) [-1337.338] (-1341.121) -- 0:03:23
328000 -- [-1336.547] (-1340.796) (-1342.538) (-1340.205) * [-1339.390] (-1337.464) (-1333.538) (-1349.109) -- 0:03:22
328500 -- (-1335.329) (-1339.474) [-1335.895] (-1335.977) * (-1337.531) (-1341.625) (-1339.582) [-1331.556] -- 0:03:22
329000 -- (-1336.625) (-1335.058) (-1347.853) [-1335.299] * (-1336.990) [-1334.063] (-1345.304) (-1334.932) -- 0:03:23
329500 -- [-1337.949] (-1334.904) (-1337.953) (-1339.640) * (-1342.934) [-1333.477] (-1338.646) (-1334.956) -- 0:03:23
330000 -- (-1331.715) [-1337.324] (-1338.572) (-1341.146) * (-1347.496) [-1339.079] (-1339.442) (-1334.936) -- 0:03:23
Average standard deviation of split frequencies: 0.012627
330500 -- (-1342.036) [-1335.053] (-1335.113) (-1348.511) * [-1334.478] (-1338.902) (-1346.002) (-1342.120) -- 0:03:22
331000 -- (-1333.664) (-1331.597) (-1343.599) [-1335.778] * [-1334.195] (-1336.947) (-1340.023) (-1338.620) -- 0:03:22
331500 -- (-1336.835) (-1336.950) (-1338.710) [-1333.335] * (-1335.310) (-1346.469) [-1339.789] (-1336.083) -- 0:03:21
332000 -- (-1348.790) (-1337.893) (-1340.022) [-1337.377] * (-1338.029) (-1342.283) (-1337.479) [-1334.374] -- 0:03:21
332500 -- (-1337.221) (-1338.746) [-1336.799] (-1340.961) * (-1343.431) (-1332.420) [-1338.431] (-1344.045) -- 0:03:22
333000 -- (-1342.699) (-1343.193) [-1338.767] (-1330.925) * (-1341.767) (-1338.280) [-1347.515] (-1332.681) -- 0:03:22
333500 -- (-1340.648) (-1336.298) [-1335.875] (-1333.563) * [-1337.428] (-1338.263) (-1341.633) (-1334.857) -- 0:03:21
334000 -- (-1338.587) (-1338.773) (-1339.470) [-1337.121] * [-1340.597] (-1340.532) (-1347.245) (-1338.857) -- 0:03:21
334500 -- [-1338.535] (-1338.561) (-1340.796) (-1338.342) * [-1337.208] (-1341.271) (-1334.772) (-1340.496) -- 0:03:20
335000 -- (-1340.771) (-1348.047) [-1331.618] (-1334.012) * [-1337.167] (-1340.009) (-1333.375) (-1338.605) -- 0:03:20
Average standard deviation of split frequencies: 0.012426
335500 -- [-1338.965] (-1338.609) (-1335.842) (-1342.483) * (-1339.432) (-1343.731) [-1342.852] (-1337.690) -- 0:03:20
336000 -- (-1337.700) [-1337.647] (-1336.408) (-1342.161) * (-1341.448) (-1339.983) (-1342.877) [-1340.126] -- 0:03:21
336500 -- (-1337.889) (-1343.175) [-1336.256] (-1340.539) * (-1336.265) [-1339.220] (-1333.832) (-1340.170) -- 0:03:21
337000 -- (-1337.512) [-1335.601] (-1336.096) (-1338.063) * (-1334.864) [-1335.381] (-1334.717) (-1342.853) -- 0:03:20
337500 -- [-1339.886] (-1339.607) (-1331.084) (-1343.134) * (-1339.641) [-1341.861] (-1344.140) (-1337.363) -- 0:03:20
338000 -- (-1342.054) [-1339.837] (-1332.542) (-1336.743) * (-1336.589) (-1348.341) [-1333.261] (-1336.426) -- 0:03:19
338500 -- [-1342.882] (-1341.505) (-1340.558) (-1339.615) * (-1340.656) [-1336.093] (-1336.680) (-1346.058) -- 0:03:19
339000 -- (-1337.229) [-1336.774] (-1335.043) (-1337.903) * (-1341.456) (-1335.040) (-1334.952) [-1345.643] -- 0:03:20
339500 -- [-1333.813] (-1342.715) (-1339.978) (-1335.670) * (-1342.336) (-1338.003) [-1332.698] (-1337.688) -- 0:03:20
340000 -- (-1334.967) (-1341.447) (-1340.167) [-1340.615] * (-1342.276) (-1339.459) [-1339.803] (-1338.419) -- 0:03:19
Average standard deviation of split frequencies: 0.011070
340500 -- [-1335.938] (-1340.704) (-1336.063) (-1341.066) * [-1339.251] (-1339.129) (-1342.268) (-1335.030) -- 0:03:19
341000 -- [-1339.897] (-1341.196) (-1338.395) (-1335.951) * [-1338.816] (-1336.976) (-1341.036) (-1340.360) -- 0:03:19
341500 -- (-1337.099) (-1347.224) [-1336.209] (-1340.949) * [-1343.337] (-1337.206) (-1336.971) (-1338.599) -- 0:03:18
342000 -- (-1339.734) [-1335.265] (-1339.573) (-1339.440) * (-1341.517) (-1345.648) [-1339.705] (-1340.258) -- 0:03:18
342500 -- (-1336.626) (-1338.012) (-1339.152) [-1338.096] * (-1335.933) (-1336.984) (-1335.684) [-1341.077] -- 0:03:19
343000 -- (-1342.198) [-1333.843] (-1337.770) (-1339.623) * (-1336.658) (-1339.516) [-1339.193] (-1338.481) -- 0:03:19
343500 -- (-1337.942) (-1342.016) (-1334.695) [-1342.015] * (-1338.624) (-1340.374) (-1335.012) [-1337.436] -- 0:03:18
344000 -- [-1336.076] (-1339.416) (-1338.016) (-1332.735) * [-1339.973] (-1343.510) (-1339.749) (-1338.363) -- 0:03:18
344500 -- [-1337.290] (-1338.268) (-1341.068) (-1341.826) * (-1337.897) (-1334.036) [-1334.626] (-1332.701) -- 0:03:17
345000 -- [-1340.062] (-1342.517) (-1336.274) (-1347.723) * (-1338.743) (-1351.551) (-1343.079) [-1340.056] -- 0:03:17
Average standard deviation of split frequencies: 0.012651
345500 -- (-1338.967) (-1338.562) (-1337.455) [-1341.607] * (-1342.681) (-1338.688) (-1336.186) [-1334.775] -- 0:03:17
346000 -- (-1341.959) (-1341.732) [-1335.402] (-1342.684) * (-1337.713) (-1336.478) (-1346.287) [-1333.807] -- 0:03:18
346500 -- (-1340.222) (-1331.075) [-1340.116] (-1348.753) * [-1335.459] (-1335.759) (-1353.420) (-1333.809) -- 0:03:18
347000 -- [-1339.381] (-1343.553) (-1336.418) (-1338.770) * (-1339.312) [-1335.458] (-1342.093) (-1338.586) -- 0:03:17
347500 -- (-1339.548) [-1334.110] (-1337.266) (-1332.865) * (-1338.512) [-1337.051] (-1335.823) (-1342.261) -- 0:03:17
348000 -- [-1336.823] (-1334.825) (-1340.065) (-1343.446) * (-1333.135) (-1343.352) (-1336.830) [-1345.657] -- 0:03:16
348500 -- (-1340.820) [-1332.829] (-1341.655) (-1345.126) * (-1340.994) [-1343.358] (-1346.473) (-1337.444) -- 0:03:16
349000 -- [-1332.909] (-1341.742) (-1339.304) (-1338.671) * [-1338.375] (-1336.566) (-1344.698) (-1338.018) -- 0:03:15
349500 -- (-1334.312) (-1342.264) (-1340.618) [-1336.713] * (-1340.497) [-1339.346] (-1345.446) (-1340.839) -- 0:03:17
350000 -- (-1338.949) [-1333.751] (-1338.186) (-1333.560) * (-1340.435) (-1341.193) (-1340.780) [-1340.918] -- 0:03:16
Average standard deviation of split frequencies: 0.014019
350500 -- [-1336.063] (-1348.963) (-1341.245) (-1336.951) * (-1333.130) (-1344.407) (-1335.853) [-1332.205] -- 0:03:16
351000 -- [-1339.554] (-1342.560) (-1347.930) (-1336.673) * [-1338.980] (-1342.872) (-1341.062) (-1335.381) -- 0:03:15
351500 -- [-1335.518] (-1333.787) (-1341.614) (-1336.525) * (-1340.064) [-1340.208] (-1340.469) (-1341.745) -- 0:03:15
352000 -- (-1336.183) (-1345.022) (-1340.006) [-1331.952] * [-1338.258] (-1340.739) (-1345.560) (-1341.184) -- 0:03:15
352500 -- (-1336.455) [-1332.069] (-1339.908) (-1339.554) * (-1339.943) (-1331.725) [-1337.083] (-1337.905) -- 0:03:16
353000 -- [-1334.138] (-1335.537) (-1335.197) (-1337.413) * (-1335.607) (-1332.846) [-1332.941] (-1339.610) -- 0:03:16
353500 -- (-1336.834) (-1331.928) [-1341.334] (-1346.349) * (-1341.228) [-1338.455] (-1342.292) (-1339.392) -- 0:03:15
354000 -- (-1343.969) (-1337.609) [-1340.418] (-1343.402) * (-1338.727) (-1349.590) [-1339.248] (-1339.712) -- 0:03:15
354500 -- (-1340.641) (-1348.128) [-1341.192] (-1347.216) * (-1345.321) (-1351.266) (-1339.959) [-1332.409] -- 0:03:14
355000 -- (-1337.909) (-1338.614) (-1331.934) [-1344.814] * (-1340.247) (-1337.500) (-1340.481) [-1335.669] -- 0:03:14
Average standard deviation of split frequencies: 0.013242
355500 -- (-1338.932) (-1334.847) (-1341.909) [-1342.147] * [-1335.349] (-1344.671) (-1338.136) (-1335.603) -- 0:03:13
356000 -- (-1343.351) (-1343.055) [-1336.773] (-1343.681) * (-1338.903) (-1347.239) (-1339.130) [-1337.982] -- 0:03:15
356500 -- (-1340.349) (-1346.870) (-1339.681) [-1333.866] * (-1343.141) (-1340.537) (-1338.581) [-1341.591] -- 0:03:14
357000 -- [-1340.465] (-1342.669) (-1349.074) (-1341.550) * (-1341.907) [-1336.610] (-1336.423) (-1335.535) -- 0:03:14
357500 -- (-1338.481) (-1342.907) (-1338.790) [-1335.777] * [-1335.959] (-1334.463) (-1335.233) (-1343.241) -- 0:03:14
358000 -- (-1334.066) (-1343.304) (-1343.228) [-1333.687] * [-1333.067] (-1340.519) (-1335.112) (-1335.621) -- 0:03:13
358500 -- (-1338.952) (-1341.235) [-1337.525] (-1336.978) * [-1342.831] (-1333.885) (-1333.200) (-1340.661) -- 0:03:13
359000 -- (-1334.547) [-1337.606] (-1335.515) (-1340.227) * (-1335.134) (-1338.130) (-1343.979) [-1337.674] -- 0:03:12
359500 -- (-1341.580) (-1337.815) [-1331.694] (-1341.635) * [-1339.639] (-1337.946) (-1338.730) (-1334.462) -- 0:03:14
360000 -- (-1337.216) [-1339.061] (-1347.308) (-1337.402) * (-1338.443) (-1338.444) (-1338.220) [-1344.545] -- 0:03:13
Average standard deviation of split frequencies: 0.011950
360500 -- (-1345.613) (-1338.572) (-1335.911) [-1341.655] * (-1336.541) [-1334.823] (-1340.378) (-1334.932) -- 0:03:13
361000 -- (-1345.125) (-1335.716) [-1339.183] (-1337.915) * (-1344.060) [-1337.721] (-1347.937) (-1339.075) -- 0:03:12
361500 -- (-1335.088) (-1339.920) (-1336.013) [-1337.753] * [-1337.253] (-1338.934) (-1345.422) (-1341.079) -- 0:03:12
362000 -- (-1341.091) (-1335.422) [-1333.781] (-1337.498) * [-1334.615] (-1335.289) (-1337.683) (-1342.915) -- 0:03:12
362500 -- (-1345.652) (-1339.820) (-1356.618) [-1338.012] * (-1343.669) (-1339.546) (-1342.544) [-1332.831] -- 0:03:11
363000 -- (-1335.046) (-1339.469) [-1345.544] (-1338.745) * (-1344.901) (-1335.975) [-1338.070] (-1342.725) -- 0:03:13
363500 -- [-1334.997] (-1339.163) (-1340.335) (-1332.241) * [-1345.279] (-1339.300) (-1334.509) (-1332.746) -- 0:03:12
364000 -- (-1339.631) (-1344.062) [-1332.923] (-1339.076) * (-1340.068) (-1339.377) [-1334.083] (-1338.699) -- 0:03:12
364500 -- [-1334.113] (-1346.062) (-1342.188) (-1335.649) * [-1338.120] (-1334.971) (-1338.909) (-1340.130) -- 0:03:11
365000 -- [-1346.033] (-1335.428) (-1339.703) (-1336.870) * [-1338.885] (-1339.000) (-1344.864) (-1336.441) -- 0:03:11
Average standard deviation of split frequencies: 0.010856
365500 -- [-1338.563] (-1340.688) (-1344.804) (-1339.371) * (-1340.152) (-1333.938) (-1341.691) [-1342.057] -- 0:03:10
366000 -- [-1338.640] (-1338.635) (-1340.696) (-1342.714) * (-1344.987) [-1334.653] (-1334.903) (-1342.655) -- 0:03:12
366500 -- (-1339.737) [-1339.455] (-1338.175) (-1348.297) * (-1341.233) (-1340.384) (-1335.105) [-1335.155] -- 0:03:11
367000 -- (-1335.129) [-1338.481] (-1344.438) (-1342.887) * (-1339.278) (-1339.719) [-1338.195] (-1343.840) -- 0:03:11
367500 -- (-1334.307) (-1341.692) [-1336.205] (-1340.434) * (-1339.154) (-1343.113) [-1340.767] (-1341.610) -- 0:03:11
368000 -- (-1339.705) (-1341.316) (-1348.138) [-1336.669] * [-1336.063] (-1343.133) (-1337.281) (-1335.319) -- 0:03:10
368500 -- (-1337.204) [-1337.539] (-1335.331) (-1345.230) * (-1340.555) [-1341.454] (-1338.200) (-1341.574) -- 0:03:10
369000 -- (-1347.337) (-1346.358) [-1331.580] (-1336.690) * (-1344.604) [-1337.190] (-1338.646) (-1340.131) -- 0:03:09
369500 -- [-1338.719] (-1341.796) (-1340.277) (-1343.796) * (-1336.802) (-1350.549) [-1336.992] (-1340.089) -- 0:03:11
370000 -- (-1335.561) (-1342.985) [-1344.425] (-1334.572) * (-1345.837) (-1335.660) [-1332.749] (-1337.984) -- 0:03:10
Average standard deviation of split frequencies: 0.011264
370500 -- (-1347.059) [-1330.771] (-1349.564) (-1337.567) * (-1351.870) [-1339.439] (-1346.783) (-1335.181) -- 0:03:10
371000 -- (-1345.764) (-1340.430) (-1346.956) [-1336.318] * (-1342.013) [-1333.568] (-1341.574) (-1338.402) -- 0:03:09
371500 -- (-1337.132) (-1341.089) (-1342.497) [-1344.335] * (-1346.735) (-1334.598) [-1342.495] (-1338.123) -- 0:03:09
372000 -- [-1337.877] (-1335.667) (-1343.059) (-1350.942) * (-1344.785) (-1333.085) [-1338.005] (-1334.325) -- 0:03:09
372500 -- (-1333.286) (-1339.891) (-1344.123) [-1333.108] * (-1345.963) (-1340.651) (-1342.547) [-1336.744] -- 0:03:08
373000 -- (-1338.904) (-1337.413) [-1337.484] (-1336.061) * (-1347.331) [-1339.569] (-1346.541) (-1335.104) -- 0:03:09
373500 -- (-1337.787) (-1340.887) (-1339.840) [-1334.006] * (-1340.198) [-1339.672] (-1339.040) (-1337.163) -- 0:03:09
374000 -- (-1344.468) (-1344.669) (-1347.730) [-1339.332] * (-1343.744) [-1337.265] (-1340.238) (-1342.037) -- 0:03:09
374500 -- (-1343.840) (-1335.145) (-1340.659) [-1335.350] * (-1337.674) [-1334.991] (-1339.999) (-1340.709) -- 0:03:08
375000 -- (-1336.782) (-1341.533) (-1338.803) [-1342.353] * (-1344.502) (-1339.294) [-1334.559] (-1346.313) -- 0:03:08
Average standard deviation of split frequencies: 0.009851
375500 -- (-1341.879) [-1343.142] (-1335.821) (-1337.397) * [-1333.207] (-1344.686) (-1334.679) (-1337.585) -- 0:03:07
376000 -- [-1342.963] (-1348.163) (-1339.239) (-1335.135) * [-1335.142] (-1334.344) (-1337.716) (-1337.805) -- 0:03:07
376500 -- (-1345.260) (-1340.501) (-1345.996) [-1332.918] * (-1341.302) (-1335.486) (-1348.482) [-1338.907] -- 0:03:08
377000 -- (-1337.929) (-1341.132) [-1332.384] (-1341.209) * (-1338.629) (-1333.839) [-1341.304] (-1345.661) -- 0:03:08
377500 -- [-1344.515] (-1337.053) (-1340.581) (-1346.569) * [-1340.860] (-1335.355) (-1338.261) (-1337.335) -- 0:03:07
378000 -- [-1334.799] (-1336.935) (-1345.437) (-1341.641) * (-1344.501) (-1344.786) (-1334.201) [-1334.931] -- 0:03:07
378500 -- (-1337.590) (-1336.650) (-1335.574) [-1343.365] * (-1338.164) (-1344.380) [-1333.827] (-1340.034) -- 0:03:07
379000 -- (-1337.550) (-1335.576) [-1334.127] (-1344.285) * [-1331.729] (-1334.503) (-1336.767) (-1342.659) -- 0:03:06
379500 -- (-1349.363) (-1335.618) [-1336.368] (-1343.951) * [-1336.882] (-1336.664) (-1343.509) (-1339.878) -- 0:03:06
380000 -- (-1337.865) (-1350.624) [-1336.465] (-1343.852) * (-1346.278) (-1336.218) [-1340.007] (-1342.346) -- 0:03:07
Average standard deviation of split frequencies: 0.009376
380500 -- (-1338.500) [-1336.644] (-1332.759) (-1340.395) * (-1339.701) (-1351.375) (-1342.609) [-1343.171] -- 0:03:07
381000 -- (-1334.733) (-1340.385) [-1339.583] (-1344.913) * (-1347.229) (-1337.066) [-1338.712] (-1339.340) -- 0:03:06
381500 -- (-1341.283) (-1338.826) [-1332.669] (-1346.127) * (-1337.531) (-1332.743) (-1338.881) [-1341.411] -- 0:03:06
382000 -- (-1349.535) [-1339.785] (-1338.659) (-1335.245) * [-1332.538] (-1339.629) (-1343.713) (-1342.208) -- 0:03:06
382500 -- (-1350.803) (-1334.567) [-1334.973] (-1338.947) * (-1343.521) [-1334.074] (-1341.026) (-1335.405) -- 0:03:05
383000 -- (-1340.133) [-1334.911] (-1338.897) (-1340.725) * (-1338.564) [-1338.271] (-1337.331) (-1340.529) -- 0:03:05
383500 -- (-1338.845) [-1333.089] (-1341.988) (-1338.432) * (-1335.693) [-1337.034] (-1347.932) (-1339.551) -- 0:03:06
384000 -- [-1337.507] (-1336.392) (-1333.084) (-1337.041) * [-1335.484] (-1340.675) (-1339.645) (-1342.534) -- 0:03:06
384500 -- (-1338.258) (-1335.897) [-1338.025] (-1342.921) * (-1342.670) [-1338.371] (-1337.619) (-1340.388) -- 0:03:05
385000 -- (-1341.269) (-1338.767) [-1337.717] (-1336.668) * (-1343.899) (-1336.178) [-1340.186] (-1348.436) -- 0:03:05
Average standard deviation of split frequencies: 0.009247
385500 -- (-1345.303) (-1343.994) (-1337.752) [-1331.778] * (-1344.577) [-1333.843] (-1336.939) (-1353.983) -- 0:03:04
386000 -- (-1333.596) (-1337.069) (-1345.676) [-1337.696] * (-1340.580) (-1343.302) (-1334.800) [-1340.089] -- 0:03:04
386500 -- (-1336.624) [-1342.263] (-1340.952) (-1349.618) * (-1340.903) [-1342.135] (-1332.174) (-1338.908) -- 0:03:04
387000 -- (-1350.941) [-1338.830] (-1343.780) (-1342.631) * (-1333.275) (-1345.159) [-1338.923] (-1350.374) -- 0:03:05
387500 -- [-1336.466] (-1338.525) (-1337.061) (-1352.533) * (-1339.680) [-1345.568] (-1339.964) (-1344.492) -- 0:03:04
388000 -- (-1339.945) [-1334.501] (-1349.617) (-1347.306) * [-1340.266] (-1341.760) (-1333.095) (-1343.348) -- 0:03:04
388500 -- [-1334.760] (-1337.106) (-1345.952) (-1340.863) * (-1335.336) (-1341.619) (-1334.336) [-1342.904] -- 0:03:04
389000 -- (-1337.899) (-1337.062) [-1336.237] (-1345.357) * [-1332.747] (-1335.746) (-1337.495) (-1342.446) -- 0:03:03
389500 -- (-1342.559) [-1337.689] (-1337.628) (-1342.330) * (-1349.118) (-1335.332) (-1334.096) [-1337.002] -- 0:03:03
390000 -- [-1340.395] (-1340.993) (-1340.464) (-1344.916) * (-1339.644) (-1337.499) [-1331.808] (-1336.795) -- 0:03:04
Average standard deviation of split frequencies: 0.008447
390500 -- [-1339.273] (-1342.734) (-1348.693) (-1345.924) * (-1337.388) [-1334.368] (-1341.006) (-1334.491) -- 0:03:04
391000 -- (-1344.557) (-1340.891) (-1344.724) [-1340.623] * (-1343.411) (-1337.581) [-1337.233] (-1344.010) -- 0:03:03
391500 -- (-1338.702) (-1339.264) [-1338.420] (-1339.736) * [-1330.798] (-1338.130) (-1343.445) (-1341.195) -- 0:03:03
392000 -- (-1340.589) (-1343.885) [-1342.749] (-1340.448) * (-1335.432) (-1338.039) (-1340.905) [-1335.114] -- 0:03:03
392500 -- (-1347.135) (-1335.030) [-1340.250] (-1345.594) * (-1337.815) (-1342.986) (-1338.923) [-1339.666] -- 0:03:02
393000 -- (-1341.341) (-1342.947) [-1338.685] (-1351.512) * (-1331.089) [-1335.337] (-1340.259) (-1338.727) -- 0:03:02
393500 -- [-1331.616] (-1342.883) (-1331.912) (-1338.506) * (-1336.413) (-1340.296) (-1349.065) [-1340.060] -- 0:03:03
394000 -- (-1335.756) (-1335.919) (-1333.898) [-1333.703] * [-1343.729] (-1348.769) (-1343.718) (-1337.447) -- 0:03:03
394500 -- (-1338.731) (-1343.574) (-1341.547) [-1333.737] * [-1341.184] (-1340.020) (-1341.521) (-1342.783) -- 0:03:02
395000 -- (-1342.902) (-1338.993) [-1339.567] (-1337.438) * (-1343.573) [-1346.498] (-1343.523) (-1345.204) -- 0:03:02
Average standard deviation of split frequencies: 0.009183
395500 -- (-1337.901) (-1342.111) (-1341.636) [-1336.572] * (-1339.474) [-1336.396] (-1342.921) (-1337.785) -- 0:03:01
396000 -- (-1333.647) (-1338.935) [-1339.976] (-1340.094) * [-1340.039] (-1335.852) (-1345.140) (-1338.454) -- 0:03:01
396500 -- [-1340.122] (-1338.195) (-1341.440) (-1340.161) * [-1336.352] (-1339.385) (-1337.505) (-1331.440) -- 0:03:01
397000 -- (-1337.083) [-1341.960] (-1338.536) (-1342.453) * (-1344.893) [-1337.673] (-1341.730) (-1346.264) -- 0:03:02
397500 -- (-1340.257) (-1346.174) (-1338.089) [-1337.445] * [-1344.480] (-1350.036) (-1344.924) (-1333.493) -- 0:03:01
398000 -- [-1336.886] (-1350.720) (-1333.499) (-1340.384) * (-1334.371) (-1339.564) (-1338.017) [-1330.588] -- 0:03:01
398500 -- [-1337.272] (-1346.589) (-1335.229) (-1341.860) * (-1335.225) (-1345.408) [-1334.356] (-1336.315) -- 0:03:01
399000 -- [-1336.436] (-1350.137) (-1337.542) (-1341.924) * (-1343.710) (-1337.899) [-1330.873] (-1342.697) -- 0:03:00
399500 -- (-1348.477) (-1341.477) (-1333.658) [-1337.549] * (-1334.372) [-1335.246] (-1340.282) (-1342.873) -- 0:03:00
400000 -- [-1337.703] (-1343.771) (-1340.638) (-1345.607) * (-1344.633) (-1340.491) (-1338.251) [-1334.719] -- 0:02:59
Average standard deviation of split frequencies: 0.010757
400500 -- (-1339.101) (-1355.257) [-1334.885] (-1335.662) * (-1337.463) (-1340.397) [-1334.336] (-1337.500) -- 0:03:01
401000 -- (-1339.818) (-1346.508) [-1338.736] (-1342.165) * [-1340.634] (-1335.990) (-1343.029) (-1334.119) -- 0:03:00
401500 -- (-1346.149) (-1348.542) [-1332.672] (-1340.493) * (-1339.307) (-1339.707) [-1342.838] (-1338.241) -- 0:03:00
402000 -- (-1335.958) (-1344.103) (-1336.274) [-1337.399] * (-1336.195) (-1339.301) (-1339.769) [-1342.874] -- 0:02:59
402500 -- [-1335.003] (-1345.666) (-1337.734) (-1336.351) * (-1332.962) [-1332.094] (-1337.198) (-1334.655) -- 0:02:59
403000 -- (-1333.386) (-1339.900) [-1341.862] (-1348.053) * (-1338.772) [-1336.374] (-1335.666) (-1339.782) -- 0:02:59
403500 -- [-1341.217] (-1335.128) (-1350.006) (-1335.481) * (-1347.941) (-1340.018) (-1334.715) [-1332.910] -- 0:03:00
404000 -- [-1336.264] (-1336.315) (-1353.142) (-1334.473) * [-1340.975] (-1341.096) (-1338.217) (-1340.030) -- 0:02:59
404500 -- (-1343.488) (-1342.010) (-1342.787) [-1333.349] * (-1340.565) [-1342.388] (-1343.423) (-1340.892) -- 0:02:59
405000 -- (-1342.876) (-1337.440) (-1338.783) [-1336.372] * [-1342.948] (-1338.686) (-1338.509) (-1338.858) -- 0:02:59
Average standard deviation of split frequencies: 0.011445
405500 -- [-1339.535] (-1341.665) (-1341.580) (-1342.948) * (-1334.184) (-1337.076) [-1337.042] (-1342.246) -- 0:02:58
406000 -- (-1343.345) [-1336.781] (-1340.691) (-1338.902) * (-1344.504) (-1340.102) [-1341.886] (-1345.069) -- 0:02:58
406500 -- (-1344.441) [-1342.075] (-1344.595) (-1341.844) * (-1343.069) (-1336.291) (-1337.068) [-1339.963] -- 0:02:58
407000 -- (-1340.574) [-1338.898] (-1335.182) (-1337.208) * (-1337.886) (-1338.931) [-1333.789] (-1335.465) -- 0:02:59
407500 -- [-1338.546] (-1338.884) (-1338.673) (-1342.380) * (-1340.629) [-1346.528] (-1337.556) (-1341.496) -- 0:02:58
408000 -- [-1335.877] (-1332.526) (-1341.412) (-1342.616) * (-1345.220) [-1335.937] (-1346.916) (-1333.073) -- 0:02:58
408500 -- (-1336.273) (-1336.424) [-1335.378] (-1340.008) * (-1343.988) (-1329.523) (-1345.790) [-1335.930] -- 0:02:58
409000 -- [-1338.766] (-1334.043) (-1337.738) (-1345.020) * (-1338.281) (-1336.721) (-1348.379) [-1339.935] -- 0:02:57
409500 -- (-1340.608) [-1342.602] (-1350.667) (-1342.677) * (-1339.643) (-1335.900) (-1350.603) [-1336.525] -- 0:02:57
410000 -- (-1337.586) (-1339.473) (-1347.425) [-1335.792] * (-1340.852) (-1333.433) (-1341.831) [-1336.581] -- 0:02:56
Average standard deviation of split frequencies: 0.011479
410500 -- (-1339.110) (-1341.464) [-1337.235] (-1352.632) * (-1346.120) [-1335.100] (-1339.694) (-1340.787) -- 0:02:58
411000 -- (-1335.906) [-1334.761] (-1338.212) (-1337.811) * (-1336.664) [-1333.830] (-1353.458) (-1337.612) -- 0:02:57
411500 -- [-1343.643] (-1346.963) (-1341.313) (-1339.980) * [-1334.423] (-1338.393) (-1341.251) (-1336.307) -- 0:02:57
412000 -- (-1343.922) (-1340.305) [-1337.577] (-1340.853) * [-1339.827] (-1339.816) (-1342.511) (-1334.414) -- 0:02:56
412500 -- (-1349.134) [-1340.331] (-1337.457) (-1338.132) * (-1350.107) [-1332.834] (-1347.603) (-1342.190) -- 0:02:56
413000 -- (-1339.203) (-1334.341) [-1336.276] (-1340.656) * (-1343.876) (-1333.830) [-1344.202] (-1334.607) -- 0:02:56
413500 -- [-1339.351] (-1336.978) (-1338.376) (-1340.899) * (-1345.946) (-1335.252) [-1341.588] (-1333.579) -- 0:02:57
414000 -- [-1339.250] (-1350.172) (-1334.766) (-1336.452) * (-1338.492) (-1333.349) (-1341.572) [-1332.225] -- 0:02:56
414500 -- (-1343.398) [-1338.571] (-1348.042) (-1335.907) * [-1330.912] (-1336.140) (-1341.689) (-1334.530) -- 0:02:56
415000 -- (-1336.527) (-1342.268) [-1348.397] (-1339.593) * (-1338.593) (-1337.261) (-1339.374) [-1340.893] -- 0:02:56
Average standard deviation of split frequencies: 0.010846
415500 -- (-1337.740) (-1345.394) (-1339.527) [-1333.515] * [-1342.424] (-1344.581) (-1340.721) (-1342.509) -- 0:02:55
416000 -- (-1338.816) (-1341.665) [-1346.140] (-1337.048) * [-1333.814] (-1359.983) (-1340.242) (-1343.764) -- 0:02:55
416500 -- (-1338.196) (-1337.396) [-1346.806] (-1336.865) * [-1331.874] (-1338.228) (-1335.170) (-1337.371) -- 0:02:55
417000 -- (-1341.345) [-1337.976] (-1336.114) (-1337.914) * (-1333.729) [-1338.699] (-1340.898) (-1334.585) -- 0:02:56
417500 -- (-1340.916) (-1334.282) [-1336.573] (-1340.595) * (-1332.275) [-1334.773] (-1344.304) (-1338.826) -- 0:02:55
418000 -- (-1336.357) (-1339.325) [-1343.775] (-1339.306) * (-1337.461) [-1334.123] (-1339.937) (-1336.573) -- 0:02:55
418500 -- [-1334.163] (-1340.050) (-1342.358) (-1338.960) * (-1339.186) (-1335.603) (-1346.154) [-1339.049] -- 0:02:55
419000 -- (-1337.343) [-1336.354] (-1341.607) (-1341.335) * (-1338.720) (-1341.745) [-1341.831] (-1341.869) -- 0:02:54
419500 -- (-1337.986) [-1338.531] (-1332.358) (-1338.107) * (-1340.526) (-1338.719) (-1340.880) [-1339.728] -- 0:02:54
420000 -- (-1335.840) [-1333.906] (-1344.090) (-1338.532) * (-1336.034) [-1333.602] (-1343.225) (-1342.563) -- 0:02:53
Average standard deviation of split frequencies: 0.011046
420500 -- (-1336.951) (-1337.136) (-1344.334) [-1336.093] * [-1343.038] (-1335.232) (-1345.368) (-1342.808) -- 0:02:55
421000 -- [-1340.803] (-1338.762) (-1335.934) (-1346.455) * (-1342.670) [-1337.319] (-1346.126) (-1339.512) -- 0:02:54
421500 -- (-1336.509) [-1333.725] (-1345.530) (-1339.551) * (-1343.913) [-1330.607] (-1340.448) (-1335.333) -- 0:02:54
422000 -- [-1334.772] (-1335.577) (-1343.265) (-1346.262) * (-1349.840) [-1331.007] (-1343.523) (-1339.817) -- 0:02:53
422500 -- (-1338.397) (-1346.747) [-1341.308] (-1333.134) * (-1344.136) [-1335.301] (-1344.184) (-1335.484) -- 0:02:53
423000 -- (-1337.477) (-1338.017) [-1352.093] (-1346.465) * [-1339.106] (-1341.529) (-1351.327) (-1337.700) -- 0:02:53
423500 -- (-1341.291) (-1336.327) [-1338.128] (-1336.515) * (-1340.007) [-1337.726] (-1344.113) (-1342.337) -- 0:02:52
424000 -- (-1341.348) (-1341.259) (-1338.844) [-1337.529] * (-1337.156) (-1343.570) (-1346.630) [-1335.512] -- 0:02:53
424500 -- (-1341.068) (-1338.191) (-1341.227) [-1338.020] * [-1334.748] (-1332.621) (-1336.494) (-1342.159) -- 0:02:53
425000 -- (-1338.931) (-1342.947) [-1336.014] (-1339.174) * (-1338.556) (-1337.911) [-1337.609] (-1337.934) -- 0:02:53
Average standard deviation of split frequencies: 0.011382
425500 -- (-1334.476) [-1333.830] (-1342.482) (-1331.699) * (-1343.722) (-1333.501) [-1335.331] (-1341.423) -- 0:02:52
426000 -- (-1337.158) [-1334.139] (-1336.353) (-1344.902) * (-1337.087) (-1349.685) [-1331.642] (-1346.047) -- 0:02:52
426500 -- (-1333.330) [-1335.174] (-1338.265) (-1337.132) * (-1338.523) (-1348.084) [-1332.435] (-1340.833) -- 0:02:52
427000 -- (-1339.460) (-1334.668) [-1336.963] (-1347.449) * (-1340.212) (-1339.380) [-1333.116] (-1339.978) -- 0:02:53
427500 -- (-1343.280) (-1334.176) [-1334.887] (-1339.027) * (-1335.343) (-1336.019) [-1338.039] (-1337.025) -- 0:02:52
428000 -- [-1339.272] (-1337.445) (-1336.160) (-1339.316) * (-1352.125) (-1337.226) [-1331.846] (-1340.008) -- 0:02:52
428500 -- (-1335.729) (-1334.317) [-1339.885] (-1340.280) * (-1342.434) [-1338.016] (-1334.937) (-1338.721) -- 0:02:52
429000 -- [-1335.344] (-1340.483) (-1348.380) (-1336.570) * [-1341.832] (-1341.734) (-1338.401) (-1346.456) -- 0:02:51
429500 -- (-1345.347) (-1340.826) (-1340.566) [-1333.294] * (-1344.297) (-1351.179) [-1336.856] (-1344.652) -- 0:02:51
430000 -- (-1335.752) (-1335.091) (-1339.425) [-1333.519] * [-1336.072] (-1339.768) (-1335.241) (-1341.867) -- 0:02:50
Average standard deviation of split frequencies: 0.010633
430500 -- (-1341.279) (-1340.834) (-1332.027) [-1340.363] * (-1338.630) (-1339.708) [-1338.900] (-1343.983) -- 0:02:51
431000 -- (-1337.085) (-1341.945) [-1335.620] (-1339.104) * (-1345.834) (-1337.652) (-1335.543) [-1340.131] -- 0:02:51
431500 -- [-1334.574] (-1342.378) (-1331.667) (-1338.422) * [-1331.790] (-1337.749) (-1338.779) (-1334.405) -- 0:02:51
432000 -- [-1334.443] (-1337.499) (-1338.664) (-1339.624) * (-1334.050) (-1335.968) (-1339.559) [-1337.852] -- 0:02:50
432500 -- (-1333.383) [-1336.076] (-1330.646) (-1333.087) * (-1338.458) (-1336.353) [-1333.775] (-1340.502) -- 0:02:50
433000 -- (-1342.284) (-1339.966) (-1339.005) [-1342.737] * (-1341.917) [-1337.280] (-1341.564) (-1341.075) -- 0:02:50
433500 -- [-1341.741] (-1341.260) (-1344.408) (-1340.030) * (-1336.906) (-1340.793) [-1338.894] (-1336.897) -- 0:02:49
434000 -- (-1335.436) (-1344.124) [-1345.789] (-1347.840) * [-1344.667] (-1343.603) (-1340.789) (-1339.384) -- 0:02:50
434500 -- (-1345.713) [-1339.080] (-1338.824) (-1338.505) * (-1339.088) (-1338.603) [-1331.569] (-1341.531) -- 0:02:50
435000 -- (-1342.267) [-1340.551] (-1338.250) (-1338.641) * [-1333.933] (-1337.331) (-1334.586) (-1335.280) -- 0:02:50
Average standard deviation of split frequencies: 0.010349
435500 -- [-1335.741] (-1338.226) (-1346.185) (-1333.777) * [-1335.976] (-1338.114) (-1332.914) (-1337.345) -- 0:02:49
436000 -- (-1335.490) (-1345.143) [-1334.250] (-1336.984) * (-1348.100) (-1339.153) (-1347.957) [-1339.335] -- 0:02:49
436500 -- (-1348.773) (-1341.922) (-1337.694) [-1337.429] * (-1336.767) [-1339.438] (-1337.270) (-1338.264) -- 0:02:49
437000 -- (-1339.927) [-1342.811] (-1349.357) (-1339.873) * (-1343.770) (-1334.230) [-1330.461] (-1338.832) -- 0:02:48
437500 -- (-1341.221) (-1336.921) (-1336.496) [-1334.141] * (-1335.855) (-1339.030) [-1338.815] (-1338.146) -- 0:02:49
438000 -- (-1341.451) [-1339.431] (-1338.531) (-1341.311) * (-1338.112) (-1337.860) (-1345.797) [-1340.365] -- 0:02:49
438500 -- (-1340.046) (-1342.668) [-1340.065] (-1345.017) * [-1338.504] (-1336.103) (-1334.542) (-1339.940) -- 0:02:49
439000 -- [-1335.268] (-1340.543) (-1344.950) (-1337.947) * [-1340.366] (-1344.256) (-1342.199) (-1343.265) -- 0:02:48
439500 -- (-1336.128) (-1337.986) (-1340.267) [-1340.278] * (-1336.919) (-1341.189) [-1336.990] (-1346.036) -- 0:02:48
440000 -- (-1340.258) (-1333.220) (-1340.725) [-1339.616] * [-1338.434] (-1337.091) (-1339.098) (-1339.797) -- 0:02:47
Average standard deviation of split frequencies: 0.009628
440500 -- (-1343.574) (-1339.861) [-1340.227] (-1342.609) * (-1342.030) (-1339.134) (-1351.236) [-1342.223] -- 0:02:47
441000 -- (-1335.769) [-1339.267] (-1343.535) (-1344.130) * (-1336.550) [-1337.074] (-1332.754) (-1342.985) -- 0:02:48
441500 -- (-1336.318) (-1338.890) (-1336.676) [-1342.439] * (-1343.218) (-1337.284) (-1348.963) [-1339.111] -- 0:02:48
442000 -- (-1339.339) (-1335.880) [-1333.168] (-1338.129) * (-1333.535) (-1337.132) (-1342.894) [-1339.307] -- 0:02:47
442500 -- (-1335.542) (-1332.405) [-1337.638] (-1339.122) * (-1339.017) [-1336.389] (-1338.531) (-1346.901) -- 0:02:47
443000 -- (-1337.623) (-1336.149) (-1343.870) [-1331.954] * (-1345.893) (-1340.594) (-1340.105) [-1336.045] -- 0:02:47
443500 -- (-1343.523) [-1334.890] (-1343.164) (-1335.568) * (-1339.404) (-1338.897) (-1337.251) [-1336.264] -- 0:02:46
444000 -- [-1341.149] (-1336.587) (-1343.913) (-1339.037) * (-1337.256) (-1340.276) [-1334.927] (-1347.797) -- 0:02:47
444500 -- (-1351.086) (-1338.320) [-1336.416] (-1336.312) * (-1346.690) (-1335.404) [-1335.867] (-1344.778) -- 0:02:47
445000 -- (-1342.064) (-1343.228) (-1339.014) [-1338.135] * (-1340.300) [-1333.387] (-1332.171) (-1341.551) -- 0:02:47
Average standard deviation of split frequencies: 0.009513
445500 -- (-1336.181) [-1344.374] (-1337.509) (-1337.786) * (-1338.604) [-1329.515] (-1337.153) (-1344.011) -- 0:02:46
446000 -- (-1334.025) [-1335.976] (-1346.715) (-1342.164) * (-1345.036) (-1340.823) [-1330.580] (-1338.365) -- 0:02:46
446500 -- (-1335.954) (-1339.471) [-1343.044] (-1339.632) * [-1339.679] (-1344.823) (-1333.558) (-1339.808) -- 0:02:46
447000 -- (-1341.816) (-1335.584) (-1347.312) [-1341.128] * (-1340.817) (-1339.443) [-1336.435] (-1339.268) -- 0:02:45
447500 -- (-1339.398) (-1341.144) (-1338.578) [-1334.068] * (-1337.809) [-1335.083] (-1350.408) (-1342.648) -- 0:02:46
448000 -- [-1337.082] (-1339.668) (-1336.874) (-1337.272) * (-1345.995) (-1343.252) (-1338.816) [-1336.825] -- 0:02:46
448500 -- [-1335.755] (-1347.439) (-1351.012) (-1343.533) * [-1336.740] (-1345.628) (-1340.155) (-1339.118) -- 0:02:46
449000 -- (-1340.679) (-1334.071) (-1336.644) [-1334.450] * (-1342.290) (-1341.013) (-1338.241) [-1339.786] -- 0:02:45
449500 -- [-1337.278] (-1340.876) (-1342.900) (-1340.809) * [-1333.459] (-1334.002) (-1338.282) (-1342.040) -- 0:02:45
450000 -- (-1335.573) (-1334.949) (-1345.119) [-1339.832] * (-1335.265) [-1338.053] (-1339.866) (-1342.622) -- 0:02:44
Average standard deviation of split frequencies: 0.009713
450500 -- (-1340.484) [-1335.556] (-1343.481) (-1337.463) * (-1343.820) (-1336.515) [-1335.285] (-1335.832) -- 0:02:45
451000 -- (-1352.256) (-1335.795) (-1344.335) [-1338.585] * (-1342.127) (-1339.574) [-1338.124] (-1336.182) -- 0:02:45
451500 -- (-1341.569) (-1340.968) [-1340.628] (-1337.285) * (-1340.926) (-1351.991) (-1348.773) [-1343.371] -- 0:02:45
452000 -- (-1340.902) (-1341.742) [-1336.896] (-1342.467) * (-1343.109) (-1345.670) [-1340.909] (-1350.603) -- 0:02:44
452500 -- (-1342.739) [-1334.289] (-1345.860) (-1337.205) * (-1344.196) (-1342.480) (-1333.200) [-1331.706] -- 0:02:44
453000 -- (-1342.120) [-1334.593] (-1343.034) (-1339.546) * (-1343.933) [-1336.929] (-1343.564) (-1333.286) -- 0:02:44
453500 -- (-1335.134) [-1335.027] (-1332.959) (-1340.424) * (-1342.500) [-1334.452] (-1335.913) (-1334.419) -- 0:02:43
454000 -- [-1340.230] (-1341.081) (-1332.830) (-1336.005) * (-1338.176) (-1342.736) (-1343.850) [-1337.490] -- 0:02:44
454500 -- (-1335.788) (-1341.466) [-1342.229] (-1339.381) * (-1346.170) (-1339.556) (-1340.608) [-1338.575] -- 0:02:44
455000 -- (-1341.584) (-1333.556) [-1334.518] (-1334.984) * (-1351.209) (-1344.225) [-1341.394] (-1337.543) -- 0:02:44
Average standard deviation of split frequencies: 0.010781
455500 -- (-1337.845) (-1338.141) [-1340.641] (-1339.743) * (-1339.261) [-1344.002] (-1341.657) (-1345.155) -- 0:02:43
456000 -- (-1331.378) [-1341.942] (-1338.761) (-1334.498) * (-1332.332) [-1333.669] (-1343.025) (-1340.242) -- 0:02:43
456500 -- [-1339.464] (-1340.552) (-1341.097) (-1344.017) * [-1337.788] (-1337.759) (-1345.862) (-1337.020) -- 0:02:43
457000 -- (-1332.203) [-1338.257] (-1337.569) (-1339.144) * (-1334.396) (-1342.881) [-1340.478] (-1342.297) -- 0:02:42
457500 -- [-1334.196] (-1346.775) (-1338.613) (-1343.473) * (-1336.216) [-1345.668] (-1337.947) (-1340.807) -- 0:02:43
458000 -- (-1342.550) (-1344.845) [-1336.243] (-1336.390) * [-1338.246] (-1333.870) (-1341.719) (-1344.926) -- 0:02:43
458500 -- (-1346.273) (-1337.871) (-1335.851) [-1333.267] * (-1332.478) [-1337.658] (-1343.375) (-1341.266) -- 0:02:42
459000 -- (-1350.944) [-1335.597] (-1337.264) (-1345.434) * (-1340.893) (-1331.599) [-1336.831] (-1337.409) -- 0:02:42
459500 -- (-1343.346) (-1335.764) (-1340.400) [-1331.029] * [-1339.273] (-1336.231) (-1333.305) (-1341.880) -- 0:02:42
460000 -- (-1348.744) (-1339.605) (-1342.414) [-1339.048] * (-1335.143) (-1337.844) [-1341.428] (-1339.530) -- 0:02:42
Average standard deviation of split frequencies: 0.011841
460500 -- (-1334.909) (-1333.977) [-1337.820] (-1349.515) * [-1335.562] (-1346.628) (-1338.366) (-1346.104) -- 0:02:41
461000 -- (-1339.121) [-1331.223] (-1335.666) (-1337.503) * (-1332.725) [-1339.853] (-1337.763) (-1342.095) -- 0:02:42
461500 -- (-1340.024) (-1336.222) [-1337.236] (-1338.429) * (-1348.663) (-1352.973) [-1337.874] (-1336.894) -- 0:02:42
462000 -- (-1338.106) [-1336.764] (-1348.035) (-1339.415) * (-1338.260) [-1344.355] (-1332.497) (-1345.850) -- 0:02:41
462500 -- (-1337.716) (-1339.234) (-1337.897) [-1341.326] * [-1334.057] (-1337.511) (-1336.996) (-1337.589) -- 0:02:41
463000 -- (-1333.312) [-1339.016] (-1350.399) (-1338.069) * (-1337.651) (-1338.058) (-1340.887) [-1340.819] -- 0:02:41
463500 -- [-1340.039] (-1346.628) (-1334.843) (-1341.293) * [-1339.656] (-1342.036) (-1333.129) (-1343.773) -- 0:02:40
464000 -- (-1332.600) (-1333.309) [-1338.233] (-1334.055) * (-1342.917) (-1343.493) (-1332.709) [-1337.398] -- 0:02:41
464500 -- (-1340.362) (-1339.328) [-1342.868] (-1345.675) * (-1330.275) (-1347.492) [-1337.419] (-1342.200) -- 0:02:41
465000 -- (-1340.913) (-1342.085) [-1342.789] (-1336.675) * [-1337.345] (-1339.314) (-1347.552) (-1340.703) -- 0:02:41
Average standard deviation of split frequencies: 0.011706
465500 -- (-1337.125) (-1337.823) (-1338.627) [-1337.621] * (-1343.692) [-1341.884] (-1342.914) (-1343.121) -- 0:02:40
466000 -- (-1340.057) [-1336.292] (-1343.355) (-1339.571) * (-1338.888) [-1340.189] (-1352.215) (-1339.466) -- 0:02:40
466500 -- [-1339.935] (-1334.655) (-1337.985) (-1340.775) * (-1344.470) (-1343.229) (-1342.655) [-1332.782] -- 0:02:40
467000 -- (-1341.067) (-1341.849) (-1338.612) [-1337.940] * (-1336.671) [-1336.238] (-1343.265) (-1337.839) -- 0:02:39
467500 -- (-1337.319) [-1335.069] (-1341.954) (-1339.207) * (-1337.195) (-1351.670) [-1333.805] (-1336.422) -- 0:02:40
468000 -- (-1341.713) (-1338.447) [-1341.867] (-1338.512) * (-1338.274) [-1336.670] (-1333.875) (-1340.020) -- 0:02:40
468500 -- (-1341.745) (-1343.659) (-1345.218) [-1336.840] * (-1337.807) [-1342.254] (-1338.369) (-1340.972) -- 0:02:39
469000 -- (-1335.864) (-1341.512) [-1342.097] (-1345.871) * (-1337.283) [-1332.875] (-1347.170) (-1345.426) -- 0:02:39
469500 -- (-1337.360) (-1336.853) (-1344.175) [-1349.595] * [-1341.797] (-1338.194) (-1338.498) (-1342.374) -- 0:02:39
470000 -- (-1334.414) [-1335.152] (-1342.215) (-1336.628) * [-1339.262] (-1342.105) (-1339.828) (-1341.869) -- 0:02:39
Average standard deviation of split frequencies: 0.010445
470500 -- [-1337.784] (-1343.174) (-1339.567) (-1338.130) * (-1333.168) (-1336.583) (-1338.992) [-1334.650] -- 0:02:38
471000 -- (-1336.745) (-1336.939) [-1341.846] (-1333.671) * (-1338.746) [-1339.641] (-1340.864) (-1332.698) -- 0:02:39
471500 -- (-1340.032) (-1346.193) (-1341.015) [-1335.960] * (-1337.780) (-1336.386) [-1338.168] (-1338.473) -- 0:02:39
472000 -- [-1342.201] (-1340.724) (-1339.172) (-1340.261) * (-1337.393) [-1335.969] (-1335.322) (-1340.838) -- 0:02:38
472500 -- (-1339.040) [-1339.171] (-1341.800) (-1336.694) * (-1341.065) (-1339.608) (-1339.712) [-1344.979] -- 0:02:38
473000 -- (-1339.404) (-1340.162) (-1342.784) [-1335.854] * (-1342.055) [-1335.547] (-1334.461) (-1340.108) -- 0:02:38
473500 -- (-1335.745) [-1337.062] (-1338.761) (-1338.537) * (-1336.782) [-1334.374] (-1342.622) (-1339.534) -- 0:02:37
474000 -- [-1334.329] (-1343.097) (-1346.572) (-1343.071) * (-1336.848) (-1340.277) (-1336.064) [-1335.653] -- 0:02:37
474500 -- (-1342.286) (-1335.127) [-1337.460] (-1340.662) * (-1332.102) (-1337.398) (-1344.099) [-1339.338] -- 0:02:38
475000 -- (-1340.427) (-1339.601) (-1336.632) [-1338.851] * (-1338.794) (-1342.662) [-1337.084] (-1347.540) -- 0:02:38
Average standard deviation of split frequencies: 0.009055
475500 -- (-1341.278) (-1339.686) (-1336.922) [-1342.858] * (-1332.763) (-1343.323) [-1335.321] (-1338.715) -- 0:02:37
476000 -- [-1336.759] (-1343.213) (-1336.037) (-1344.784) * [-1335.782] (-1338.540) (-1333.712) (-1335.939) -- 0:02:37
476500 -- (-1335.401) (-1338.009) (-1338.215) [-1337.423] * [-1337.022] (-1345.491) (-1334.865) (-1343.056) -- 0:02:37
477000 -- (-1335.717) (-1337.500) (-1341.827) [-1337.970] * (-1344.273) [-1332.968] (-1334.877) (-1350.402) -- 0:02:36
477500 -- (-1338.728) (-1336.204) [-1336.879] (-1350.032) * (-1344.139) (-1336.408) (-1339.663) [-1337.364] -- 0:02:36
478000 -- (-1346.959) (-1337.106) [-1341.380] (-1340.329) * (-1336.874) (-1339.128) (-1343.772) [-1338.713] -- 0:02:37
478500 -- (-1335.722) [-1331.782] (-1336.480) (-1336.150) * (-1347.371) (-1340.648) [-1338.769] (-1342.046) -- 0:02:36
479000 -- [-1337.011] (-1338.133) (-1339.544) (-1336.341) * [-1346.980] (-1346.347) (-1337.736) (-1338.725) -- 0:02:36
479500 -- (-1334.373) [-1340.310] (-1335.165) (-1336.024) * [-1343.875] (-1342.329) (-1344.572) (-1338.484) -- 0:02:36
480000 -- (-1341.162) (-1340.727) (-1335.447) [-1335.676] * (-1344.965) (-1340.362) (-1344.736) [-1339.780] -- 0:02:36
Average standard deviation of split frequencies: 0.008406
480500 -- (-1333.051) [-1331.453] (-1341.112) (-1333.055) * (-1341.149) [-1339.731] (-1342.315) (-1346.487) -- 0:02:35
481000 -- [-1342.394] (-1336.184) (-1338.107) (-1342.661) * (-1339.718) (-1336.643) (-1345.358) [-1344.845] -- 0:02:35
481500 -- (-1349.031) (-1333.509) [-1334.437] (-1341.336) * (-1340.387) [-1340.746] (-1336.559) (-1347.100) -- 0:02:36
482000 -- (-1338.156) (-1337.893) [-1335.792] (-1335.910) * (-1342.224) [-1339.750] (-1349.676) (-1344.729) -- 0:02:35
482500 -- (-1336.073) (-1337.894) (-1334.312) [-1339.094] * [-1334.474] (-1340.582) (-1346.002) (-1337.984) -- 0:02:35
483000 -- (-1344.775) (-1342.065) (-1337.652) [-1339.271] * (-1346.145) [-1334.714] (-1335.757) (-1338.614) -- 0:02:35
483500 -- (-1342.816) (-1346.129) [-1340.507] (-1334.809) * [-1343.539] (-1335.301) (-1340.749) (-1338.976) -- 0:02:34
484000 -- (-1340.433) (-1336.713) (-1338.987) [-1336.362] * (-1341.836) [-1342.322] (-1338.465) (-1341.370) -- 0:02:34
484500 -- (-1340.918) (-1336.081) (-1336.447) [-1336.626] * (-1354.799) [-1337.110] (-1335.523) (-1336.335) -- 0:02:34
485000 -- (-1346.814) [-1335.463] (-1332.161) (-1343.506) * (-1353.737) [-1338.384] (-1343.122) (-1336.670) -- 0:02:35
Average standard deviation of split frequencies: 0.008175
485500 -- (-1347.588) (-1341.659) (-1336.409) [-1339.089] * (-1343.480) (-1342.586) [-1333.931] (-1335.373) -- 0:02:34
486000 -- (-1338.705) (-1346.763) (-1341.433) [-1340.080] * (-1344.046) (-1337.952) [-1337.436] (-1342.448) -- 0:02:34
486500 -- (-1335.706) (-1338.943) (-1333.585) [-1336.085] * [-1335.233] (-1349.762) (-1336.531) (-1338.447) -- 0:02:34
487000 -- [-1337.793] (-1344.452) (-1337.988) (-1337.032) * [-1332.622] (-1340.254) (-1337.749) (-1341.027) -- 0:02:33
487500 -- (-1341.917) (-1341.677) (-1339.106) [-1342.266] * (-1334.895) (-1347.573) [-1333.772] (-1333.983) -- 0:02:33
488000 -- [-1336.578] (-1337.888) (-1336.079) (-1347.441) * (-1341.485) (-1342.015) [-1333.267] (-1339.521) -- 0:02:33
488500 -- (-1338.114) (-1340.938) [-1339.243] (-1348.408) * (-1337.588) [-1338.068] (-1341.315) (-1340.215) -- 0:02:33
489000 -- [-1339.342] (-1336.303) (-1341.780) (-1350.525) * (-1340.750) (-1338.303) (-1349.297) [-1338.881] -- 0:02:33
489500 -- (-1343.947) [-1334.944] (-1342.882) (-1337.967) * [-1341.684] (-1338.282) (-1337.382) (-1339.055) -- 0:02:33
490000 -- [-1335.919] (-1334.994) (-1341.418) (-1339.612) * (-1344.613) [-1339.139] (-1345.431) (-1339.595) -- 0:02:33
Average standard deviation of split frequencies: 0.009196
490500 -- [-1337.967] (-1344.321) (-1340.248) (-1343.669) * [-1338.923] (-1335.907) (-1340.199) (-1338.380) -- 0:02:32
491000 -- (-1336.174) (-1339.199) [-1337.821] (-1339.865) * [-1333.196] (-1344.002) (-1335.602) (-1338.472) -- 0:02:32
491500 -- (-1343.070) (-1344.505) (-1346.585) [-1332.895] * [-1334.480] (-1336.423) (-1339.491) (-1337.754) -- 0:02:32
492000 -- (-1337.841) (-1341.146) (-1344.915) [-1333.799] * [-1336.746] (-1333.515) (-1336.302) (-1340.000) -- 0:02:32
492500 -- (-1333.540) [-1336.869] (-1344.564) (-1337.560) * (-1338.781) (-1341.641) [-1332.865] (-1341.048) -- 0:02:32
493000 -- (-1340.983) [-1336.738] (-1346.861) (-1344.671) * (-1337.431) (-1347.023) [-1335.449] (-1343.990) -- 0:02:32
493500 -- [-1338.499] (-1344.013) (-1340.980) (-1354.574) * (-1337.599) (-1335.594) (-1334.916) [-1341.119] -- 0:02:31
494000 -- [-1340.155] (-1349.900) (-1336.066) (-1340.247) * (-1337.416) (-1344.520) (-1337.631) [-1333.464] -- 0:02:31
494500 -- [-1340.560] (-1341.053) (-1344.214) (-1336.552) * (-1338.405) (-1339.627) [-1336.786] (-1334.328) -- 0:02:31
495000 -- (-1340.756) [-1337.739] (-1341.081) (-1337.159) * (-1340.004) [-1341.568] (-1343.815) (-1332.951) -- 0:02:30
Average standard deviation of split frequencies: 0.008825
495500 -- (-1341.469) [-1333.154] (-1341.841) (-1340.811) * (-1333.038) (-1344.262) [-1343.873] (-1339.611) -- 0:02:31
496000 -- (-1344.671) (-1335.920) (-1340.829) [-1338.492] * (-1346.182) (-1344.434) [-1340.348] (-1340.964) -- 0:02:31
496500 -- (-1344.859) (-1339.554) (-1336.830) [-1340.300] * (-1339.875) [-1337.873] (-1338.797) (-1339.087) -- 0:02:31
497000 -- (-1337.094) (-1344.144) (-1342.147) [-1336.725] * [-1338.156] (-1342.239) (-1345.059) (-1334.790) -- 0:02:30
497500 -- (-1337.880) [-1337.757] (-1343.995) (-1346.772) * (-1340.042) (-1339.356) [-1336.365] (-1338.053) -- 0:02:30
498000 -- [-1336.002] (-1343.308) (-1340.917) (-1336.053) * (-1345.139) (-1342.963) (-1337.449) [-1338.355] -- 0:02:30
498500 -- [-1335.950] (-1332.617) (-1334.981) (-1345.658) * (-1340.718) (-1335.155) (-1335.815) [-1342.145] -- 0:02:29
499000 -- [-1338.943] (-1333.927) (-1341.554) (-1350.541) * [-1332.249] (-1335.277) (-1347.074) (-1340.424) -- 0:02:30
499500 -- [-1338.266] (-1339.304) (-1339.284) (-1342.916) * (-1334.705) [-1332.613] (-1336.569) (-1344.186) -- 0:02:30
500000 -- (-1342.388) (-1343.595) [-1338.233] (-1347.474) * (-1341.686) (-1341.153) [-1334.696] (-1341.584) -- 0:02:30
Average standard deviation of split frequencies: 0.007398
500500 -- (-1345.655) (-1336.504) [-1334.408] (-1338.596) * (-1338.366) (-1339.151) (-1339.766) [-1333.721] -- 0:02:29
501000 -- (-1342.325) (-1334.327) (-1338.713) [-1335.879] * (-1339.137) (-1342.710) (-1342.695) [-1333.964] -- 0:02:29
501500 -- (-1350.139) [-1342.606] (-1332.887) (-1334.334) * (-1335.167) (-1341.849) (-1335.849) [-1335.587] -- 0:02:29
502000 -- [-1335.874] (-1336.289) (-1337.745) (-1334.115) * (-1338.866) (-1335.280) [-1333.093] (-1342.678) -- 0:02:28
502500 -- (-1344.660) [-1334.255] (-1342.798) (-1339.374) * (-1339.451) [-1341.308] (-1338.418) (-1336.186) -- 0:02:29
503000 -- (-1345.406) [-1337.187] (-1343.893) (-1339.558) * [-1339.380] (-1340.901) (-1338.587) (-1340.544) -- 0:02:29
503500 -- (-1348.865) (-1340.302) (-1339.574) [-1333.087] * (-1347.608) [-1333.640] (-1337.419) (-1331.692) -- 0:02:28
504000 -- (-1335.491) [-1336.844] (-1345.816) (-1335.409) * (-1339.626) (-1337.035) (-1340.443) [-1336.837] -- 0:02:28
504500 -- (-1335.590) (-1338.274) [-1343.347] (-1337.139) * (-1337.650) (-1339.056) [-1334.870] (-1341.666) -- 0:02:28
505000 -- (-1338.624) (-1335.365) [-1338.413] (-1345.605) * (-1337.564) [-1335.788] (-1340.206) (-1353.852) -- 0:02:28
Average standard deviation of split frequencies: 0.007320
505500 -- (-1341.782) (-1338.057) (-1346.444) [-1335.755] * (-1338.439) (-1338.898) [-1336.960] (-1343.200) -- 0:02:27
506000 -- (-1344.492) (-1340.926) [-1333.265] (-1332.964) * (-1340.796) (-1342.932) (-1346.307) [-1334.653] -- 0:02:28
506500 -- (-1351.565) (-1340.020) (-1338.094) [-1335.329] * (-1335.803) (-1333.311) (-1336.504) [-1335.770] -- 0:02:28
507000 -- (-1339.226) [-1339.680] (-1340.220) (-1336.974) * (-1340.899) [-1340.022] (-1344.894) (-1336.993) -- 0:02:27
507500 -- [-1338.709] (-1340.333) (-1336.435) (-1334.164) * [-1336.708] (-1344.705) (-1339.813) (-1335.118) -- 0:02:27
508000 -- (-1342.723) [-1335.822] (-1334.597) (-1333.213) * (-1340.331) (-1339.021) (-1337.568) [-1335.405] -- 0:02:27
508500 -- [-1338.381] (-1340.332) (-1335.073) (-1351.460) * (-1337.223) (-1341.855) [-1338.451] (-1341.818) -- 0:02:26
509000 -- (-1336.154) [-1332.047] (-1336.731) (-1343.299) * (-1342.257) (-1336.128) [-1341.742] (-1341.023) -- 0:02:26
509500 -- [-1335.388] (-1339.782) (-1339.140) (-1343.554) * (-1340.775) (-1339.406) [-1340.674] (-1338.916) -- 0:02:27
510000 -- (-1335.888) (-1338.587) [-1336.212] (-1346.125) * (-1337.417) (-1343.318) (-1334.732) [-1335.441] -- 0:02:27
Average standard deviation of split frequencies: 0.006462
510500 -- (-1335.660) (-1338.297) (-1337.194) [-1340.061] * (-1341.711) (-1343.654) (-1338.577) [-1339.337] -- 0:02:26
511000 -- [-1340.319] (-1341.111) (-1337.193) (-1348.365) * (-1337.176) (-1338.796) [-1333.551] (-1345.671) -- 0:02:26
511500 -- (-1335.383) [-1341.627] (-1345.545) (-1337.103) * [-1340.439] (-1333.394) (-1342.824) (-1346.312) -- 0:02:26
512000 -- [-1338.735] (-1346.250) (-1337.743) (-1340.462) * (-1339.586) (-1336.956) [-1332.340] (-1347.291) -- 0:02:25
512500 -- [-1338.025] (-1345.486) (-1350.776) (-1342.674) * (-1337.711) [-1347.024] (-1335.854) (-1331.555) -- 0:02:25
513000 -- (-1333.338) [-1343.468] (-1339.490) (-1347.386) * (-1338.510) [-1332.832] (-1336.302) (-1336.843) -- 0:02:26
513500 -- (-1338.824) (-1343.936) [-1342.406] (-1340.508) * (-1348.605) (-1340.689) [-1339.272] (-1341.571) -- 0:02:25
514000 -- [-1332.964] (-1343.509) (-1338.800) (-1342.910) * (-1344.674) (-1347.959) [-1341.989] (-1340.373) -- 0:02:25
514500 -- (-1340.866) [-1332.735] (-1338.954) (-1339.589) * (-1336.695) [-1333.552] (-1335.644) (-1345.337) -- 0:02:25
515000 -- (-1333.315) (-1341.508) [-1336.605] (-1337.282) * (-1338.972) [-1332.962] (-1335.463) (-1336.209) -- 0:02:25
Average standard deviation of split frequencies: 0.007961
515500 -- (-1337.943) (-1337.943) (-1339.047) [-1335.728] * (-1335.106) (-1337.004) (-1336.099) [-1340.691] -- 0:02:24
516000 -- [-1335.416] (-1339.741) (-1341.371) (-1341.433) * [-1334.515] (-1341.913) (-1339.175) (-1345.157) -- 0:02:24
516500 -- (-1336.742) (-1335.643) [-1337.869] (-1343.644) * [-1336.466] (-1342.702) (-1341.588) (-1334.287) -- 0:02:25
517000 -- (-1336.493) [-1333.155] (-1339.653) (-1337.767) * (-1337.335) (-1342.683) [-1338.719] (-1334.571) -- 0:02:24
517500 -- (-1331.399) [-1344.457] (-1350.345) (-1342.444) * [-1337.207] (-1333.359) (-1345.699) (-1338.627) -- 0:02:24
518000 -- (-1333.080) [-1335.996] (-1343.072) (-1333.714) * (-1339.348) [-1339.154] (-1343.983) (-1339.465) -- 0:02:24
518500 -- (-1331.996) (-1337.588) (-1341.806) [-1335.499] * (-1339.898) (-1344.303) [-1336.375] (-1339.528) -- 0:02:23
519000 -- (-1339.353) [-1334.701] (-1343.190) (-1334.271) * (-1341.877) (-1340.054) (-1340.501) [-1335.418] -- 0:02:23
519500 -- (-1333.859) [-1334.778] (-1340.173) (-1333.051) * (-1334.019) [-1341.011] (-1340.265) (-1343.080) -- 0:02:23
520000 -- (-1341.595) (-1333.355) (-1339.311) [-1335.174] * (-1346.708) [-1336.185] (-1343.167) (-1339.234) -- 0:02:24
Average standard deviation of split frequencies: 0.007760
520500 -- [-1335.367] (-1344.155) (-1340.112) (-1345.754) * (-1333.410) [-1335.160] (-1338.193) (-1345.172) -- 0:02:23
521000 -- [-1328.984] (-1341.024) (-1334.314) (-1342.475) * (-1345.712) [-1333.460] (-1341.282) (-1337.705) -- 0:02:23
521500 -- (-1337.935) (-1345.516) (-1337.560) [-1343.519] * (-1338.229) (-1334.951) [-1342.444] (-1338.644) -- 0:02:23
522000 -- [-1332.966] (-1335.528) (-1341.187) (-1338.631) * [-1331.529] (-1337.551) (-1341.840) (-1342.183) -- 0:02:22
522500 -- (-1331.964) [-1340.543] (-1335.932) (-1339.151) * (-1338.147) (-1335.700) (-1341.349) [-1330.602] -- 0:02:22
523000 -- (-1343.232) [-1334.808] (-1343.181) (-1341.466) * [-1331.671] (-1346.969) (-1331.264) (-1337.659) -- 0:02:22
523500 -- (-1338.735) [-1342.143] (-1339.421) (-1338.594) * [-1337.288] (-1342.174) (-1337.408) (-1350.471) -- 0:02:22
524000 -- (-1336.400) (-1337.904) (-1342.421) [-1342.451] * (-1337.375) [-1347.147] (-1336.439) (-1344.249) -- 0:02:22
524500 -- [-1336.518] (-1338.255) (-1337.366) (-1335.679) * (-1335.640) [-1335.096] (-1335.455) (-1345.919) -- 0:02:22
525000 -- (-1341.868) [-1336.567] (-1343.439) (-1338.829) * [-1336.791] (-1340.540) (-1336.951) (-1347.183) -- 0:02:22
Average standard deviation of split frequencies: 0.007938
525500 -- (-1333.110) (-1342.130) [-1340.170] (-1342.678) * [-1335.582] (-1332.795) (-1335.558) (-1338.564) -- 0:02:21
526000 -- (-1341.669) (-1340.489) (-1335.982) [-1338.684] * (-1341.410) [-1333.519] (-1337.516) (-1332.047) -- 0:02:21
526500 -- (-1338.279) (-1337.079) [-1335.076] (-1343.956) * (-1334.885) (-1340.550) (-1338.080) [-1337.742] -- 0:02:21
527000 -- (-1339.012) (-1338.072) (-1336.595) [-1334.236] * (-1336.648) (-1340.966) (-1345.354) [-1342.561] -- 0:02:21
527500 -- (-1337.864) (-1336.943) (-1336.662) [-1336.705] * (-1339.212) (-1337.439) (-1337.558) [-1332.854] -- 0:02:21
528000 -- [-1334.929] (-1340.325) (-1338.948) (-1335.585) * (-1333.822) (-1340.370) [-1337.446] (-1342.368) -- 0:02:21
528500 -- (-1340.968) (-1340.462) (-1341.915) [-1338.823] * [-1339.840] (-1341.539) (-1340.328) (-1333.300) -- 0:02:20
529000 -- (-1339.795) (-1330.528) [-1341.036] (-1345.841) * (-1335.450) [-1343.454] (-1339.540) (-1335.918) -- 0:02:20
529500 -- (-1346.446) (-1341.566) (-1343.851) [-1334.989] * (-1340.181) [-1338.250] (-1340.821) (-1333.660) -- 0:02:20
530000 -- (-1346.309) (-1333.609) [-1336.225] (-1335.924) * (-1345.738) (-1342.781) (-1338.074) [-1331.361] -- 0:02:20
Average standard deviation of split frequencies: 0.007741
530500 -- (-1339.507) (-1338.395) (-1329.907) [-1337.747] * (-1344.611) (-1338.169) [-1332.807] (-1336.065) -- 0:02:20
531000 -- (-1335.630) (-1338.613) [-1335.976] (-1340.935) * (-1341.566) (-1333.081) (-1343.478) [-1341.429] -- 0:02:20
531500 -- (-1339.855) [-1343.139] (-1339.143) (-1341.220) * (-1343.104) [-1334.057] (-1345.177) (-1338.167) -- 0:02:20
532000 -- (-1335.296) (-1347.710) [-1333.731] (-1339.601) * (-1340.424) (-1344.036) (-1338.953) [-1335.099] -- 0:02:19
532500 -- (-1339.932) (-1344.777) [-1332.726] (-1336.608) * (-1341.885) (-1342.290) (-1341.930) [-1332.230] -- 0:02:19
533000 -- (-1346.554) [-1342.453] (-1340.243) (-1338.390) * [-1334.749] (-1334.824) (-1342.546) (-1338.694) -- 0:02:19
533500 -- (-1334.440) (-1337.798) [-1334.844] (-1337.429) * (-1345.840) (-1342.034) [-1335.612] (-1336.787) -- 0:02:19
534000 -- (-1337.450) [-1336.110] (-1343.350) (-1344.204) * (-1340.785) (-1339.828) [-1342.105] (-1347.041) -- 0:02:19
534500 -- (-1333.470) (-1334.845) [-1335.843] (-1343.678) * [-1336.192] (-1342.914) (-1348.929) (-1335.726) -- 0:02:19
535000 -- (-1339.761) [-1339.638] (-1340.622) (-1337.641) * (-1337.775) [-1343.170] (-1340.751) (-1340.156) -- 0:02:19
Average standard deviation of split frequencies: 0.007413
535500 -- (-1343.724) (-1332.792) [-1337.910] (-1344.791) * (-1339.611) (-1339.471) [-1343.207] (-1341.388) -- 0:02:18
536000 -- (-1342.297) (-1336.880) [-1338.582] (-1331.726) * (-1342.079) (-1344.332) [-1334.796] (-1333.845) -- 0:02:18
536500 -- (-1340.938) (-1333.833) [-1334.519] (-1336.574) * [-1334.110] (-1338.350) (-1342.466) (-1342.169) -- 0:02:18
537000 -- [-1339.824] (-1341.534) (-1346.954) (-1335.791) * (-1338.968) [-1333.317] (-1341.381) (-1348.521) -- 0:02:17
537500 -- (-1346.115) [-1339.825] (-1344.224) (-1340.976) * (-1339.411) (-1336.147) (-1339.855) [-1337.816] -- 0:02:18
538000 -- (-1352.385) [-1340.129] (-1343.621) (-1336.457) * (-1336.250) (-1333.809) (-1338.094) [-1334.897] -- 0:02:18
538500 -- [-1337.162] (-1342.966) (-1336.980) (-1336.492) * [-1335.833] (-1329.574) (-1344.315) (-1339.660) -- 0:02:17
539000 -- [-1337.769] (-1333.616) (-1334.804) (-1340.122) * (-1343.234) [-1337.225] (-1336.330) (-1340.989) -- 0:02:17
539500 -- [-1341.978] (-1341.358) (-1340.762) (-1337.202) * (-1333.299) [-1336.365] (-1339.613) (-1337.428) -- 0:02:17
540000 -- (-1341.586) (-1341.281) (-1341.113) [-1335.046] * (-1338.781) (-1342.107) (-1336.919) [-1331.312] -- 0:02:17
Average standard deviation of split frequencies: 0.006726
540500 -- (-1345.797) (-1342.808) [-1337.113] (-1334.040) * (-1342.510) [-1340.464] (-1338.487) (-1334.395) -- 0:02:16
541000 -- (-1338.870) [-1341.265] (-1339.764) (-1342.026) * (-1339.421) [-1338.165] (-1338.866) (-1334.106) -- 0:02:17
541500 -- (-1334.476) (-1340.918) (-1337.143) [-1339.250] * (-1342.279) [-1337.878] (-1342.221) (-1345.413) -- 0:02:17
542000 -- (-1337.601) [-1337.144] (-1338.883) (-1344.080) * (-1333.735) [-1338.891] (-1336.895) (-1335.747) -- 0:02:16
542500 -- (-1342.786) [-1337.738] (-1338.129) (-1344.653) * (-1337.428) (-1334.700) (-1337.671) [-1341.688] -- 0:02:16
543000 -- (-1337.764) [-1338.172] (-1349.341) (-1344.201) * (-1336.722) [-1335.970] (-1343.087) (-1345.041) -- 0:02:16
543500 -- (-1349.293) (-1338.621) (-1336.131) [-1336.402] * (-1335.355) [-1333.332] (-1340.355) (-1344.739) -- 0:02:16
544000 -- (-1339.844) [-1337.672] (-1338.285) (-1331.144) * (-1333.551) (-1341.150) (-1340.637) [-1340.902] -- 0:02:15
544500 -- (-1344.313) [-1333.908] (-1343.413) (-1338.966) * (-1345.484) (-1343.022) [-1340.230] (-1335.326) -- 0:02:16
545000 -- (-1335.302) (-1338.758) (-1348.168) [-1333.703] * (-1345.098) [-1334.238] (-1340.434) (-1344.234) -- 0:02:16
Average standard deviation of split frequencies: 0.006044
545500 -- [-1337.935] (-1341.558) (-1339.562) (-1340.119) * (-1338.318) (-1340.895) [-1340.887] (-1344.670) -- 0:02:15
546000 -- (-1341.721) (-1337.286) (-1343.009) [-1336.340] * (-1347.406) (-1335.630) (-1335.040) [-1344.849] -- 0:02:15
546500 -- [-1340.181] (-1334.862) (-1346.199) (-1343.941) * (-1334.630) (-1342.485) [-1347.751] (-1338.872) -- 0:02:15
547000 -- [-1341.090] (-1340.059) (-1342.157) (-1338.374) * (-1345.628) (-1342.620) [-1337.228] (-1338.717) -- 0:02:14
547500 -- (-1339.794) (-1343.182) [-1333.051] (-1338.862) * (-1344.847) [-1341.435] (-1338.986) (-1332.105) -- 0:02:14
548000 -- (-1340.285) [-1334.450] (-1340.915) (-1338.504) * (-1342.035) [-1333.998] (-1336.955) (-1339.064) -- 0:02:15
548500 -- (-1343.890) [-1339.698] (-1340.397) (-1337.168) * (-1342.643) [-1338.169] (-1338.518) (-1340.650) -- 0:02:14
549000 -- (-1333.729) (-1338.867) [-1340.422] (-1340.236) * (-1338.835) (-1338.973) (-1344.047) [-1345.636] -- 0:02:14
549500 -- (-1333.681) (-1341.006) [-1336.312] (-1336.707) * (-1343.120) (-1338.800) (-1338.567) [-1339.593] -- 0:02:14
550000 -- (-1342.163) (-1336.214) (-1338.724) [-1335.172] * (-1333.132) (-1335.583) (-1359.071) [-1337.573] -- 0:02:14
Average standard deviation of split frequencies: 0.006237
550500 -- [-1331.808] (-1336.695) (-1337.666) (-1334.834) * (-1332.517) (-1349.140) (-1345.364) [-1333.026] -- 0:02:13
551000 -- (-1339.888) (-1343.202) [-1340.761] (-1337.959) * [-1337.848] (-1343.006) (-1346.886) (-1349.704) -- 0:02:13
551500 -- (-1341.208) [-1338.336] (-1334.705) (-1333.303) * [-1337.299] (-1338.339) (-1337.246) (-1344.280) -- 0:02:14
552000 -- (-1339.870) [-1340.127] (-1342.263) (-1341.415) * (-1337.558) (-1344.145) [-1331.247] (-1351.825) -- 0:02:13
552500 -- (-1336.356) (-1346.787) [-1348.218] (-1336.002) * (-1345.711) [-1336.590] (-1336.655) (-1339.042) -- 0:02:13
553000 -- (-1339.885) (-1345.199) [-1335.805] (-1335.878) * (-1337.313) (-1350.918) (-1340.693) [-1337.049] -- 0:02:13
553500 -- [-1346.351] (-1336.439) (-1340.056) (-1336.413) * (-1340.473) (-1347.218) (-1338.948) [-1339.888] -- 0:02:13
554000 -- [-1344.443] (-1336.885) (-1338.320) (-1338.948) * (-1347.871) (-1348.056) [-1337.260] (-1336.060) -- 0:02:12
554500 -- (-1340.051) (-1344.194) (-1335.132) [-1338.849] * (-1340.227) (-1336.060) (-1346.225) [-1343.274] -- 0:02:12
555000 -- (-1336.244) (-1342.478) [-1336.914] (-1339.412) * (-1335.252) (-1334.873) [-1339.696] (-1338.909) -- 0:02:13
Average standard deviation of split frequencies: 0.006541
555500 -- (-1335.735) (-1337.539) (-1336.511) [-1332.929] * (-1338.638) (-1338.730) [-1338.040] (-1332.883) -- 0:02:12
556000 -- [-1336.166] (-1339.471) (-1332.364) (-1336.922) * [-1336.285] (-1339.425) (-1340.434) (-1330.596) -- 0:02:12
556500 -- (-1341.390) [-1333.482] (-1338.953) (-1342.183) * (-1339.679) (-1344.278) (-1336.509) [-1336.608] -- 0:02:12
557000 -- (-1338.919) [-1336.364] (-1336.182) (-1335.059) * (-1345.137) (-1343.450) [-1337.587] (-1333.266) -- 0:02:12
557500 -- (-1349.541) (-1343.305) [-1340.124] (-1334.623) * [-1338.485] (-1356.059) (-1338.430) (-1338.781) -- 0:02:11
558000 -- (-1342.983) (-1341.743) [-1338.825] (-1339.634) * (-1334.639) (-1335.426) (-1341.993) [-1337.328] -- 0:02:12
558500 -- (-1349.777) [-1338.688] (-1335.759) (-1336.172) * [-1339.325] (-1339.926) (-1343.906) (-1335.523) -- 0:02:12
559000 -- (-1330.920) (-1356.773) (-1337.052) [-1331.400] * (-1345.234) [-1338.672] (-1336.517) (-1335.202) -- 0:02:11
559500 -- (-1339.997) (-1337.378) (-1343.697) [-1334.612] * [-1336.760] (-1340.303) (-1334.129) (-1330.002) -- 0:02:11
560000 -- (-1342.853) [-1336.297] (-1338.498) (-1339.113) * (-1339.736) (-1340.964) (-1344.136) [-1341.906] -- 0:02:11
Average standard deviation of split frequencies: 0.006126
560500 -- [-1348.392] (-1340.836) (-1340.340) (-1340.348) * (-1349.896) (-1335.064) [-1336.823] (-1352.875) -- 0:02:10
561000 -- (-1342.463) (-1340.129) [-1339.796] (-1336.909) * (-1352.760) (-1345.791) [-1335.853] (-1338.009) -- 0:02:10
561500 -- (-1342.174) [-1337.099] (-1337.889) (-1339.805) * (-1334.961) (-1335.061) [-1331.306] (-1336.498) -- 0:02:11
562000 -- [-1334.315] (-1333.842) (-1332.329) (-1342.520) * (-1340.084) (-1331.965) [-1334.669] (-1345.033) -- 0:02:10
562500 -- (-1346.997) [-1331.582] (-1330.531) (-1335.518) * [-1333.184] (-1335.177) (-1333.941) (-1336.472) -- 0:02:10
563000 -- (-1339.634) (-1338.747) (-1335.034) [-1336.500] * (-1336.022) [-1342.665] (-1339.968) (-1344.764) -- 0:02:10
563500 -- (-1337.474) (-1339.883) [-1343.909] (-1344.252) * (-1334.054) (-1338.648) (-1345.200) [-1335.500] -- 0:02:10
564000 -- (-1338.473) (-1337.562) [-1342.637] (-1339.270) * (-1341.460) (-1334.659) (-1333.245) [-1335.370] -- 0:02:09
564500 -- [-1337.320] (-1345.094) (-1341.520) (-1334.588) * (-1339.912) [-1340.933] (-1337.179) (-1344.262) -- 0:02:09
565000 -- (-1336.311) [-1339.079] (-1342.689) (-1334.924) * (-1337.971) (-1347.801) [-1334.754] (-1334.162) -- 0:02:10
Average standard deviation of split frequencies: 0.006663
565500 -- [-1338.176] (-1342.865) (-1347.507) (-1335.630) * (-1345.965) (-1343.579) (-1341.003) [-1340.454] -- 0:02:09
566000 -- (-1333.638) (-1339.756) (-1352.644) [-1342.162] * (-1338.150) (-1336.905) [-1332.475] (-1338.950) -- 0:02:09
566500 -- (-1331.337) (-1336.434) (-1339.062) [-1336.888] * [-1337.745] (-1342.123) (-1345.490) (-1344.842) -- 0:02:09
567000 -- (-1342.187) [-1340.276] (-1344.484) (-1344.712) * (-1336.212) (-1344.399) [-1334.897] (-1338.166) -- 0:02:09
567500 -- (-1340.513) (-1340.081) (-1339.191) [-1338.212] * [-1339.173] (-1339.796) (-1337.333) (-1337.081) -- 0:02:08
568000 -- (-1341.936) [-1334.835] (-1343.794) (-1339.011) * (-1345.287) (-1345.645) [-1342.189] (-1334.250) -- 0:02:08
568500 -- (-1332.065) (-1340.885) [-1341.336] (-1332.618) * (-1347.132) (-1340.700) [-1342.570] (-1334.287) -- 0:02:09
569000 -- (-1342.219) (-1337.159) (-1340.734) [-1334.503] * (-1338.804) (-1348.273) (-1346.616) [-1335.925] -- 0:02:08
569500 -- [-1341.217] (-1344.461) (-1335.249) (-1336.269) * [-1334.795] (-1338.771) (-1349.904) (-1336.789) -- 0:02:08
570000 -- (-1331.276) (-1333.301) [-1334.169] (-1336.682) * (-1331.495) [-1339.774] (-1335.502) (-1341.169) -- 0:02:08
Average standard deviation of split frequencies: 0.005782
570500 -- (-1336.557) (-1330.777) (-1335.583) [-1342.212] * [-1336.233] (-1336.294) (-1333.351) (-1333.175) -- 0:02:07
571000 -- (-1334.878) [-1339.536] (-1336.334) (-1331.311) * [-1341.089] (-1339.910) (-1344.234) (-1337.263) -- 0:02:07
571500 -- (-1334.955) [-1331.424] (-1334.973) (-1343.746) * (-1340.678) (-1335.941) [-1338.350] (-1347.081) -- 0:02:07
572000 -- (-1338.128) (-1338.519) [-1338.501] (-1337.239) * (-1345.642) (-1338.453) (-1349.071) [-1333.798] -- 0:02:07
572500 -- (-1337.491) [-1334.818] (-1337.183) (-1343.368) * (-1337.124) (-1341.560) (-1339.700) [-1334.010] -- 0:02:07
573000 -- (-1336.151) (-1334.386) (-1337.411) [-1336.294] * (-1339.000) (-1338.840) [-1339.106] (-1340.203) -- 0:02:07
573500 -- (-1339.952) (-1337.946) [-1341.913] (-1341.952) * (-1335.439) [-1338.269] (-1335.554) (-1334.425) -- 0:02:07
574000 -- (-1334.445) (-1340.804) [-1339.412] (-1339.628) * (-1338.276) [-1339.770] (-1334.017) (-1338.952) -- 0:02:06
574500 -- (-1338.666) [-1339.130] (-1336.344) (-1339.409) * (-1337.297) [-1337.565] (-1341.607) (-1335.538) -- 0:02:06
575000 -- (-1335.728) [-1340.025] (-1337.258) (-1337.672) * (-1334.425) (-1338.974) [-1340.944] (-1334.651) -- 0:02:06
Average standard deviation of split frequencies: 0.005963
575500 -- (-1341.041) (-1336.141) (-1349.506) [-1335.315] * (-1338.718) (-1339.958) [-1335.438] (-1337.063) -- 0:02:06
576000 -- (-1336.125) (-1340.644) (-1347.105) [-1337.997] * [-1345.933] (-1343.936) (-1342.717) (-1344.278) -- 0:02:06
576500 -- (-1338.531) [-1337.602] (-1349.338) (-1339.095) * (-1337.148) (-1350.248) [-1332.902] (-1342.774) -- 0:02:06
577000 -- (-1342.582) (-1337.401) (-1335.401) [-1336.616] * (-1337.489) (-1341.712) [-1339.504] (-1342.908) -- 0:02:06
577500 -- [-1338.371] (-1345.704) (-1339.394) (-1336.905) * (-1341.425) (-1338.223) (-1345.080) [-1341.646] -- 0:02:05
578000 -- (-1341.555) [-1336.734] (-1338.840) (-1341.783) * [-1342.682] (-1344.444) (-1344.207) (-1338.505) -- 0:02:05
578500 -- (-1336.582) [-1341.937] (-1340.618) (-1339.292) * [-1332.266] (-1337.332) (-1344.241) (-1335.122) -- 0:02:05
579000 -- [-1337.599] (-1341.836) (-1342.614) (-1342.577) * [-1336.177] (-1335.477) (-1333.763) (-1344.743) -- 0:02:05
579500 -- (-1338.222) (-1343.249) [-1344.873] (-1348.693) * [-1336.060] (-1338.943) (-1341.174) (-1346.441) -- 0:02:05
580000 -- (-1337.607) (-1344.669) (-1340.254) [-1337.442] * (-1337.760) (-1339.877) (-1345.266) [-1340.255] -- 0:02:05
Average standard deviation of split frequencies: 0.004871
580500 -- [-1338.864] (-1348.065) (-1343.358) (-1346.553) * (-1331.297) (-1340.925) [-1335.521] (-1341.980) -- 0:02:05
581000 -- (-1342.572) [-1338.738] (-1342.766) (-1339.226) * [-1344.287] (-1336.289) (-1334.569) (-1338.519) -- 0:02:04
581500 -- (-1341.798) (-1346.086) (-1342.587) [-1332.967] * (-1336.500) (-1335.940) (-1338.219) [-1346.437] -- 0:02:04
582000 -- (-1342.513) (-1338.548) (-1344.970) [-1334.737] * (-1336.365) (-1339.542) (-1338.008) [-1335.242] -- 0:02:04
582500 -- (-1337.235) (-1342.354) (-1347.898) [-1332.418] * (-1336.387) (-1338.716) [-1343.068] (-1347.672) -- 0:02:04
583000 -- (-1344.428) (-1338.977) [-1343.017] (-1342.994) * (-1344.500) (-1336.699) [-1339.456] (-1338.783) -- 0:02:04
583500 -- (-1350.647) [-1333.337] (-1336.361) (-1340.901) * [-1334.528] (-1338.760) (-1334.849) (-1336.413) -- 0:02:04
584000 -- (-1344.521) (-1334.685) (-1339.017) [-1334.070] * (-1341.313) (-1340.014) (-1346.158) [-1338.372] -- 0:02:03
584500 -- (-1344.637) (-1346.790) (-1335.247) [-1338.176] * [-1334.555] (-1343.184) (-1344.429) (-1339.231) -- 0:02:03
585000 -- [-1331.411] (-1334.892) (-1336.662) (-1338.319) * (-1344.790) (-1351.857) (-1336.275) [-1340.714] -- 0:02:03
Average standard deviation of split frequencies: 0.003907
585500 -- (-1347.071) [-1338.277] (-1344.551) (-1340.249) * (-1336.729) (-1345.800) (-1338.194) [-1336.539] -- 0:02:03
586000 -- (-1349.032) (-1340.386) (-1345.555) [-1339.009] * [-1335.047] (-1341.988) (-1336.657) (-1338.233) -- 0:02:03
586500 -- (-1337.781) (-1337.739) [-1336.556] (-1337.035) * (-1338.256) [-1336.210] (-1338.479) (-1336.773) -- 0:02:03
587000 -- (-1337.333) (-1342.594) (-1344.525) [-1338.910] * (-1339.164) [-1335.786] (-1346.506) (-1339.032) -- 0:02:03
587500 -- (-1343.682) [-1333.922] (-1342.584) (-1341.328) * (-1341.550) (-1340.389) (-1336.047) [-1339.820] -- 0:02:02
588000 -- (-1338.020) (-1339.361) (-1346.253) [-1338.838] * (-1342.032) [-1342.382] (-1337.021) (-1336.640) -- 0:02:02
588500 -- [-1337.754] (-1342.052) (-1334.810) (-1338.757) * (-1341.273) (-1335.563) (-1338.275) [-1339.030] -- 0:02:02
589000 -- (-1336.393) (-1340.579) (-1337.118) [-1346.012] * [-1334.637] (-1335.446) (-1346.723) (-1335.323) -- 0:02:02
589500 -- [-1331.939] (-1336.268) (-1344.254) (-1350.708) * (-1339.006) [-1342.644] (-1340.569) (-1341.118) -- 0:02:02
590000 -- (-1341.140) (-1340.002) [-1340.072] (-1342.545) * (-1345.584) [-1339.568] (-1337.246) (-1339.872) -- 0:02:02
Average standard deviation of split frequencies: 0.003990
590500 -- (-1335.407) (-1341.594) (-1336.056) [-1342.049] * (-1352.501) (-1334.675) [-1342.719] (-1342.737) -- 0:02:02
591000 -- [-1338.734] (-1338.872) (-1339.350) (-1343.680) * (-1341.901) (-1331.242) [-1339.744] (-1340.191) -- 0:02:01
591500 -- (-1334.810) (-1340.138) (-1335.700) [-1334.918] * (-1341.439) (-1339.428) [-1333.337] (-1335.642) -- 0:02:01
592000 -- (-1340.176) [-1338.417] (-1334.983) (-1338.770) * (-1336.306) (-1334.273) (-1354.046) [-1334.547] -- 0:02:01
592500 -- (-1340.456) (-1340.394) [-1333.722] (-1339.157) * (-1336.760) (-1345.753) [-1340.839] (-1339.660) -- 0:02:01
593000 -- (-1337.232) [-1332.833] (-1335.552) (-1336.897) * (-1349.145) (-1347.421) (-1346.635) [-1335.103] -- 0:02:01
593500 -- (-1333.070) (-1333.151) (-1348.073) [-1340.427] * [-1338.593] (-1338.675) (-1341.318) (-1340.363) -- 0:02:01
594000 -- (-1335.615) (-1339.428) (-1341.097) [-1334.583] * (-1339.548) (-1352.316) [-1338.696] (-1346.975) -- 0:02:00
594500 -- (-1337.337) (-1342.391) [-1340.548] (-1334.519) * (-1334.600) [-1338.466] (-1341.830) (-1338.116) -- 0:02:00
595000 -- (-1339.070) (-1335.770) (-1338.429) [-1334.810] * (-1335.000) (-1336.019) [-1334.979] (-1334.551) -- 0:02:00
Average standard deviation of split frequencies: 0.004294
595500 -- (-1340.158) (-1337.893) (-1344.338) [-1336.655] * [-1334.009] (-1338.165) (-1344.468) (-1341.346) -- 0:02:00
596000 -- [-1338.740] (-1350.098) (-1335.751) (-1340.353) * (-1333.179) [-1334.981] (-1337.318) (-1344.761) -- 0:01:59
596500 -- (-1343.867) (-1345.288) (-1340.551) [-1335.706] * (-1339.855) (-1345.515) (-1338.897) [-1341.813] -- 0:02:00
597000 -- (-1344.920) (-1340.265) (-1333.357) [-1335.992] * (-1337.210) (-1340.684) [-1331.378] (-1347.542) -- 0:02:00
597500 -- [-1336.091] (-1341.467) (-1332.814) (-1333.394) * [-1334.493] (-1333.368) (-1343.745) (-1343.008) -- 0:01:59
598000 -- (-1348.648) [-1338.865] (-1339.455) (-1336.190) * (-1338.689) (-1336.102) (-1338.195) [-1333.475] -- 0:01:59
598500 -- (-1337.658) (-1336.197) [-1345.396] (-1336.354) * (-1339.520) (-1340.253) (-1338.721) [-1337.130] -- 0:01:59
599000 -- [-1334.793] (-1343.693) (-1344.189) (-1336.184) * (-1332.810) (-1337.308) (-1337.071) [-1343.066] -- 0:01:59
599500 -- [-1336.814] (-1341.764) (-1347.485) (-1334.634) * [-1337.485] (-1347.775) (-1338.212) (-1339.623) -- 0:01:58
600000 -- (-1336.961) [-1336.554] (-1343.598) (-1343.820) * (-1334.155) [-1344.463] (-1339.603) (-1343.605) -- 0:01:59
Average standard deviation of split frequencies: 0.005269
600500 -- (-1339.184) (-1347.169) (-1331.789) [-1337.398] * (-1343.996) (-1346.571) (-1339.409) [-1335.975] -- 0:01:59
601000 -- (-1349.016) [-1338.481] (-1339.870) (-1339.255) * (-1342.811) (-1340.927) (-1339.007) [-1340.043] -- 0:01:58
601500 -- (-1333.604) (-1340.910) (-1334.234) [-1342.201] * [-1334.985] (-1346.702) (-1341.279) (-1335.070) -- 0:01:58
602000 -- (-1337.094) [-1339.445] (-1333.403) (-1336.526) * (-1334.257) [-1335.413] (-1336.675) (-1337.827) -- 0:01:58
602500 -- (-1335.345) (-1338.712) [-1336.806] (-1336.974) * [-1338.993] (-1334.868) (-1343.003) (-1345.216) -- 0:01:58
603000 -- (-1337.090) (-1338.457) (-1333.372) [-1335.879] * [-1336.206] (-1346.519) (-1338.375) (-1342.971) -- 0:01:57
603500 -- (-1340.531) [-1339.404] (-1334.384) (-1335.934) * (-1337.359) [-1337.392] (-1342.458) (-1342.502) -- 0:01:58
604000 -- (-1345.228) [-1335.065] (-1340.402) (-1345.139) * (-1341.375) [-1335.975] (-1335.025) (-1335.314) -- 0:01:58
604500 -- (-1347.782) (-1343.626) (-1343.366) [-1338.134] * [-1337.714] (-1342.559) (-1337.806) (-1337.239) -- 0:01:57
605000 -- (-1338.766) (-1340.021) [-1337.604] (-1344.517) * (-1339.272) [-1337.413] (-1339.909) (-1336.861) -- 0:01:57
Average standard deviation of split frequencies: 0.005445
605500 -- (-1343.293) (-1341.437) [-1334.303] (-1338.753) * [-1337.226] (-1341.508) (-1341.297) (-1338.448) -- 0:01:57
606000 -- (-1339.835) (-1340.135) [-1332.242] (-1332.296) * (-1333.728) (-1339.475) [-1334.832] (-1340.980) -- 0:01:57
606500 -- (-1341.067) (-1337.550) (-1346.757) [-1340.025] * (-1338.578) (-1352.033) (-1336.364) [-1337.685] -- 0:01:56
607000 -- (-1344.648) (-1341.383) (-1338.501) [-1336.967] * (-1343.991) [-1335.000] (-1333.627) (-1335.482) -- 0:01:57
607500 -- (-1341.992) [-1334.484] (-1341.193) (-1340.150) * (-1342.292) [-1341.470] (-1345.293) (-1334.534) -- 0:01:56
608000 -- (-1340.333) (-1343.271) (-1339.738) [-1334.809] * (-1341.393) (-1340.706) (-1335.526) [-1338.483] -- 0:01:56
608500 -- (-1344.141) (-1342.529) [-1334.217] (-1343.800) * (-1334.882) (-1350.593) (-1336.324) [-1336.581] -- 0:01:56
609000 -- (-1333.791) [-1336.814] (-1337.782) (-1345.375) * (-1337.831) (-1344.955) [-1335.863] (-1339.584) -- 0:01:56
609500 -- (-1335.367) [-1340.692] (-1341.691) (-1345.252) * (-1341.294) (-1345.171) (-1341.901) [-1335.095] -- 0:01:55
610000 -- (-1337.232) [-1343.508] (-1340.433) (-1346.676) * (-1339.799) (-1337.734) [-1341.308] (-1342.724) -- 0:01:55
Average standard deviation of split frequencies: 0.006727
610500 -- (-1333.513) (-1336.370) [-1332.666] (-1342.750) * (-1337.113) (-1348.902) [-1331.851] (-1337.653) -- 0:01:56
611000 -- [-1342.985] (-1342.967) (-1334.028) (-1342.604) * [-1334.497] (-1344.286) (-1335.846) (-1341.640) -- 0:01:55
611500 -- (-1341.333) (-1341.704) [-1337.152] (-1333.469) * (-1339.209) (-1342.931) (-1336.502) [-1336.708] -- 0:01:55
612000 -- [-1337.148] (-1337.799) (-1333.322) (-1339.648) * [-1330.953] (-1336.395) (-1334.580) (-1334.795) -- 0:01:55
612500 -- (-1342.365) [-1342.681] (-1336.709) (-1333.726) * (-1333.000) [-1332.934] (-1344.964) (-1340.843) -- 0:01:55
613000 -- (-1343.729) (-1346.406) (-1340.077) [-1334.816] * (-1337.944) (-1339.686) (-1335.624) [-1335.921] -- 0:01:54
613500 -- (-1342.063) (-1339.346) [-1341.391] (-1343.092) * [-1331.563] (-1338.681) (-1342.629) (-1340.728) -- 0:01:54
614000 -- (-1337.805) (-1339.688) (-1338.664) [-1338.542] * (-1340.358) [-1333.692] (-1337.908) (-1342.719) -- 0:01:55
614500 -- (-1340.355) (-1339.861) (-1347.552) [-1339.185] * (-1339.461) (-1341.696) (-1341.385) [-1343.132] -- 0:01:54
615000 -- [-1334.058] (-1333.025) (-1333.987) (-1339.318) * (-1339.936) [-1337.984] (-1340.305) (-1341.775) -- 0:01:54
Average standard deviation of split frequencies: 0.005903
615500 -- (-1342.571) (-1339.964) (-1337.934) [-1331.942] * (-1338.284) [-1332.815] (-1334.159) (-1340.383) -- 0:01:54
616000 -- [-1339.793] (-1336.859) (-1342.885) (-1336.837) * [-1332.739] (-1347.297) (-1335.892) (-1341.143) -- 0:01:54
616500 -- (-1337.079) [-1338.074] (-1337.806) (-1339.090) * (-1338.808) (-1341.604) (-1335.977) [-1335.377] -- 0:01:53
617000 -- (-1341.036) (-1333.303) (-1334.822) [-1337.772] * (-1347.204) (-1338.977) [-1340.281] (-1332.657) -- 0:01:53
617500 -- [-1340.475] (-1343.911) (-1340.437) (-1338.721) * (-1342.179) (-1332.131) (-1339.755) [-1342.619] -- 0:01:53
618000 -- (-1340.906) (-1338.431) (-1337.429) [-1339.002] * (-1337.766) (-1331.342) (-1335.712) [-1339.631] -- 0:01:53
618500 -- (-1337.785) (-1342.912) [-1335.597] (-1335.475) * (-1342.646) (-1337.681) [-1341.531] (-1341.309) -- 0:01:53
619000 -- (-1334.808) (-1339.457) [-1339.491] (-1339.947) * (-1344.810) [-1335.232] (-1346.174) (-1348.341) -- 0:01:53
619500 -- [-1338.522] (-1341.505) (-1342.065) (-1338.217) * (-1343.249) (-1333.998) (-1341.618) [-1341.441] -- 0:01:53
620000 -- [-1333.829] (-1331.689) (-1342.943) (-1337.101) * [-1334.256] (-1340.965) (-1339.947) (-1343.742) -- 0:01:52
Average standard deviation of split frequencies: 0.006402
620500 -- (-1337.373) [-1333.409] (-1342.175) (-1342.462) * [-1334.950] (-1343.400) (-1336.273) (-1339.316) -- 0:01:52
621000 -- (-1337.567) [-1341.706] (-1343.824) (-1331.618) * (-1339.840) (-1339.201) (-1337.520) [-1339.969] -- 0:01:52
621500 -- (-1334.192) [-1333.417] (-1341.514) (-1342.263) * [-1337.424] (-1347.704) (-1333.210) (-1339.181) -- 0:01:52
622000 -- (-1348.544) (-1340.185) [-1337.349] (-1340.384) * [-1333.421] (-1337.226) (-1335.771) (-1347.232) -- 0:01:52
622500 -- (-1348.316) (-1333.435) [-1339.180] (-1333.041) * (-1335.068) (-1337.426) [-1339.409] (-1346.116) -- 0:01:52
623000 -- (-1352.094) (-1330.883) [-1331.144] (-1337.599) * [-1333.749] (-1337.297) (-1336.288) (-1338.804) -- 0:01:51
623500 -- (-1343.306) (-1331.454) (-1342.877) [-1341.134] * [-1331.897] (-1342.795) (-1342.166) (-1336.620) -- 0:01:51
624000 -- (-1344.487) [-1346.639] (-1340.204) (-1342.140) * (-1341.645) (-1344.273) [-1333.467] (-1345.353) -- 0:01:51
624500 -- (-1341.930) (-1341.019) (-1337.275) [-1340.026] * [-1338.931] (-1338.359) (-1346.069) (-1347.853) -- 0:01:51
625000 -- (-1338.343) (-1340.678) [-1340.561] (-1340.240) * [-1338.637] (-1338.522) (-1341.804) (-1342.725) -- 0:01:51
Average standard deviation of split frequencies: 0.006885
625500 -- [-1334.767] (-1340.548) (-1336.780) (-1349.810) * [-1334.363] (-1337.352) (-1343.295) (-1348.758) -- 0:01:51
626000 -- (-1340.667) (-1346.140) [-1335.272] (-1353.482) * [-1334.944] (-1336.693) (-1336.663) (-1344.277) -- 0:01:51
626500 -- [-1337.231] (-1341.016) (-1340.316) (-1345.803) * (-1336.564) [-1337.878] (-1342.577) (-1344.409) -- 0:01:50
627000 -- (-1334.069) [-1336.768] (-1339.942) (-1342.899) * (-1338.805) (-1356.076) [-1343.644] (-1344.921) -- 0:01:50
627500 -- [-1332.991] (-1343.805) (-1340.730) (-1340.498) * (-1332.102) [-1345.701] (-1348.319) (-1335.474) -- 0:01:50
628000 -- (-1335.703) (-1347.178) [-1337.032] (-1345.894) * [-1341.970] (-1340.918) (-1346.913) (-1337.202) -- 0:01:50
628500 -- [-1337.815] (-1339.959) (-1335.756) (-1335.135) * (-1348.329) [-1338.085] (-1349.553) (-1340.935) -- 0:01:50
629000 -- [-1333.413] (-1345.118) (-1341.104) (-1338.603) * (-1350.261) [-1333.028] (-1338.679) (-1340.352) -- 0:01:50
629500 -- [-1346.310] (-1341.252) (-1339.346) (-1337.542) * [-1336.195] (-1335.510) (-1335.674) (-1343.877) -- 0:01:50
630000 -- (-1346.722) (-1334.507) [-1339.908] (-1342.909) * (-1344.251) (-1336.725) (-1333.025) [-1342.846] -- 0:01:49
Average standard deviation of split frequencies: 0.005873
630500 -- (-1337.821) [-1335.037] (-1342.507) (-1333.356) * [-1338.123] (-1338.796) (-1342.444) (-1336.013) -- 0:01:49
631000 -- (-1345.278) (-1345.156) [-1337.205] (-1335.152) * (-1340.448) (-1339.756) (-1334.475) [-1334.446] -- 0:01:49
631500 -- (-1340.137) (-1341.529) (-1335.912) [-1334.561] * (-1336.571) (-1335.883) [-1342.563] (-1337.736) -- 0:01:49
632000 -- (-1339.808) (-1343.767) [-1333.864] (-1334.322) * (-1334.960) [-1333.661] (-1339.020) (-1333.706) -- 0:01:49
632500 -- (-1335.614) [-1331.490] (-1333.664) (-1338.190) * (-1341.888) (-1340.673) [-1338.106] (-1340.753) -- 0:01:49
633000 -- (-1339.864) (-1338.265) [-1337.463] (-1341.798) * (-1336.950) (-1338.487) [-1334.036] (-1341.307) -- 0:01:48
633500 -- (-1336.574) (-1344.200) (-1337.026) [-1340.302] * (-1340.877) (-1341.089) (-1334.645) [-1335.099] -- 0:01:48
634000 -- (-1341.790) (-1350.195) [-1340.200] (-1338.690) * (-1340.245) [-1337.697] (-1337.680) (-1343.797) -- 0:01:48
634500 -- (-1336.420) (-1339.045) (-1342.397) [-1336.425] * (-1336.212) (-1333.379) (-1338.349) [-1334.778] -- 0:01:48
635000 -- (-1344.293) (-1338.039) [-1335.096] (-1342.961) * (-1335.903) [-1340.874] (-1345.649) (-1336.617) -- 0:01:48
Average standard deviation of split frequencies: 0.004871
635500 -- (-1341.824) (-1341.141) (-1339.633) [-1335.638] * (-1344.210) (-1347.969) (-1334.855) [-1333.364] -- 0:01:48
636000 -- (-1344.066) (-1339.626) [-1338.871] (-1338.702) * (-1345.662) (-1340.976) (-1335.040) [-1333.639] -- 0:01:48
636500 -- (-1338.803) (-1343.546) [-1331.917] (-1331.125) * (-1335.911) (-1337.907) (-1337.632) [-1329.339] -- 0:01:47
637000 -- [-1338.928] (-1338.982) (-1336.920) (-1344.529) * (-1339.607) [-1336.712] (-1340.103) (-1343.522) -- 0:01:47
637500 -- (-1338.859) [-1340.644] (-1341.836) (-1339.081) * (-1340.887) [-1337.780] (-1335.846) (-1336.365) -- 0:01:47
638000 -- [-1333.643] (-1337.518) (-1348.551) (-1341.365) * (-1337.914) (-1341.140) (-1332.501) [-1340.250] -- 0:01:47
638500 -- (-1340.482) (-1342.681) (-1341.928) [-1339.305] * (-1342.001) (-1336.229) (-1338.170) [-1336.873] -- 0:01:47
639000 -- (-1341.681) (-1337.472) (-1341.860) [-1337.892] * (-1343.339) (-1343.483) [-1339.582] (-1339.082) -- 0:01:47
639500 -- [-1340.660] (-1343.553) (-1343.675) (-1337.184) * (-1343.632) (-1336.332) [-1341.348] (-1346.566) -- 0:01:47
640000 -- (-1342.456) (-1336.205) (-1340.860) [-1344.384] * (-1343.005) [-1336.336] (-1337.824) (-1339.420) -- 0:01:46
Average standard deviation of split frequencies: 0.005466
640500 -- [-1333.075] (-1339.728) (-1339.786) (-1339.437) * [-1336.350] (-1332.841) (-1346.388) (-1344.646) -- 0:01:46
641000 -- (-1339.673) (-1343.052) (-1341.708) [-1341.636] * (-1337.311) (-1337.327) (-1341.638) [-1337.210] -- 0:01:46
641500 -- [-1339.522] (-1334.891) (-1336.395) (-1334.863) * (-1345.328) [-1334.816] (-1337.228) (-1335.901) -- 0:01:46
642000 -- (-1333.758) [-1339.129] (-1335.287) (-1335.776) * (-1342.581) [-1340.394] (-1344.383) (-1330.291) -- 0:01:46
642500 -- (-1338.187) (-1346.402) [-1340.519] (-1340.111) * (-1346.216) (-1341.054) (-1332.488) [-1337.334] -- 0:01:46
643000 -- (-1343.705) [-1334.553] (-1337.719) (-1342.061) * (-1337.253) [-1332.235] (-1337.772) (-1344.834) -- 0:01:46
643500 -- (-1336.418) [-1337.267] (-1333.315) (-1354.313) * [-1333.654] (-1337.955) (-1334.897) (-1335.655) -- 0:01:45
644000 -- (-1345.285) [-1334.972] (-1335.195) (-1342.323) * (-1343.484) (-1344.320) [-1340.294] (-1340.788) -- 0:01:45
644500 -- [-1338.141] (-1344.842) (-1338.954) (-1336.363) * (-1337.622) (-1340.867) (-1340.432) [-1335.631] -- 0:01:45
645000 -- (-1341.508) (-1336.434) [-1330.923] (-1349.028) * (-1335.818) (-1332.627) (-1342.554) [-1334.995] -- 0:01:45
Average standard deviation of split frequencies: 0.005838
645500 -- (-1339.716) (-1340.686) [-1333.275] (-1347.873) * (-1338.381) [-1336.819] (-1340.200) (-1334.515) -- 0:01:45
646000 -- (-1337.217) (-1334.431) (-1337.023) [-1340.436] * (-1337.061) (-1331.077) (-1339.731) [-1338.711] -- 0:01:45
646500 -- (-1336.177) (-1338.681) (-1338.685) [-1341.978] * [-1332.234] (-1348.810) (-1341.277) (-1341.077) -- 0:01:44
647000 -- [-1340.721] (-1341.493) (-1341.330) (-1345.337) * (-1333.506) (-1345.779) [-1329.462] (-1335.980) -- 0:01:44
647500 -- [-1332.203] (-1341.058) (-1341.852) (-1335.787) * (-1336.120) (-1344.725) (-1329.201) [-1335.282] -- 0:01:44
648000 -- (-1341.830) [-1337.517] (-1337.677) (-1335.831) * (-1338.031) (-1350.873) [-1332.035] (-1337.106) -- 0:01:44
648500 -- (-1341.246) [-1337.304] (-1341.023) (-1338.393) * (-1340.264) (-1343.023) [-1332.695] (-1340.501) -- 0:01:44
649000 -- (-1338.286) (-1352.460) (-1342.792) [-1336.847] * (-1339.146) (-1341.925) (-1336.138) [-1337.468] -- 0:01:44
649500 -- (-1337.543) [-1344.981] (-1340.850) (-1342.011) * (-1345.064) (-1335.468) [-1340.754] (-1342.890) -- 0:01:44
650000 -- (-1336.453) (-1342.094) (-1338.996) [-1341.845] * (-1352.233) (-1339.967) [-1343.594] (-1338.685) -- 0:01:43
Average standard deviation of split frequencies: 0.007038
650500 -- (-1342.472) (-1342.885) [-1344.067] (-1337.010) * (-1340.557) [-1338.292] (-1336.960) (-1339.193) -- 0:01:43
651000 -- (-1339.682) (-1334.766) (-1342.612) [-1345.734] * (-1338.459) (-1344.357) (-1336.535) [-1336.752] -- 0:01:43
651500 -- (-1339.345) [-1337.070] (-1340.663) (-1347.406) * [-1342.442] (-1343.938) (-1333.874) (-1337.927) -- 0:01:43
652000 -- (-1345.667) (-1336.840) (-1340.527) [-1342.446] * (-1354.306) (-1343.948) (-1338.607) [-1345.001] -- 0:01:43
652500 -- (-1339.131) (-1338.719) [-1333.604] (-1341.627) * (-1349.019) (-1340.054) [-1334.069] (-1340.026) -- 0:01:43
653000 -- (-1340.967) (-1341.966) (-1348.159) [-1339.655] * [-1345.530] (-1336.210) (-1345.484) (-1340.283) -- 0:01:43
653500 -- (-1334.021) (-1338.148) (-1334.866) [-1339.530] * [-1341.272] (-1339.641) (-1344.815) (-1340.576) -- 0:01:42
654000 -- (-1334.474) [-1330.748] (-1339.321) (-1339.789) * (-1345.519) [-1339.573] (-1341.521) (-1334.124) -- 0:01:42
654500 -- (-1339.046) (-1342.318) [-1337.787] (-1334.356) * [-1336.735] (-1342.056) (-1338.665) (-1339.943) -- 0:01:42
655000 -- (-1347.919) (-1331.768) [-1337.332] (-1343.211) * [-1331.809] (-1350.827) (-1336.922) (-1339.086) -- 0:01:42
Average standard deviation of split frequencies: 0.006775
655500 -- [-1336.927] (-1348.308) (-1338.568) (-1339.490) * (-1336.754) (-1338.006) (-1339.086) [-1340.193] -- 0:01:42
656000 -- [-1333.033] (-1344.111) (-1333.613) (-1351.091) * (-1338.921) (-1339.163) [-1338.595] (-1338.406) -- 0:01:42
656500 -- (-1337.210) (-1349.365) (-1338.565) [-1335.563] * [-1335.919] (-1336.565) (-1343.805) (-1341.618) -- 0:01:42
657000 -- (-1339.799) (-1347.622) [-1346.383] (-1332.126) * [-1336.529] (-1338.933) (-1349.265) (-1340.817) -- 0:01:41
657500 -- (-1345.638) (-1342.432) (-1333.367) [-1334.615] * (-1342.023) (-1337.747) [-1342.515] (-1337.011) -- 0:01:41
658000 -- (-1343.361) (-1337.423) (-1341.192) [-1336.888] * [-1341.139] (-1344.275) (-1334.988) (-1335.652) -- 0:01:41
658500 -- (-1347.808) [-1339.914] (-1334.353) (-1341.255) * (-1335.438) (-1338.750) [-1332.058] (-1339.846) -- 0:01:41
659000 -- (-1341.287) [-1334.240] (-1334.307) (-1349.027) * (-1334.544) [-1339.376] (-1335.520) (-1338.763) -- 0:01:41
659500 -- (-1346.310) (-1336.418) [-1334.637] (-1337.398) * (-1340.903) (-1335.922) (-1334.085) [-1347.375] -- 0:01:41
660000 -- [-1337.411] (-1335.266) (-1338.598) (-1340.965) * [-1336.515] (-1335.423) (-1356.525) (-1335.892) -- 0:01:40
Average standard deviation of split frequencies: 0.006829
660500 -- (-1342.146) (-1339.816) [-1337.856] (-1335.935) * (-1336.600) [-1335.517] (-1344.940) (-1337.120) -- 0:01:40
661000 -- (-1346.811) (-1339.209) (-1339.742) [-1333.849] * (-1335.904) [-1336.978] (-1342.199) (-1342.200) -- 0:01:40
661500 -- (-1340.181) (-1346.934) (-1341.172) [-1334.255] * (-1343.188) [-1334.293] (-1337.896) (-1341.775) -- 0:01:40
662000 -- (-1341.913) (-1338.216) [-1338.130] (-1346.237) * (-1345.062) (-1338.469) [-1331.989] (-1334.406) -- 0:01:40
662500 -- [-1332.506] (-1338.614) (-1339.205) (-1344.271) * (-1347.383) (-1340.845) (-1341.181) [-1338.989] -- 0:01:40
663000 -- (-1348.851) (-1340.219) (-1341.228) [-1336.460] * [-1340.227] (-1339.447) (-1343.476) (-1335.357) -- 0:01:40
663500 -- (-1336.242) (-1334.711) (-1333.820) [-1341.062] * (-1335.130) (-1338.418) (-1347.781) [-1335.346] -- 0:01:39
664000 -- (-1342.891) (-1344.575) [-1335.967] (-1345.996) * (-1335.358) (-1337.211) (-1341.208) [-1333.970] -- 0:01:39
664500 -- [-1331.250] (-1333.777) (-1336.889) (-1340.136) * [-1335.570] (-1337.847) (-1345.433) (-1335.429) -- 0:01:39
665000 -- (-1339.108) (-1335.919) (-1342.365) [-1337.742] * (-1344.323) (-1338.484) (-1346.467) [-1332.455] -- 0:01:39
Average standard deviation of split frequencies: 0.006471
665500 -- [-1335.283] (-1343.272) (-1343.658) (-1337.382) * [-1342.624] (-1333.959) (-1345.177) (-1341.731) -- 0:01:39
666000 -- [-1335.328] (-1338.477) (-1337.062) (-1330.029) * (-1342.755) [-1337.972] (-1337.360) (-1344.066) -- 0:01:39
666500 -- (-1343.205) [-1334.530] (-1337.253) (-1334.310) * [-1339.060] (-1336.417) (-1342.878) (-1339.421) -- 0:01:39
667000 -- [-1337.257] (-1337.995) (-1343.903) (-1337.697) * [-1342.285] (-1339.733) (-1336.182) (-1339.173) -- 0:01:38
667500 -- (-1333.286) (-1339.387) (-1346.509) [-1331.718] * [-1337.399] (-1348.384) (-1332.238) (-1340.818) -- 0:01:38
668000 -- (-1336.066) (-1338.722) (-1340.282) [-1334.228] * (-1339.451) [-1339.715] (-1334.267) (-1339.879) -- 0:01:38
668500 -- (-1337.359) [-1344.145] (-1334.797) (-1347.745) * (-1332.121) [-1335.114] (-1331.064) (-1342.961) -- 0:01:38
669000 -- (-1338.415) (-1334.669) [-1342.326] (-1340.678) * (-1337.440) (-1344.051) [-1333.843] (-1338.147) -- 0:01:37
669500 -- [-1334.308] (-1335.292) (-1342.945) (-1335.143) * (-1334.155) (-1341.858) (-1333.825) [-1335.882] -- 0:01:38
670000 -- [-1343.232] (-1346.726) (-1336.772) (-1336.197) * (-1340.178) (-1345.152) [-1339.620] (-1348.904) -- 0:01:38
Average standard deviation of split frequencies: 0.006025
670500 -- (-1346.505) (-1331.033) [-1342.043] (-1334.289) * (-1336.147) (-1343.095) (-1342.679) [-1335.291] -- 0:01:37
671000 -- (-1337.479) (-1340.485) [-1335.584] (-1341.965) * [-1337.355] (-1343.823) (-1343.369) (-1335.472) -- 0:01:37
671500 -- [-1335.844] (-1343.115) (-1348.940) (-1344.560) * (-1337.376) (-1340.756) [-1344.436] (-1343.147) -- 0:01:37
672000 -- (-1338.226) (-1338.520) (-1342.653) [-1334.315] * [-1339.752] (-1341.743) (-1342.542) (-1350.659) -- 0:01:37
672500 -- [-1336.464] (-1340.464) (-1339.470) (-1335.462) * [-1335.483] (-1338.890) (-1334.235) (-1339.735) -- 0:01:36
673000 -- (-1340.424) [-1341.154] (-1337.136) (-1332.739) * (-1340.023) (-1336.378) (-1334.756) [-1339.139] -- 0:01:37
673500 -- (-1339.295) (-1348.490) (-1345.500) [-1339.772] * (-1336.338) (-1336.488) (-1339.337) [-1334.402] -- 0:01:36
674000 -- (-1341.266) (-1347.614) [-1343.449] (-1336.870) * (-1336.754) (-1335.961) [-1332.725] (-1333.645) -- 0:01:36
674500 -- (-1342.618) (-1346.653) [-1337.164] (-1341.434) * (-1343.481) (-1332.921) [-1338.300] (-1340.643) -- 0:01:36
675000 -- (-1342.641) (-1337.696) [-1343.353] (-1338.744) * (-1338.916) [-1337.959] (-1343.055) (-1339.709) -- 0:01:36
Average standard deviation of split frequencies: 0.006675
675500 -- (-1344.306) [-1339.894] (-1345.527) (-1340.895) * (-1336.052) (-1343.361) [-1336.643] (-1341.776) -- 0:01:36
676000 -- (-1333.056) (-1336.773) (-1344.869) [-1341.172] * (-1337.697) [-1342.040] (-1336.144) (-1339.416) -- 0:01:35
676500 -- (-1342.134) (-1345.737) [-1333.756] (-1340.254) * (-1334.296) [-1346.282] (-1339.245) (-1343.044) -- 0:01:36
677000 -- (-1341.337) (-1339.038) (-1346.448) [-1334.257] * (-1333.777) (-1339.229) [-1337.815] (-1343.021) -- 0:01:35
677500 -- [-1337.887] (-1334.871) (-1341.082) (-1339.213) * (-1343.485) (-1351.086) [-1331.531] (-1349.333) -- 0:01:35
678000 -- (-1343.078) (-1341.883) [-1339.397] (-1345.938) * (-1342.390) (-1342.751) [-1333.206] (-1349.426) -- 0:01:35
678500 -- (-1333.166) [-1337.591] (-1342.125) (-1337.799) * (-1343.542) [-1340.929] (-1337.778) (-1341.557) -- 0:01:35
679000 -- (-1340.764) [-1340.602] (-1335.677) (-1339.758) * (-1343.582) [-1335.891] (-1334.275) (-1335.625) -- 0:01:35
679500 -- (-1342.665) (-1341.911) (-1340.545) [-1335.712] * (-1344.511) [-1335.780] (-1338.362) (-1338.443) -- 0:01:34
680000 -- (-1336.737) [-1333.780] (-1335.893) (-1340.744) * (-1340.986) (-1341.254) [-1341.422] (-1336.444) -- 0:01:35
Average standard deviation of split frequencies: 0.006035
680500 -- (-1336.572) (-1340.282) [-1332.329] (-1336.952) * (-1334.395) (-1343.997) (-1340.565) [-1338.964] -- 0:01:34
681000 -- (-1342.131) (-1344.265) (-1336.508) [-1336.962] * (-1349.053) (-1333.930) (-1338.909) [-1337.582] -- 0:01:34
681500 -- (-1341.519) [-1338.254] (-1333.352) (-1344.297) * (-1339.587) [-1335.567] (-1338.194) (-1339.220) -- 0:01:34
682000 -- (-1332.551) [-1339.772] (-1338.730) (-1343.171) * (-1346.740) [-1337.807] (-1346.347) (-1337.496) -- 0:01:34
682500 -- (-1345.007) (-1342.712) (-1338.243) [-1347.728] * (-1335.326) (-1339.393) [-1339.266] (-1339.734) -- 0:01:33
683000 -- (-1342.683) (-1342.155) [-1331.675] (-1351.930) * (-1343.649) (-1345.323) (-1336.496) [-1336.423] -- 0:01:33
683500 -- [-1344.632] (-1345.490) (-1340.258) (-1341.101) * (-1345.294) (-1344.241) (-1336.980) [-1341.299] -- 0:01:34
684000 -- (-1349.344) (-1341.560) [-1342.375] (-1336.559) * (-1334.933) [-1337.351] (-1334.530) (-1345.420) -- 0:01:33
684500 -- (-1337.027) [-1343.716] (-1341.847) (-1341.211) * [-1345.749] (-1331.110) (-1338.476) (-1333.865) -- 0:01:33
685000 -- (-1346.312) (-1339.871) (-1341.366) [-1334.038] * [-1337.844] (-1334.083) (-1335.467) (-1333.142) -- 0:01:33
Average standard deviation of split frequencies: 0.005596
685500 -- (-1341.404) (-1339.350) (-1335.665) [-1341.277] * (-1336.197) (-1331.861) (-1331.679) [-1337.489] -- 0:01:33
686000 -- (-1336.686) (-1340.154) (-1338.651) [-1335.368] * (-1339.592) (-1338.874) [-1335.819] (-1340.763) -- 0:01:32
686500 -- [-1341.935] (-1342.481) (-1343.780) (-1335.862) * [-1333.658] (-1334.253) (-1335.712) (-1341.522) -- 0:01:32
687000 -- (-1333.648) (-1336.139) [-1340.453] (-1348.995) * (-1333.890) [-1346.574] (-1340.878) (-1334.864) -- 0:01:32
687500 -- (-1340.717) [-1337.428] (-1339.756) (-1334.720) * (-1343.140) (-1333.485) (-1341.417) [-1338.811] -- 0:01:32
688000 -- (-1338.770) (-1339.148) (-1339.265) [-1333.316] * (-1336.284) (-1335.311) [-1337.717] (-1334.808) -- 0:01:32
688500 -- (-1337.440) (-1341.181) [-1336.282] (-1336.365) * (-1337.935) [-1337.609] (-1343.358) (-1342.575) -- 0:01:32
689000 -- (-1334.157) (-1339.727) [-1337.028] (-1338.784) * (-1335.424) (-1340.152) [-1334.976] (-1334.300) -- 0:01:32
689500 -- (-1335.105) (-1345.010) [-1332.531] (-1339.047) * (-1339.994) (-1350.593) (-1335.763) [-1338.589] -- 0:01:31
690000 -- (-1341.477) (-1335.688) (-1337.181) [-1335.282] * (-1341.346) (-1348.017) [-1330.279] (-1335.824) -- 0:01:31
Average standard deviation of split frequencies: 0.005850
690500 -- (-1339.702) [-1336.224] (-1335.048) (-1339.624) * (-1340.445) (-1344.686) (-1341.684) [-1345.955] -- 0:01:31
691000 -- (-1340.992) [-1329.979] (-1334.531) (-1345.712) * (-1338.637) [-1335.846] (-1339.972) (-1341.553) -- 0:01:31
691500 -- [-1339.224] (-1340.790) (-1340.028) (-1341.188) * (-1341.201) (-1335.221) [-1337.352] (-1338.300) -- 0:01:31
692000 -- (-1333.789) [-1338.970] (-1339.417) (-1339.291) * (-1339.864) (-1338.786) (-1343.706) [-1333.367] -- 0:01:31
692500 -- (-1333.700) (-1345.402) [-1339.805] (-1334.986) * (-1338.807) (-1337.437) (-1344.292) [-1334.309] -- 0:01:31
693000 -- [-1340.430] (-1336.920) (-1339.423) (-1341.340) * [-1343.326] (-1335.144) (-1340.443) (-1340.742) -- 0:01:30
693500 -- (-1347.064) [-1340.800] (-1333.402) (-1332.855) * [-1333.084] (-1340.129) (-1345.487) (-1343.751) -- 0:01:30
694000 -- [-1338.788] (-1336.817) (-1342.480) (-1336.261) * (-1344.082) [-1336.201] (-1336.689) (-1341.948) -- 0:01:30
694500 -- (-1339.448) (-1337.776) (-1334.565) [-1337.583] * (-1337.359) (-1343.025) [-1334.459] (-1333.494) -- 0:01:30
695000 -- (-1335.416) (-1331.718) [-1339.329] (-1339.636) * [-1336.527] (-1340.242) (-1344.361) (-1342.507) -- 0:01:30
Average standard deviation of split frequencies: 0.004838
695500 -- (-1343.513) (-1334.883) (-1342.362) [-1340.617] * (-1348.703) [-1342.476] (-1335.868) (-1344.365) -- 0:01:30
696000 -- (-1346.417) [-1339.795] (-1340.908) (-1343.824) * (-1336.967) (-1347.526) [-1337.766] (-1352.437) -- 0:01:29
696500 -- (-1338.942) (-1339.254) (-1342.399) [-1342.595] * (-1339.162) (-1343.908) (-1342.973) [-1334.936] -- 0:01:29
697000 -- [-1336.471] (-1341.503) (-1339.684) (-1344.171) * (-1343.085) [-1340.656] (-1336.973) (-1340.502) -- 0:01:29
697500 -- [-1338.710] (-1336.759) (-1335.194) (-1351.193) * (-1346.956) [-1339.145] (-1341.481) (-1341.535) -- 0:01:29
698000 -- [-1339.987] (-1336.417) (-1333.015) (-1339.894) * [-1335.603] (-1346.588) (-1342.710) (-1339.728) -- 0:01:29
698500 -- (-1335.554) [-1335.809] (-1338.222) (-1340.505) * [-1337.153] (-1341.980) (-1337.553) (-1344.426) -- 0:01:29
699000 -- [-1340.449] (-1346.520) (-1336.167) (-1336.512) * [-1330.692] (-1344.412) (-1339.992) (-1338.681) -- 0:01:29
699500 -- (-1345.285) (-1336.782) (-1340.657) [-1339.154] * (-1339.338) (-1344.410) [-1337.023] (-1352.459) -- 0:01:28
700000 -- (-1342.510) (-1337.362) (-1341.953) [-1335.561] * (-1337.740) (-1337.886) [-1334.767] (-1342.288) -- 0:01:28
Average standard deviation of split frequencies: 0.004613
700500 -- [-1344.505] (-1333.598) (-1337.445) (-1348.578) * [-1333.067] (-1338.992) (-1336.310) (-1340.064) -- 0:01:28
701000 -- (-1337.236) (-1337.957) (-1342.855) [-1331.540] * (-1335.280) (-1341.952) [-1340.237] (-1340.668) -- 0:01:28
701500 -- (-1340.830) (-1342.591) (-1336.604) [-1339.393] * (-1342.235) [-1330.261] (-1344.644) (-1342.962) -- 0:01:28
702000 -- (-1337.473) (-1343.963) [-1343.907] (-1340.553) * (-1337.914) (-1338.328) (-1339.640) [-1333.954] -- 0:01:28
702500 -- [-1340.759] (-1343.177) (-1341.651) (-1336.132) * (-1343.371) (-1338.754) (-1343.845) [-1344.793] -- 0:01:28
703000 -- (-1335.800) [-1337.283] (-1341.473) (-1339.390) * [-1341.501] (-1335.853) (-1349.764) (-1343.692) -- 0:01:27
703500 -- (-1334.557) (-1339.547) (-1345.899) [-1338.481] * (-1332.730) [-1340.661] (-1331.544) (-1342.040) -- 0:01:27
704000 -- [-1335.670] (-1340.755) (-1348.759) (-1351.167) * (-1345.472) (-1336.626) [-1336.673] (-1342.431) -- 0:01:27
704500 -- [-1339.298] (-1337.465) (-1337.352) (-1346.214) * (-1344.915) [-1337.952] (-1343.078) (-1339.011) -- 0:01:27
705000 -- (-1338.524) (-1340.798) (-1335.655) [-1349.380] * (-1343.247) (-1335.451) [-1334.249] (-1339.463) -- 0:01:27
Average standard deviation of split frequencies: 0.004197
705500 -- (-1336.340) [-1336.494] (-1347.296) (-1342.553) * [-1340.480] (-1343.668) (-1338.790) (-1336.420) -- 0:01:27
706000 -- (-1338.744) [-1335.733] (-1345.947) (-1345.620) * (-1343.657) [-1332.914] (-1340.309) (-1339.406) -- 0:01:27
706500 -- [-1332.731] (-1343.032) (-1343.994) (-1337.588) * (-1342.654) [-1334.845] (-1332.401) (-1342.370) -- 0:01:26
707000 -- (-1341.443) (-1341.424) (-1335.518) [-1337.449] * (-1335.933) (-1338.573) [-1335.871] (-1344.222) -- 0:01:26
707500 -- [-1341.588] (-1336.326) (-1340.764) (-1347.586) * [-1337.297] (-1344.800) (-1334.671) (-1341.453) -- 0:01:26
708000 -- (-1333.576) [-1337.725] (-1339.834) (-1338.702) * (-1346.954) (-1337.734) [-1334.793] (-1339.111) -- 0:01:26
708500 -- [-1341.595] (-1335.485) (-1345.967) (-1350.375) * (-1344.457) (-1341.886) [-1336.700] (-1337.112) -- 0:01:26
709000 -- (-1345.328) (-1349.956) (-1341.874) [-1334.594] * (-1343.331) (-1346.358) (-1336.883) [-1337.452] -- 0:01:26
709500 -- (-1337.264) [-1341.518] (-1336.719) (-1333.797) * [-1340.235] (-1347.115) (-1332.837) (-1336.850) -- 0:01:25
710000 -- (-1338.259) (-1337.137) (-1335.428) [-1337.904] * (-1337.629) (-1348.210) (-1334.587) [-1335.360] -- 0:01:25
Average standard deviation of split frequencies: 0.004359
710500 -- (-1337.554) (-1343.287) (-1335.366) [-1333.629] * (-1350.031) (-1339.604) [-1334.611] (-1334.164) -- 0:01:25
711000 -- (-1340.184) (-1337.816) (-1335.940) [-1337.254] * (-1345.298) (-1338.479) [-1338.111] (-1335.494) -- 0:01:25
711500 -- (-1338.348) (-1339.351) [-1341.847] (-1333.604) * (-1338.693) (-1337.254) [-1337.745] (-1338.966) -- 0:01:25
712000 -- (-1335.496) [-1340.615] (-1341.967) (-1336.501) * (-1335.356) (-1340.243) (-1337.284) [-1336.062] -- 0:01:25
712500 -- (-1341.147) (-1335.584) (-1334.657) [-1333.536] * (-1344.391) (-1344.441) [-1333.375] (-1344.170) -- 0:01:25
713000 -- (-1338.014) (-1346.890) (-1337.079) [-1338.188] * (-1346.572) [-1334.756] (-1336.969) (-1353.324) -- 0:01:24
713500 -- (-1338.833) [-1333.464] (-1336.213) (-1338.634) * (-1337.785) (-1334.357) [-1336.250] (-1344.634) -- 0:01:24
714000 -- (-1335.443) (-1348.444) [-1338.742] (-1346.589) * (-1334.239) (-1340.778) [-1338.422] (-1342.677) -- 0:01:24
714500 -- [-1333.782] (-1339.054) (-1334.673) (-1338.620) * (-1345.720) (-1339.519) (-1346.051) [-1341.431] -- 0:01:24
715000 -- (-1334.169) [-1336.195] (-1336.296) (-1335.419) * (-1343.319) (-1342.499) [-1342.390] (-1343.514) -- 0:01:24
Average standard deviation of split frequencies: 0.004609
715500 -- (-1341.642) (-1336.239) [-1337.730] (-1336.634) * [-1336.503] (-1336.890) (-1340.067) (-1346.070) -- 0:01:24
716000 -- (-1341.921) (-1343.477) [-1340.598] (-1340.237) * (-1340.179) (-1341.569) [-1341.727] (-1339.026) -- 0:01:24
716500 -- (-1339.804) (-1343.335) [-1339.754] (-1338.300) * (-1336.406) (-1348.539) (-1334.827) [-1336.086] -- 0:01:23
717000 -- [-1340.493] (-1343.081) (-1339.823) (-1338.472) * (-1339.250) (-1346.659) [-1334.424] (-1341.229) -- 0:01:23
717500 -- (-1341.984) (-1341.885) (-1337.826) [-1338.576] * (-1342.320) (-1345.355) [-1333.484] (-1337.568) -- 0:01:23
718000 -- [-1336.686] (-1350.315) (-1333.085) (-1339.497) * (-1333.923) (-1335.474) (-1336.486) [-1341.658] -- 0:01:23
718500 -- (-1338.064) (-1338.665) [-1331.466] (-1340.639) * (-1340.286) (-1339.515) [-1335.065] (-1347.691) -- 0:01:23
719000 -- (-1341.943) [-1336.190] (-1336.071) (-1335.779) * (-1336.535) [-1334.157] (-1335.493) (-1344.068) -- 0:01:23
719500 -- (-1340.090) [-1333.530] (-1335.147) (-1341.888) * (-1335.833) [-1339.277] (-1334.486) (-1337.123) -- 0:01:23
720000 -- (-1337.638) (-1348.524) [-1336.572] (-1333.720) * (-1335.318) (-1341.897) [-1340.258] (-1336.757) -- 0:01:22
Average standard deviation of split frequencies: 0.005420
720500 -- (-1335.581) (-1349.286) [-1333.153] (-1338.858) * [-1338.838] (-1337.808) (-1340.961) (-1341.251) -- 0:01:22
721000 -- (-1342.353) (-1337.628) (-1340.039) [-1336.029] * [-1335.486] (-1331.957) (-1338.890) (-1335.956) -- 0:01:22
721500 -- (-1347.439) (-1334.151) [-1339.859] (-1339.473) * (-1333.885) [-1331.846] (-1336.456) (-1336.886) -- 0:01:22
722000 -- (-1335.964) (-1340.977) [-1336.540] (-1337.614) * (-1340.115) [-1333.377] (-1337.012) (-1333.375) -- 0:01:22
722500 -- (-1338.998) (-1340.916) [-1331.987] (-1336.111) * [-1337.417] (-1333.882) (-1341.639) (-1336.018) -- 0:01:22
723000 -- (-1342.830) (-1334.438) [-1347.708] (-1334.625) * (-1335.704) (-1336.877) [-1340.727] (-1342.319) -- 0:01:21
723500 -- (-1347.944) (-1340.914) [-1340.784] (-1347.917) * (-1347.810) (-1345.639) [-1339.492] (-1350.421) -- 0:01:21
724000 -- (-1349.702) (-1340.401) (-1338.005) [-1338.030] * (-1339.688) [-1343.600] (-1341.180) (-1346.320) -- 0:01:21
724500 -- (-1336.880) (-1343.628) (-1336.137) [-1333.087] * (-1344.309) (-1340.887) [-1342.809] (-1348.907) -- 0:01:21
725000 -- [-1332.219] (-1340.479) (-1341.358) (-1331.286) * (-1346.647) (-1340.365) [-1345.130] (-1341.372) -- 0:01:21
Average standard deviation of split frequencies: 0.004916
725500 -- [-1339.114] (-1342.827) (-1343.146) (-1338.896) * (-1343.458) [-1336.691] (-1338.140) (-1340.628) -- 0:01:21
726000 -- (-1332.871) [-1337.750] (-1340.546) (-1332.158) * [-1335.596] (-1337.138) (-1337.955) (-1346.575) -- 0:01:21
726500 -- [-1336.271] (-1338.321) (-1340.969) (-1345.994) * (-1333.270) (-1336.615) (-1340.438) [-1338.926] -- 0:01:20
727000 -- (-1346.439) (-1345.100) (-1336.944) [-1335.809] * (-1338.984) (-1339.132) (-1342.583) [-1345.424] -- 0:01:20
727500 -- (-1341.562) [-1333.018] (-1344.644) (-1343.935) * [-1337.324] (-1340.471) (-1335.612) (-1340.497) -- 0:01:20
728000 -- (-1347.230) (-1335.532) [-1336.997] (-1336.462) * (-1333.739) [-1338.798] (-1342.964) (-1347.090) -- 0:01:20
728500 -- (-1336.625) [-1337.611] (-1338.253) (-1341.642) * (-1338.044) (-1348.404) [-1335.027] (-1341.817) -- 0:01:20
729000 -- (-1338.602) (-1341.936) (-1335.973) [-1342.463] * (-1353.045) (-1340.929) [-1336.660] (-1339.724) -- 0:01:20
729500 -- (-1339.017) [-1338.129] (-1343.551) (-1355.823) * (-1335.291) (-1342.877) (-1332.803) [-1340.516] -- 0:01:20
730000 -- [-1334.904] (-1333.754) (-1345.867) (-1336.954) * (-1331.538) (-1341.649) [-1335.282] (-1342.362) -- 0:01:19
Average standard deviation of split frequencies: 0.004516
730500 -- (-1337.551) (-1337.152) [-1334.999] (-1334.504) * (-1345.259) (-1337.928) (-1346.729) [-1341.825] -- 0:01:19
731000 -- (-1351.747) (-1340.525) [-1332.266] (-1341.284) * (-1338.753) (-1343.619) [-1336.694] (-1342.443) -- 0:01:19
731500 -- (-1354.786) (-1345.508) [-1336.797] (-1338.393) * (-1337.841) [-1337.728] (-1337.946) (-1339.140) -- 0:01:19
732000 -- (-1341.533) (-1337.178) [-1338.719] (-1335.631) * (-1342.638) [-1338.142] (-1339.841) (-1340.813) -- 0:01:19
732500 -- (-1346.287) (-1336.890) [-1334.851] (-1340.524) * [-1337.089] (-1336.581) (-1336.915) (-1337.977) -- 0:01:19
733000 -- (-1342.382) (-1342.039) [-1337.894] (-1346.169) * (-1339.748) [-1336.932] (-1336.890) (-1340.637) -- 0:01:19
733500 -- [-1338.264] (-1340.062) (-1340.033) (-1344.662) * (-1338.165) [-1338.928] (-1335.175) (-1349.530) -- 0:01:18
734000 -- (-1338.942) (-1339.886) (-1330.937) [-1332.697] * [-1331.403] (-1335.066) (-1333.637) (-1342.225) -- 0:01:18
734500 -- (-1338.213) [-1342.116] (-1344.781) (-1334.815) * (-1337.019) [-1338.137] (-1342.081) (-1351.071) -- 0:01:18
735000 -- (-1337.355) (-1353.972) [-1338.679] (-1339.539) * (-1333.663) [-1338.479] (-1332.918) (-1350.910) -- 0:01:18
Average standard deviation of split frequencies: 0.003934
735500 -- (-1342.559) (-1352.866) (-1332.044) [-1333.812] * [-1338.096] (-1331.274) (-1338.613) (-1335.664) -- 0:01:18
736000 -- [-1335.056] (-1344.082) (-1336.503) (-1338.944) * (-1343.310) (-1340.663) [-1334.433] (-1338.874) -- 0:01:18
736500 -- (-1340.908) (-1347.933) [-1340.427] (-1342.683) * (-1341.240) (-1338.245) (-1341.183) [-1337.643] -- 0:01:17
737000 -- [-1340.212] (-1347.990) (-1335.096) (-1347.092) * (-1340.279) (-1338.931) (-1343.305) [-1333.113] -- 0:01:17
737500 -- [-1335.294] (-1336.140) (-1333.953) (-1341.962) * [-1337.714] (-1337.132) (-1339.855) (-1334.616) -- 0:01:17
738000 -- (-1344.414) (-1337.424) (-1338.090) [-1333.988] * (-1336.027) [-1334.900] (-1342.889) (-1342.141) -- 0:01:17
738500 -- [-1340.648] (-1337.242) (-1341.788) (-1333.462) * (-1340.092) (-1345.458) [-1336.249] (-1337.541) -- 0:01:17
739000 -- [-1337.423] (-1336.537) (-1345.849) (-1337.816) * (-1330.527) [-1346.429] (-1339.831) (-1345.337) -- 0:01:17
739500 -- (-1339.492) (-1346.145) (-1343.485) [-1339.111] * [-1336.279] (-1343.372) (-1337.083) (-1347.151) -- 0:01:17
740000 -- (-1348.907) (-1341.304) (-1334.139) [-1336.437] * (-1340.097) (-1339.533) (-1339.932) [-1342.147] -- 0:01:16
Average standard deviation of split frequencies: 0.004001
740500 -- [-1337.797] (-1335.889) (-1340.837) (-1332.804) * [-1332.143] (-1340.854) (-1342.751) (-1335.593) -- 0:01:16
741000 -- (-1337.924) (-1339.649) [-1339.148] (-1346.823) * (-1337.860) (-1342.950) (-1338.701) [-1337.008] -- 0:01:16
741500 -- (-1343.812) [-1338.859] (-1335.639) (-1344.404) * (-1337.038) (-1332.668) (-1335.737) [-1337.996] -- 0:01:16
742000 -- (-1340.509) (-1334.566) [-1342.056] (-1341.826) * [-1336.030] (-1337.700) (-1342.096) (-1337.561) -- 0:01:16
742500 -- (-1337.473) (-1336.346) [-1334.317] (-1343.544) * (-1338.476) (-1337.107) (-1345.857) [-1338.758] -- 0:01:16
743000 -- (-1333.245) [-1336.033] (-1339.519) (-1340.077) * [-1333.305] (-1338.260) (-1347.224) (-1345.754) -- 0:01:16
743500 -- [-1339.926] (-1333.168) (-1348.701) (-1335.154) * (-1338.240) [-1336.629] (-1349.224) (-1340.380) -- 0:01:15
744000 -- (-1334.609) (-1340.469) (-1336.192) [-1340.010] * [-1338.281] (-1334.462) (-1335.953) (-1345.328) -- 0:01:15
744500 -- (-1340.177) (-1344.272) (-1338.187) [-1347.114] * [-1337.513] (-1345.725) (-1342.731) (-1338.720) -- 0:01:15
745000 -- (-1335.716) (-1335.533) [-1338.385] (-1338.730) * (-1335.817) [-1340.562] (-1338.329) (-1342.266) -- 0:01:15
Average standard deviation of split frequencies: 0.003701
745500 -- (-1342.886) (-1340.386) [-1333.502] (-1341.862) * (-1338.510) (-1339.886) [-1337.935] (-1331.787) -- 0:01:15
746000 -- (-1339.803) [-1335.158] (-1344.724) (-1344.209) * (-1338.206) [-1335.070] (-1338.497) (-1336.067) -- 0:01:15
746500 -- [-1337.806] (-1343.929) (-1341.486) (-1344.852) * (-1337.131) [-1342.650] (-1333.294) (-1344.231) -- 0:01:15
747000 -- [-1341.341] (-1332.007) (-1344.493) (-1348.833) * [-1340.921] (-1340.870) (-1337.045) (-1339.473) -- 0:01:14
747500 -- (-1340.228) (-1348.161) [-1340.384] (-1344.150) * (-1335.490) (-1338.436) [-1334.644] (-1342.489) -- 0:01:14
748000 -- [-1339.892] (-1341.835) (-1339.206) (-1340.502) * (-1343.925) [-1341.757] (-1338.937) (-1341.575) -- 0:01:14
748500 -- (-1339.028) (-1336.081) (-1340.493) [-1337.887] * (-1338.161) (-1337.194) (-1338.149) [-1333.456] -- 0:01:14
749000 -- (-1340.777) (-1337.310) [-1332.506] (-1337.706) * (-1342.790) [-1334.069] (-1352.359) (-1335.568) -- 0:01:14
749500 -- (-1339.947) (-1334.426) [-1332.778] (-1338.285) * [-1338.411] (-1332.581) (-1343.721) (-1338.503) -- 0:01:14
750000 -- [-1347.008] (-1338.684) (-1343.594) (-1348.272) * (-1348.838) (-1338.404) [-1336.998] (-1342.397) -- 0:01:14
Average standard deviation of split frequencies: 0.003499
750500 -- (-1350.508) [-1344.157] (-1344.334) (-1341.232) * (-1335.449) (-1349.934) (-1339.423) [-1332.671] -- 0:01:13
751000 -- [-1337.097] (-1336.205) (-1337.103) (-1342.274) * [-1342.025] (-1343.227) (-1336.991) (-1336.988) -- 0:01:13
751500 -- (-1339.250) [-1332.021] (-1340.806) (-1338.736) * (-1340.005) (-1333.808) [-1337.337] (-1348.104) -- 0:01:13
752000 -- (-1340.980) [-1339.362] (-1345.903) (-1330.234) * (-1340.656) [-1337.472] (-1346.639) (-1347.850) -- 0:01:13
752500 -- (-1341.812) [-1337.344] (-1334.873) (-1337.477) * [-1335.032] (-1339.403) (-1336.388) (-1340.216) -- 0:01:13
753000 -- (-1341.484) (-1341.495) [-1332.950] (-1341.442) * (-1350.734) (-1336.507) [-1334.567] (-1339.906) -- 0:01:13
753500 -- (-1341.846) (-1348.381) [-1338.497] (-1352.127) * (-1343.429) (-1336.863) [-1338.247] (-1340.081) -- 0:01:12
754000 -- (-1338.389) (-1333.394) (-1340.041) [-1338.605] * (-1342.827) [-1338.075] (-1339.176) (-1347.274) -- 0:01:12
754500 -- [-1334.201] (-1344.472) (-1338.773) (-1347.075) * (-1336.843) (-1337.561) [-1337.354] (-1338.938) -- 0:01:12
755000 -- (-1337.248) [-1334.310] (-1338.716) (-1342.590) * (-1341.169) [-1336.659] (-1334.342) (-1335.503) -- 0:01:12
Average standard deviation of split frequencies: 0.003118
755500 -- (-1347.599) (-1339.050) [-1336.855] (-1334.490) * [-1342.309] (-1336.819) (-1345.978) (-1340.484) -- 0:01:12
756000 -- (-1343.682) [-1338.170] (-1338.933) (-1342.080) * (-1340.936) [-1335.176] (-1333.096) (-1350.693) -- 0:01:11
756500 -- (-1345.154) (-1344.885) [-1334.260] (-1335.045) * [-1334.899] (-1337.844) (-1338.692) (-1335.536) -- 0:01:12
757000 -- [-1338.103] (-1352.206) (-1349.628) (-1339.534) * (-1337.947) (-1344.292) [-1336.845] (-1338.814) -- 0:01:11
757500 -- (-1342.318) (-1351.168) (-1340.126) [-1334.138] * (-1338.825) (-1341.221) [-1339.817] (-1341.244) -- 0:01:11
758000 -- [-1339.792] (-1345.046) (-1339.014) (-1339.130) * (-1335.941) (-1341.962) (-1337.941) [-1335.139] -- 0:01:11
758500 -- [-1346.123] (-1347.299) (-1333.131) (-1348.631) * (-1338.934) (-1352.175) (-1333.917) [-1339.041] -- 0:01:11
759000 -- [-1334.367] (-1347.043) (-1339.241) (-1334.448) * (-1343.440) (-1340.524) [-1332.524] (-1342.796) -- 0:01:11
759500 -- (-1335.828) [-1339.750] (-1339.731) (-1344.498) * (-1331.665) (-1337.454) [-1335.710] (-1335.995) -- 0:01:10
760000 -- (-1338.252) [-1342.327] (-1344.165) (-1335.864) * (-1334.804) (-1337.794) (-1337.040) [-1341.939] -- 0:01:11
Average standard deviation of split frequencies: 0.003718
760500 -- (-1347.128) [-1334.350] (-1336.569) (-1338.166) * [-1340.886] (-1345.047) (-1338.723) (-1339.511) -- 0:01:10
761000 -- [-1339.764] (-1346.243) (-1337.437) (-1334.742) * (-1350.854) [-1337.255] (-1347.950) (-1340.524) -- 0:01:10
761500 -- (-1338.204) (-1342.696) [-1337.791] (-1342.655) * (-1341.249) (-1345.242) [-1338.268] (-1357.906) -- 0:01:10
762000 -- (-1340.506) (-1337.120) [-1343.813] (-1344.468) * (-1341.740) (-1340.180) (-1339.145) [-1340.647] -- 0:01:10
762500 -- (-1334.886) [-1338.836] (-1340.644) (-1341.006) * (-1338.262) (-1343.892) (-1337.179) [-1339.122] -- 0:01:10
763000 -- [-1335.893] (-1348.084) (-1337.781) (-1340.455) * (-1344.456) (-1343.098) [-1336.156] (-1334.573) -- 0:01:09
763500 -- (-1335.643) [-1338.017] (-1345.558) (-1340.043) * (-1341.551) (-1338.904) [-1336.559] (-1341.413) -- 0:01:10
764000 -- [-1339.005] (-1338.850) (-1347.580) (-1339.773) * (-1339.429) (-1345.514) (-1339.608) [-1337.628] -- 0:01:09
764500 -- (-1341.330) [-1342.162] (-1346.233) (-1338.070) * (-1339.939) (-1336.843) (-1339.403) [-1336.927] -- 0:01:09
765000 -- [-1334.758] (-1348.111) (-1337.595) (-1337.747) * (-1336.719) [-1335.839] (-1341.388) (-1344.924) -- 0:01:09
Average standard deviation of split frequencies: 0.003341
765500 -- (-1349.583) (-1341.404) [-1340.301] (-1338.627) * (-1335.922) (-1344.254) [-1338.189] (-1346.349) -- 0:01:09
766000 -- [-1336.022] (-1342.751) (-1345.972) (-1335.780) * [-1334.680] (-1337.812) (-1336.563) (-1341.630) -- 0:01:09
766500 -- (-1337.194) (-1341.791) (-1341.403) [-1345.332] * (-1342.842) [-1340.331] (-1337.768) (-1341.348) -- 0:01:08
767000 -- (-1339.052) (-1336.286) (-1351.329) [-1335.935] * (-1352.371) [-1344.455] (-1344.785) (-1337.109) -- 0:01:08
767500 -- (-1341.293) [-1338.311] (-1346.699) (-1346.052) * (-1349.844) (-1331.405) [-1341.409] (-1335.472) -- 0:01:08
768000 -- (-1339.587) (-1336.115) (-1340.076) [-1340.909] * (-1337.704) [-1331.656] (-1338.931) (-1348.622) -- 0:01:08
768500 -- [-1339.018] (-1336.528) (-1338.178) (-1342.745) * [-1340.466] (-1339.513) (-1338.483) (-1334.032) -- 0:01:08
769000 -- (-1336.558) [-1337.521] (-1337.815) (-1343.632) * (-1343.594) (-1341.500) [-1349.070] (-1341.832) -- 0:01:08
769500 -- [-1333.858] (-1331.153) (-1348.257) (-1341.394) * (-1332.653) (-1342.803) [-1336.933] (-1340.390) -- 0:01:07
770000 -- [-1339.480] (-1345.353) (-1338.014) (-1338.142) * (-1347.437) [-1342.185] (-1339.031) (-1341.589) -- 0:01:07
Average standard deviation of split frequencies: 0.004107
770500 -- [-1336.840] (-1339.518) (-1342.532) (-1342.283) * (-1340.004) [-1338.264] (-1335.781) (-1335.659) -- 0:01:07
771000 -- [-1337.613] (-1335.210) (-1334.777) (-1337.104) * (-1341.130) (-1346.150) [-1337.088] (-1340.909) -- 0:01:07
771500 -- (-1341.869) (-1349.145) [-1343.137] (-1332.847) * [-1331.650] (-1346.567) (-1337.508) (-1342.606) -- 0:01:07
772000 -- (-1344.700) (-1334.329) (-1334.461) [-1330.607] * (-1337.479) (-1344.125) (-1334.498) [-1336.564] -- 0:01:07
772500 -- (-1347.580) (-1336.653) [-1332.802] (-1331.628) * (-1341.372) (-1332.115) [-1336.123] (-1334.869) -- 0:01:07
773000 -- [-1340.670] (-1338.690) (-1341.088) (-1335.567) * (-1334.096) [-1335.778] (-1341.651) (-1341.392) -- 0:01:06
773500 -- [-1335.012] (-1343.315) (-1341.257) (-1344.863) * (-1340.656) [-1343.366] (-1342.960) (-1335.924) -- 0:01:06
774000 -- (-1336.338) (-1340.419) [-1336.014] (-1342.351) * [-1338.375] (-1342.753) (-1340.622) (-1340.805) -- 0:01:06
774500 -- (-1339.179) [-1340.146] (-1334.861) (-1343.587) * (-1347.197) (-1342.116) (-1340.115) [-1336.495] -- 0:01:06
775000 -- (-1339.067) (-1333.438) [-1335.110] (-1342.186) * (-1337.777) (-1345.604) [-1333.210] (-1339.255) -- 0:01:06
Average standard deviation of split frequencies: 0.003992
775500 -- [-1334.260] (-1336.880) (-1346.297) (-1338.414) * (-1344.542) (-1343.672) (-1342.741) [-1336.845] -- 0:01:06
776000 -- (-1338.022) (-1346.537) [-1336.968] (-1335.491) * (-1341.933) (-1343.207) [-1335.312] (-1341.483) -- 0:01:06
776500 -- (-1344.163) (-1338.141) [-1336.983] (-1343.523) * (-1345.586) (-1332.413) [-1335.050] (-1341.591) -- 0:01:05
777000 -- (-1350.095) (-1341.267) (-1340.011) [-1336.801] * (-1345.318) [-1334.093] (-1340.709) (-1343.066) -- 0:01:05
777500 -- (-1342.118) (-1334.963) (-1337.226) [-1337.168] * (-1342.787) [-1331.695] (-1341.350) (-1340.395) -- 0:01:05
778000 -- (-1339.026) (-1337.698) (-1334.108) [-1341.460] * (-1346.673) [-1337.122] (-1337.679) (-1343.681) -- 0:01:05
778500 -- (-1356.703) (-1339.591) [-1334.531] (-1337.672) * (-1340.055) [-1333.941] (-1336.756) (-1343.883) -- 0:01:05
779000 -- (-1342.902) (-1346.789) [-1334.859] (-1337.747) * (-1345.028) [-1334.830] (-1337.319) (-1337.339) -- 0:01:05
779500 -- (-1337.102) (-1334.080) (-1338.079) [-1335.295] * [-1340.416] (-1336.875) (-1338.126) (-1344.104) -- 0:01:05
780000 -- (-1345.927) (-1342.086) (-1341.444) [-1345.546] * (-1339.102) (-1338.107) (-1338.684) [-1338.237] -- 0:01:04
Average standard deviation of split frequencies: 0.003796
780500 -- (-1343.867) (-1335.363) (-1335.282) [-1342.963] * [-1333.398] (-1341.846) (-1339.185) (-1338.560) -- 0:01:04
781000 -- (-1355.078) [-1340.358] (-1348.237) (-1343.949) * (-1340.817) (-1336.514) (-1339.663) [-1337.480] -- 0:01:04
781500 -- (-1340.596) (-1341.119) (-1351.673) [-1337.312] * (-1336.977) (-1340.101) (-1330.881) [-1343.567] -- 0:01:04
782000 -- (-1343.623) [-1335.105] (-1341.234) (-1336.192) * (-1339.222) (-1347.266) (-1337.633) [-1336.184] -- 0:01:04
782500 -- [-1339.425] (-1334.406) (-1356.706) (-1342.803) * (-1341.823) [-1344.860] (-1331.635) (-1341.479) -- 0:01:04
783000 -- (-1340.519) [-1339.764] (-1336.203) (-1339.057) * [-1333.992] (-1339.283) (-1335.386) (-1337.478) -- 0:01:04
783500 -- [-1333.829] (-1348.683) (-1340.335) (-1344.609) * (-1337.538) (-1342.943) (-1344.652) [-1334.111] -- 0:01:03
784000 -- (-1341.936) (-1342.681) (-1337.934) [-1338.432] * (-1338.349) [-1338.839] (-1342.573) (-1346.585) -- 0:01:03
784500 -- (-1330.463) [-1339.637] (-1341.757) (-1337.353) * [-1334.999] (-1332.226) (-1335.782) (-1333.717) -- 0:01:03
785000 -- (-1341.139) [-1338.233] (-1337.616) (-1336.150) * (-1342.647) (-1346.178) [-1342.825] (-1334.591) -- 0:01:03
Average standard deviation of split frequencies: 0.003599
785500 -- (-1341.687) [-1342.911] (-1339.057) (-1338.643) * (-1346.554) [-1341.037] (-1337.668) (-1341.966) -- 0:01:03
786000 -- (-1335.749) (-1347.987) [-1340.506] (-1346.296) * (-1336.911) (-1343.207) [-1335.845] (-1339.193) -- 0:01:03
786500 -- (-1332.262) (-1342.879) (-1337.218) [-1334.664] * (-1333.617) (-1337.782) (-1334.498) [-1338.772] -- 0:01:02
787000 -- (-1351.387) (-1345.275) [-1335.516] (-1334.324) * (-1340.497) (-1339.324) (-1339.357) [-1338.983] -- 0:01:02
787500 -- [-1340.658] (-1341.285) (-1345.716) (-1345.816) * [-1341.364] (-1342.122) (-1339.059) (-1343.961) -- 0:01:02
788000 -- (-1341.192) [-1342.302] (-1337.376) (-1339.862) * [-1333.596] (-1340.303) (-1341.722) (-1341.087) -- 0:01:02
788500 -- (-1331.410) (-1344.980) (-1335.268) [-1345.046] * (-1337.065) (-1342.427) [-1330.824] (-1339.279) -- 0:01:02
789000 -- (-1339.778) (-1347.598) [-1336.859] (-1344.164) * (-1333.610) (-1343.483) [-1335.409] (-1338.839) -- 0:01:02
789500 -- (-1340.725) (-1339.332) (-1338.735) [-1336.555] * [-1334.754] (-1347.965) (-1341.287) (-1341.195) -- 0:01:02
790000 -- (-1344.002) [-1334.674] (-1341.725) (-1348.293) * (-1332.681) (-1337.118) [-1337.536] (-1349.740) -- 0:01:01
Average standard deviation of split frequencies: 0.003748
790500 -- (-1336.014) (-1340.134) [-1344.301] (-1340.517) * (-1338.632) [-1336.429] (-1343.510) (-1351.579) -- 0:01:01
791000 -- (-1337.476) (-1340.677) [-1334.484] (-1335.018) * [-1339.187] (-1347.228) (-1338.242) (-1340.404) -- 0:01:01
791500 -- (-1345.054) [-1346.189] (-1339.357) (-1348.035) * (-1338.680) [-1340.155] (-1341.544) (-1337.391) -- 0:01:01
792000 -- (-1333.494) (-1341.476) (-1341.750) [-1343.465] * (-1345.374) [-1337.762] (-1337.465) (-1342.867) -- 0:01:01
792500 -- [-1337.784] (-1338.271) (-1352.766) (-1337.629) * [-1339.121] (-1345.086) (-1343.242) (-1334.875) -- 0:01:01
793000 -- (-1339.039) [-1336.898] (-1334.900) (-1342.851) * (-1339.186) [-1335.999] (-1342.315) (-1337.964) -- 0:01:01
793500 -- (-1338.531) (-1336.357) [-1332.373] (-1337.837) * (-1335.754) (-1336.560) (-1342.832) [-1333.756] -- 0:01:00
794000 -- (-1342.878) (-1336.454) (-1338.416) [-1340.342] * (-1335.976) [-1335.282] (-1338.189) (-1337.700) -- 0:01:00
794500 -- (-1345.918) [-1340.650] (-1339.963) (-1339.732) * (-1337.990) (-1335.851) [-1334.747] (-1340.011) -- 0:01:00
795000 -- (-1339.659) [-1339.124] (-1337.515) (-1338.716) * (-1338.834) [-1334.211] (-1341.761) (-1340.017) -- 0:01:00
Average standard deviation of split frequencies: 0.003638
795500 -- (-1338.746) (-1339.351) [-1341.933] (-1341.842) * [-1334.751] (-1343.403) (-1341.753) (-1338.818) -- 0:01:00
796000 -- (-1342.965) (-1334.386) [-1339.479] (-1337.001) * (-1336.155) (-1335.538) (-1339.189) [-1335.239] -- 0:01:00
796500 -- (-1344.198) (-1334.574) (-1339.573) [-1336.699] * (-1337.878) (-1353.497) [-1334.927] (-1337.991) -- 0:01:00
797000 -- (-1341.746) (-1340.797) [-1336.952] (-1339.424) * (-1344.714) [-1336.759] (-1337.548) (-1341.339) -- 0:00:59
797500 -- [-1340.880] (-1334.579) (-1334.977) (-1336.106) * [-1332.169] (-1338.306) (-1343.485) (-1338.956) -- 0:00:59
798000 -- (-1342.583) (-1337.053) (-1339.371) [-1333.799] * (-1334.781) [-1335.172] (-1341.713) (-1335.544) -- 0:00:59
798500 -- (-1335.126) (-1336.962) (-1335.278) [-1334.976] * (-1340.430) (-1340.839) (-1338.800) [-1342.429] -- 0:00:59
799000 -- (-1334.300) (-1339.656) [-1345.365] (-1339.969) * [-1335.321] (-1341.803) (-1334.988) (-1339.080) -- 0:00:59
799500 -- (-1339.495) (-1345.727) [-1336.029] (-1345.991) * [-1338.805] (-1346.518) (-1341.026) (-1340.423) -- 0:00:59
800000 -- (-1343.514) (-1346.203) [-1330.413] (-1344.525) * [-1338.238] (-1339.146) (-1338.632) (-1338.338) -- 0:00:59
Average standard deviation of split frequencies: 0.003280
800500 -- [-1346.103] (-1345.107) (-1335.130) (-1340.092) * (-1341.755) (-1334.699) [-1338.156] (-1339.792) -- 0:00:58
801000 -- (-1340.050) (-1333.914) [-1335.351] (-1340.919) * (-1343.618) (-1336.185) [-1335.349] (-1331.123) -- 0:00:58
801500 -- (-1341.151) [-1337.186] (-1341.527) (-1343.157) * (-1339.337) (-1339.397) [-1341.557] (-1334.264) -- 0:00:58
802000 -- (-1340.309) [-1330.688] (-1334.641) (-1342.282) * (-1337.570) [-1336.740] (-1338.585) (-1335.097) -- 0:00:58
802500 -- (-1337.115) [-1329.642] (-1337.924) (-1341.926) * (-1346.528) (-1335.492) (-1337.039) [-1337.004] -- 0:00:58
803000 -- (-1347.608) (-1342.382) [-1341.425] (-1345.624) * (-1337.229) (-1336.467) [-1334.564] (-1350.052) -- 0:00:58
803500 -- [-1329.800] (-1331.810) (-1336.022) (-1337.341) * (-1343.739) (-1344.319) [-1334.590] (-1351.136) -- 0:00:57
804000 -- (-1350.815) (-1331.769) [-1338.944] (-1342.029) * (-1343.246) (-1336.438) (-1338.978) [-1335.617] -- 0:00:57
804500 -- [-1340.087] (-1333.832) (-1348.397) (-1341.597) * (-1341.803) (-1340.068) (-1339.050) [-1336.795] -- 0:00:57
805000 -- (-1337.536) (-1343.114) [-1335.276] (-1337.929) * [-1336.563] (-1330.960) (-1337.541) (-1343.637) -- 0:00:57
Average standard deviation of split frequencies: 0.003175
805500 -- [-1342.105] (-1341.434) (-1337.847) (-1345.457) * (-1331.826) (-1334.012) [-1338.518] (-1340.576) -- 0:00:57
806000 -- [-1338.730] (-1335.767) (-1337.024) (-1336.105) * [-1331.232] (-1342.476) (-1343.012) (-1337.799) -- 0:00:57
806500 -- (-1346.173) [-1336.985] (-1339.035) (-1337.759) * (-1348.120) (-1343.017) (-1343.260) [-1342.781] -- 0:00:57
807000 -- (-1338.284) (-1334.745) (-1339.121) [-1337.197] * (-1341.446) (-1343.931) [-1342.370] (-1338.875) -- 0:00:56
807500 -- (-1344.307) (-1342.558) [-1342.590] (-1345.280) * (-1342.822) [-1339.222] (-1339.271) (-1334.311) -- 0:00:56
808000 -- (-1345.853) (-1349.363) (-1337.761) [-1333.802] * (-1346.862) (-1331.928) (-1337.705) [-1337.057] -- 0:00:56
808500 -- [-1340.129] (-1337.724) (-1342.910) (-1332.261) * (-1343.694) [-1339.423] (-1335.933) (-1343.249) -- 0:00:56
809000 -- (-1349.024) (-1343.765) (-1334.575) [-1335.414] * (-1351.319) (-1344.497) (-1342.878) [-1334.172] -- 0:00:56
809500 -- (-1335.578) (-1350.511) [-1336.449] (-1346.410) * (-1336.959) [-1337.350] (-1339.760) (-1340.170) -- 0:00:56
810000 -- (-1338.231) (-1342.142) [-1333.665] (-1350.152) * [-1336.237] (-1340.290) (-1337.259) (-1352.308) -- 0:00:56
Average standard deviation of split frequencies: 0.003323
810500 -- (-1340.523) (-1338.771) (-1337.939) [-1333.510] * [-1339.419] (-1341.718) (-1336.957) (-1341.162) -- 0:00:55
811000 -- (-1336.743) [-1337.176] (-1340.028) (-1346.070) * [-1336.825] (-1344.309) (-1340.261) (-1340.882) -- 0:00:55
811500 -- (-1334.390) (-1341.147) [-1333.583] (-1342.860) * (-1336.072) [-1338.304] (-1341.495) (-1341.234) -- 0:00:55
812000 -- (-1339.099) (-1339.816) [-1332.091] (-1334.318) * (-1338.033) (-1341.819) (-1342.013) [-1336.499] -- 0:00:55
812500 -- (-1344.264) [-1333.514] (-1338.748) (-1342.630) * (-1341.931) (-1345.083) (-1340.207) [-1339.762] -- 0:00:55
813000 -- (-1331.867) [-1339.796] (-1337.354) (-1339.563) * (-1338.376) (-1334.516) [-1343.488] (-1338.634) -- 0:00:55
813500 -- [-1337.538] (-1337.611) (-1338.047) (-1337.564) * (-1342.554) (-1334.670) [-1341.414] (-1337.654) -- 0:00:55
814000 -- [-1339.855] (-1334.973) (-1341.497) (-1346.117) * (-1340.475) (-1341.305) (-1338.518) [-1338.244] -- 0:00:54
814500 -- [-1340.660] (-1340.494) (-1336.870) (-1344.537) * (-1340.768) (-1348.732) (-1339.015) [-1342.429] -- 0:00:54
815000 -- (-1338.576) [-1341.289] (-1342.844) (-1338.020) * (-1342.161) (-1347.537) [-1337.506] (-1340.228) -- 0:00:54
Average standard deviation of split frequencies: 0.003219
815500 -- (-1344.915) (-1339.526) (-1344.641) [-1339.267] * (-1345.244) (-1337.318) (-1344.039) [-1335.111] -- 0:00:54
816000 -- (-1335.729) (-1354.668) [-1337.934] (-1338.326) * [-1335.102] (-1344.861) (-1343.109) (-1341.894) -- 0:00:54
816500 -- (-1339.465) (-1344.692) (-1334.065) [-1337.448] * (-1336.437) (-1337.567) [-1336.046] (-1347.878) -- 0:00:54
817000 -- [-1334.125] (-1339.521) (-1337.636) (-1339.567) * (-1339.135) (-1355.641) [-1340.488] (-1350.023) -- 0:00:53
817500 -- (-1336.735) [-1334.069] (-1331.056) (-1344.513) * (-1333.218) (-1336.640) [-1337.161] (-1338.965) -- 0:00:53
818000 -- (-1342.054) (-1330.954) (-1335.355) [-1335.029] * (-1336.654) (-1341.161) [-1338.117] (-1340.809) -- 0:00:53
818500 -- (-1345.470) (-1335.630) [-1339.532] (-1334.575) * (-1333.668) (-1338.443) [-1336.093] (-1339.989) -- 0:00:53
819000 -- (-1339.507) (-1340.205) (-1334.832) [-1334.427] * (-1332.000) (-1341.442) [-1340.401] (-1342.255) -- 0:00:53
819500 -- (-1347.529) (-1337.969) [-1336.589] (-1336.389) * [-1343.565] (-1338.965) (-1339.375) (-1340.131) -- 0:00:53
820000 -- [-1342.661] (-1340.116) (-1340.257) (-1331.137) * [-1342.772] (-1339.646) (-1343.148) (-1334.151) -- 0:00:53
Average standard deviation of split frequencies: 0.003857
820500 -- (-1345.750) (-1336.330) [-1339.800] (-1343.327) * (-1345.892) [-1336.151] (-1340.892) (-1345.915) -- 0:00:52
821000 -- (-1334.988) (-1338.848) (-1329.484) [-1335.851] * (-1346.972) (-1344.173) (-1334.514) [-1332.495] -- 0:00:52
821500 -- (-1337.641) (-1346.941) (-1347.771) [-1336.182] * (-1338.973) (-1334.855) [-1336.737] (-1335.778) -- 0:00:52
822000 -- (-1338.094) (-1341.155) [-1339.236] (-1343.430) * (-1341.124) (-1338.268) [-1333.056] (-1344.516) -- 0:00:52
822500 -- [-1339.715] (-1335.998) (-1339.827) (-1343.582) * [-1342.248] (-1335.139) (-1343.283) (-1338.875) -- 0:00:52
823000 -- [-1333.354] (-1334.071) (-1343.188) (-1347.680) * (-1347.613) (-1335.882) [-1337.804] (-1350.711) -- 0:00:52
823500 -- [-1335.865] (-1337.306) (-1337.734) (-1341.800) * (-1336.634) (-1333.701) [-1334.671] (-1334.190) -- 0:00:52
824000 -- [-1333.566] (-1334.887) (-1344.833) (-1339.694) * (-1344.535) [-1341.181] (-1338.444) (-1337.972) -- 0:00:51
824500 -- (-1336.083) (-1340.529) (-1345.049) [-1342.882] * [-1335.897] (-1333.177) (-1346.501) (-1338.267) -- 0:00:51
825000 -- (-1337.754) [-1331.309] (-1349.956) (-1336.930) * [-1341.154] (-1337.422) (-1343.776) (-1344.915) -- 0:00:51
Average standard deviation of split frequencies: 0.003261
825500 -- (-1340.356) [-1332.616] (-1343.304) (-1342.902) * (-1341.911) [-1335.347] (-1337.087) (-1340.062) -- 0:00:51
826000 -- (-1339.425) [-1337.140] (-1340.379) (-1336.763) * (-1347.759) (-1339.517) [-1344.248] (-1335.797) -- 0:00:51
826500 -- (-1338.657) (-1337.578) [-1338.593] (-1338.482) * (-1354.801) [-1332.817] (-1342.273) (-1342.045) -- 0:00:51
827000 -- (-1335.509) (-1341.037) (-1337.419) [-1337.387] * (-1343.266) [-1336.360] (-1342.568) (-1342.557) -- 0:00:51
827500 -- (-1342.945) (-1338.108) [-1340.268] (-1342.077) * (-1344.506) (-1351.886) [-1333.565] (-1337.236) -- 0:00:50
828000 -- (-1337.686) (-1336.067) (-1334.737) [-1341.260] * (-1339.113) (-1348.036) [-1338.251] (-1339.733) -- 0:00:50
828500 -- [-1338.799] (-1339.170) (-1340.118) (-1340.389) * (-1339.951) (-1336.014) (-1340.021) [-1339.519] -- 0:00:50
829000 -- (-1349.381) [-1339.423] (-1339.159) (-1336.611) * [-1336.347] (-1341.444) (-1343.813) (-1341.791) -- 0:00:50
829500 -- [-1336.029] (-1340.361) (-1343.636) (-1336.725) * (-1346.837) (-1341.867) [-1339.269] (-1336.213) -- 0:00:50
830000 -- (-1341.598) (-1343.192) (-1332.591) [-1338.126] * (-1345.509) (-1335.146) (-1342.772) [-1342.235] -- 0:00:50
Average standard deviation of split frequencies: 0.002838
830500 -- (-1341.491) (-1343.828) (-1341.283) [-1341.209] * (-1344.422) (-1339.351) (-1338.679) [-1333.292] -- 0:00:50
831000 -- (-1339.292) (-1335.270) [-1343.119] (-1339.406) * (-1337.963) (-1336.466) [-1333.623] (-1342.264) -- 0:00:49
831500 -- (-1341.966) (-1338.998) [-1339.962] (-1339.447) * (-1342.149) (-1351.787) [-1334.943] (-1336.760) -- 0:00:49
832000 -- (-1341.976) (-1334.745) (-1340.335) [-1333.169] * (-1335.950) (-1338.714) [-1343.484] (-1345.320) -- 0:00:49
832500 -- [-1340.208] (-1337.703) (-1339.430) (-1335.935) * (-1340.823) (-1343.570) [-1337.660] (-1338.779) -- 0:00:49
833000 -- (-1338.164) (-1337.993) (-1344.867) [-1335.927] * [-1337.495] (-1340.092) (-1341.612) (-1342.092) -- 0:00:49
833500 -- (-1339.704) [-1331.562] (-1337.040) (-1346.945) * (-1338.564) (-1347.701) [-1336.837] (-1338.039) -- 0:00:49
834000 -- (-1344.971) (-1335.849) (-1335.272) [-1335.390] * (-1336.920) (-1336.297) [-1332.869] (-1338.763) -- 0:00:48
834500 -- [-1335.129] (-1343.240) (-1339.405) (-1344.364) * [-1336.006] (-1349.169) (-1333.951) (-1335.177) -- 0:00:48
835000 -- (-1342.116) [-1336.076] (-1340.701) (-1348.360) * (-1338.578) [-1336.287] (-1341.258) (-1344.336) -- 0:00:48
Average standard deviation of split frequencies: 0.002497
835500 -- (-1341.296) [-1340.539] (-1344.336) (-1339.167) * (-1340.234) (-1334.708) (-1337.535) [-1334.564] -- 0:00:48
836000 -- (-1340.767) [-1338.895] (-1339.049) (-1348.787) * (-1335.953) [-1333.390] (-1334.204) (-1339.092) -- 0:00:48
836500 -- (-1345.798) (-1333.687) [-1338.369] (-1342.022) * (-1339.912) (-1344.339) [-1335.565] (-1341.057) -- 0:00:48
837000 -- (-1337.433) [-1332.205] (-1340.175) (-1335.731) * (-1338.542) (-1341.058) [-1331.581] (-1333.557) -- 0:00:48
837500 -- (-1345.906) [-1342.185] (-1344.118) (-1341.414) * [-1336.835] (-1343.417) (-1338.251) (-1341.785) -- 0:00:47
838000 -- (-1338.912) (-1339.565) (-1338.797) [-1339.801] * (-1337.857) [-1333.615] (-1337.296) (-1339.775) -- 0:00:47
838500 -- (-1332.969) (-1342.399) [-1336.239] (-1345.541) * (-1337.154) [-1335.590] (-1335.061) (-1339.427) -- 0:00:47
839000 -- (-1340.439) (-1339.233) (-1337.217) [-1340.198] * (-1334.981) (-1348.473) (-1337.372) [-1338.648] -- 0:00:47
839500 -- (-1342.553) (-1340.733) (-1347.313) [-1336.837] * (-1337.184) [-1334.788] (-1346.658) (-1342.019) -- 0:00:47
840000 -- (-1342.622) (-1338.303) (-1336.708) [-1341.880] * (-1341.366) (-1342.916) [-1334.533] (-1349.358) -- 0:00:47
Average standard deviation of split frequencies: 0.003044
840500 -- (-1336.958) (-1334.444) [-1339.599] (-1334.497) * (-1341.667) (-1335.854) (-1340.473) [-1335.575] -- 0:00:47
841000 -- (-1332.735) [-1336.280] (-1339.843) (-1332.298) * [-1343.310] (-1339.115) (-1337.487) (-1337.086) -- 0:00:46
841500 -- (-1341.172) [-1338.687] (-1346.504) (-1339.205) * (-1336.762) (-1355.739) (-1341.885) [-1341.811] -- 0:00:46
842000 -- [-1338.711] (-1342.463) (-1335.940) (-1341.266) * (-1331.191) (-1337.266) (-1335.404) [-1339.082] -- 0:00:46
842500 -- [-1341.550] (-1340.131) (-1352.673) (-1335.126) * (-1339.640) (-1334.936) [-1340.398] (-1344.703) -- 0:00:46
843000 -- (-1344.781) [-1335.753] (-1346.189) (-1338.327) * (-1348.253) [-1342.043] (-1337.428) (-1348.607) -- 0:00:46
843500 -- (-1340.109) (-1341.962) [-1337.034] (-1335.357) * (-1343.237) (-1344.694) (-1336.023) [-1341.768] -- 0:00:46
844000 -- [-1337.060] (-1344.157) (-1342.675) (-1341.598) * [-1338.267] (-1343.601) (-1342.922) (-1342.170) -- 0:00:46
844500 -- (-1337.871) [-1335.909] (-1350.038) (-1335.002) * (-1336.817) [-1336.283] (-1338.099) (-1337.637) -- 0:00:45
845000 -- (-1339.631) (-1336.957) [-1340.035] (-1333.499) * (-1342.334) (-1335.855) [-1342.135] (-1341.761) -- 0:00:45
Average standard deviation of split frequencies: 0.002547
845500 -- [-1347.119] (-1334.358) (-1340.769) (-1343.059) * (-1343.820) (-1345.283) (-1339.096) [-1340.301] -- 0:00:45
846000 -- (-1334.952) [-1336.239] (-1334.079) (-1341.240) * [-1337.181] (-1336.029) (-1335.208) (-1332.506) -- 0:00:45
846500 -- (-1335.331) [-1343.478] (-1341.262) (-1341.855) * (-1335.616) [-1337.339] (-1339.452) (-1336.013) -- 0:00:45
847000 -- [-1335.754] (-1343.836) (-1337.765) (-1338.081) * (-1336.288) (-1333.237) (-1343.394) [-1341.456] -- 0:00:45
847500 -- (-1337.963) [-1338.194] (-1339.475) (-1337.611) * (-1338.078) (-1341.348) (-1348.121) [-1335.432] -- 0:00:44
848000 -- (-1334.333) (-1338.582) [-1339.257] (-1332.872) * (-1341.794) [-1337.175] (-1339.347) (-1339.060) -- 0:00:44
848500 -- (-1336.542) [-1335.183] (-1339.004) (-1336.433) * (-1342.642) (-1334.501) (-1333.751) [-1337.588] -- 0:00:44
849000 -- (-1339.121) [-1347.622] (-1335.570) (-1339.269) * (-1333.546) (-1345.071) [-1333.194] (-1343.551) -- 0:00:44
849500 -- [-1332.424] (-1345.536) (-1342.266) (-1338.864) * [-1336.212] (-1336.207) (-1344.453) (-1345.924) -- 0:00:44
850000 -- (-1340.565) (-1341.680) (-1341.365) [-1335.314] * [-1335.903] (-1341.800) (-1335.292) (-1346.100) -- 0:00:44
Average standard deviation of split frequencies: 0.002771
850500 -- (-1340.946) [-1340.807] (-1333.969) (-1340.007) * (-1340.865) (-1336.604) [-1335.931] (-1342.681) -- 0:00:44
851000 -- (-1340.802) (-1340.673) [-1333.057] (-1340.168) * [-1339.423] (-1338.411) (-1336.829) (-1340.565) -- 0:00:43
851500 -- (-1343.066) (-1343.204) [-1334.482] (-1340.106) * [-1338.550] (-1342.513) (-1337.450) (-1343.060) -- 0:00:43
852000 -- [-1335.625] (-1350.122) (-1335.399) (-1336.197) * (-1342.548) [-1338.647] (-1341.735) (-1335.746) -- 0:00:43
852500 -- [-1334.862] (-1343.866) (-1344.923) (-1336.850) * (-1340.229) (-1342.283) (-1333.213) [-1340.366] -- 0:00:43
853000 -- (-1339.382) [-1349.292] (-1335.289) (-1339.398) * (-1345.320) (-1346.224) (-1340.073) [-1341.245] -- 0:00:43
853500 -- (-1332.337) (-1340.791) [-1336.962] (-1338.557) * (-1339.852) (-1339.256) (-1336.404) [-1335.769] -- 0:00:43
854000 -- (-1352.447) (-1338.888) (-1340.019) [-1340.618] * (-1337.476) [-1337.376] (-1337.210) (-1338.094) -- 0:00:43
854500 -- [-1343.289] (-1341.094) (-1338.942) (-1340.357) * [-1342.891] (-1339.801) (-1336.177) (-1337.130) -- 0:00:42
855000 -- (-1339.422) [-1336.932] (-1333.889) (-1336.283) * (-1341.188) (-1337.087) [-1337.373] (-1331.663) -- 0:00:42
Average standard deviation of split frequencies: 0.002675
855500 -- (-1337.231) [-1335.607] (-1343.968) (-1340.173) * (-1341.050) (-1336.613) [-1338.165] (-1338.547) -- 0:00:42
856000 -- (-1336.636) (-1348.878) (-1346.767) [-1336.498] * (-1339.365) [-1340.639] (-1341.427) (-1337.598) -- 0:00:42
856500 -- [-1344.936] (-1339.896) (-1345.039) (-1346.140) * (-1340.275) (-1332.827) (-1335.644) [-1336.222] -- 0:00:42
857000 -- (-1342.138) (-1333.011) (-1337.567) [-1335.397] * (-1341.391) (-1339.102) (-1338.014) [-1336.945] -- 0:00:42
857500 -- (-1341.671) (-1339.423) [-1334.463] (-1340.776) * [-1334.381] (-1336.253) (-1346.750) (-1342.489) -- 0:00:42
858000 -- (-1338.314) [-1341.339] (-1347.344) (-1340.028) * [-1335.736] (-1334.173) (-1341.259) (-1334.257) -- 0:00:41
858500 -- (-1346.039) (-1337.635) [-1336.020] (-1342.486) * (-1337.282) [-1329.806] (-1336.836) (-1336.130) -- 0:00:41
859000 -- (-1334.774) [-1335.457] (-1341.700) (-1336.057) * (-1338.215) [-1335.380] (-1343.740) (-1338.533) -- 0:00:41
859500 -- (-1345.137) (-1333.768) [-1339.815] (-1339.168) * (-1340.334) (-1335.928) [-1335.558] (-1339.011) -- 0:00:41
860000 -- (-1338.721) (-1333.567) [-1340.367] (-1338.135) * (-1335.053) (-1337.913) [-1339.152] (-1340.139) -- 0:00:41
Average standard deviation of split frequencies: 0.002660
860500 -- (-1340.411) (-1337.311) [-1334.965] (-1340.650) * [-1330.056] (-1338.102) (-1335.692) (-1334.768) -- 0:00:41
861000 -- [-1341.597] (-1336.660) (-1339.783) (-1343.112) * [-1335.903] (-1336.061) (-1340.747) (-1340.869) -- 0:00:41
861500 -- [-1341.084] (-1335.942) (-1338.419) (-1331.103) * [-1334.416] (-1338.435) (-1339.538) (-1345.163) -- 0:00:40
862000 -- (-1338.188) (-1340.405) (-1338.917) [-1331.676] * (-1336.682) [-1334.921] (-1337.248) (-1343.999) -- 0:00:40
862500 -- (-1348.119) [-1334.629] (-1336.190) (-1343.133) * (-1338.126) (-1334.058) (-1339.312) [-1336.708] -- 0:00:40
863000 -- (-1343.590) (-1339.526) [-1338.068] (-1339.805) * (-1347.066) [-1347.432] (-1338.432) (-1340.763) -- 0:00:40
863500 -- (-1344.274) [-1339.158] (-1336.832) (-1341.834) * [-1334.263] (-1340.478) (-1339.828) (-1344.528) -- 0:00:40
864000 -- (-1344.731) (-1340.261) [-1346.792] (-1333.040) * (-1336.160) [-1341.096] (-1342.129) (-1345.583) -- 0:00:40
864500 -- (-1342.610) (-1348.119) (-1344.280) [-1341.310] * (-1344.113) (-1336.958) [-1338.555] (-1342.974) -- 0:00:39
865000 -- (-1333.749) [-1338.373] (-1342.369) (-1349.172) * (-1355.527) (-1344.829) (-1339.440) [-1337.287] -- 0:00:39
Average standard deviation of split frequencies: 0.002877
865500 -- (-1332.283) (-1332.912) [-1337.716] (-1348.655) * [-1345.191] (-1332.793) (-1348.510) (-1341.743) -- 0:00:39
866000 -- [-1333.889] (-1335.434) (-1336.097) (-1340.500) * (-1342.976) [-1338.108] (-1342.030) (-1341.348) -- 0:00:39
866500 -- (-1336.136) [-1336.567] (-1352.323) (-1344.062) * (-1334.038) (-1334.617) (-1342.022) [-1336.224] -- 0:00:39
867000 -- (-1335.812) (-1334.011) [-1334.322] (-1342.186) * (-1337.999) [-1339.648] (-1339.100) (-1340.036) -- 0:00:39
867500 -- (-1343.654) (-1337.362) [-1336.470] (-1346.339) * (-1334.948) (-1338.614) (-1340.104) [-1338.797] -- 0:00:39
868000 -- [-1333.062] (-1343.040) (-1335.586) (-1344.961) * (-1340.038) (-1335.038) [-1342.737] (-1337.756) -- 0:00:38
868500 -- (-1335.539) (-1340.163) [-1337.936] (-1342.876) * [-1334.872] (-1338.148) (-1334.785) (-1342.720) -- 0:00:38
869000 -- (-1338.040) (-1334.698) (-1336.470) [-1333.727] * [-1337.621] (-1333.029) (-1345.423) (-1349.655) -- 0:00:38
869500 -- (-1340.972) (-1338.703) [-1337.467] (-1337.399) * [-1335.627] (-1340.692) (-1336.109) (-1342.457) -- 0:00:38
870000 -- (-1340.394) (-1338.092) [-1331.074] (-1342.436) * [-1335.198] (-1336.761) (-1339.586) (-1336.958) -- 0:00:38
Average standard deviation of split frequencies: 0.002320
870500 -- (-1336.019) [-1335.018] (-1337.607) (-1343.837) * (-1341.832) (-1338.996) (-1335.781) [-1337.381] -- 0:00:38
871000 -- (-1338.241) [-1337.444] (-1348.106) (-1347.281) * (-1344.941) (-1339.662) (-1337.219) [-1333.782] -- 0:00:38
871500 -- (-1345.166) (-1338.685) [-1340.861] (-1337.631) * [-1333.791] (-1340.770) (-1338.690) (-1335.542) -- 0:00:37
872000 -- (-1335.317) [-1336.009] (-1342.695) (-1331.220) * [-1332.711] (-1342.621) (-1343.136) (-1339.473) -- 0:00:37
872500 -- [-1340.930] (-1341.083) (-1338.371) (-1342.638) * (-1335.512) (-1348.109) (-1344.796) [-1335.882] -- 0:00:37
873000 -- (-1344.152) (-1331.850) (-1335.360) [-1335.256] * (-1339.349) (-1339.782) (-1336.505) [-1336.161] -- 0:00:37
873500 -- (-1344.089) (-1341.185) [-1333.259] (-1336.545) * (-1354.404) [-1348.056] (-1345.569) (-1333.111) -- 0:00:37
874000 -- (-1342.993) (-1340.164) [-1334.709] (-1340.744) * (-1339.857) (-1338.190) (-1341.098) [-1340.356] -- 0:00:37
874500 -- [-1332.886] (-1333.566) (-1347.222) (-1332.810) * (-1348.039) (-1339.275) [-1335.073] (-1334.460) -- 0:00:37
875000 -- (-1334.874) (-1351.335) [-1340.027] (-1337.837) * (-1340.252) (-1339.721) (-1335.111) [-1340.450] -- 0:00:36
Average standard deviation of split frequencies: 0.002460
875500 -- (-1346.267) (-1331.960) [-1338.722] (-1335.940) * (-1338.371) (-1340.546) [-1335.563] (-1335.193) -- 0:00:36
876000 -- (-1344.577) (-1337.284) [-1336.686] (-1334.427) * (-1335.352) (-1335.266) (-1346.167) [-1340.704] -- 0:00:36
876500 -- (-1336.492) (-1336.822) [-1336.441] (-1331.424) * [-1335.580] (-1344.282) (-1337.396) (-1338.663) -- 0:00:36
877000 -- (-1335.799) (-1349.762) (-1340.824) [-1342.474] * [-1338.377] (-1342.064) (-1341.150) (-1348.311) -- 0:00:36
877500 -- [-1331.611] (-1343.915) (-1345.418) (-1342.352) * (-1337.684) (-1332.069) [-1333.580] (-1341.866) -- 0:00:36
878000 -- (-1331.174) (-1335.780) (-1342.008) [-1340.569] * [-1337.130] (-1339.988) (-1338.373) (-1347.569) -- 0:00:35
878500 -- (-1335.451) (-1335.370) (-1341.595) [-1350.759] * [-1337.366] (-1342.024) (-1331.754) (-1337.305) -- 0:00:35
879000 -- (-1338.981) (-1340.988) [-1337.727] (-1338.312) * (-1338.483) (-1336.372) [-1345.305] (-1346.173) -- 0:00:35
879500 -- (-1338.576) (-1341.028) (-1342.704) [-1340.618] * (-1343.374) [-1335.233] (-1337.204) (-1340.105) -- 0:00:35
880000 -- (-1348.674) (-1339.428) (-1336.477) [-1334.842] * (-1335.012) (-1333.023) [-1337.479] (-1336.264) -- 0:00:35
Average standard deviation of split frequencies: 0.002676
880500 -- (-1344.471) [-1345.631] (-1342.352) (-1331.120) * (-1332.620) [-1338.891] (-1339.275) (-1342.136) -- 0:00:35
881000 -- (-1342.394) (-1333.109) [-1342.226] (-1336.832) * (-1332.346) [-1335.625] (-1338.731) (-1338.774) -- 0:00:35
881500 -- (-1339.815) (-1340.647) (-1346.825) [-1334.896] * (-1340.674) (-1343.538) [-1340.243] (-1343.652) -- 0:00:34
882000 -- (-1333.638) [-1339.752] (-1336.373) (-1330.977) * (-1340.813) (-1343.760) [-1333.086] (-1336.545) -- 0:00:34
882500 -- (-1341.363) [-1335.739] (-1340.592) (-1336.495) * (-1343.679) [-1337.035] (-1335.645) (-1342.812) -- 0:00:34
883000 -- (-1334.370) [-1336.448] (-1339.000) (-1338.870) * (-1335.033) (-1344.829) [-1331.917] (-1337.687) -- 0:00:34
883500 -- (-1334.405) (-1338.908) [-1337.947] (-1345.403) * (-1338.832) (-1344.024) (-1349.055) [-1341.917] -- 0:00:34
884000 -- [-1337.063] (-1340.283) (-1342.436) (-1339.363) * [-1336.307] (-1339.633) (-1342.451) (-1341.154) -- 0:00:34
884500 -- (-1337.224) (-1337.224) [-1334.168] (-1344.209) * (-1338.163) (-1337.864) [-1339.085] (-1333.531) -- 0:00:34
885000 -- (-1340.807) [-1334.833] (-1339.192) (-1331.063) * (-1340.277) (-1338.360) (-1343.847) [-1334.046] -- 0:00:33
Average standard deviation of split frequencies: 0.002736
885500 -- (-1334.976) (-1333.660) [-1340.664] (-1333.197) * (-1336.922) (-1344.392) (-1342.871) [-1336.308] -- 0:00:33
886000 -- (-1337.684) [-1333.654] (-1339.720) (-1337.983) * (-1334.566) (-1339.100) (-1340.771) [-1334.188] -- 0:00:33
886500 -- (-1341.775) [-1337.454] (-1340.738) (-1335.172) * (-1342.203) (-1337.610) [-1338.187] (-1343.818) -- 0:00:33
887000 -- (-1339.128) [-1336.095] (-1340.376) (-1340.707) * (-1336.421) (-1344.972) (-1331.784) [-1337.940] -- 0:00:33
887500 -- (-1341.406) (-1343.629) (-1335.807) [-1340.263] * (-1335.555) (-1341.639) (-1338.907) [-1343.736] -- 0:00:33
888000 -- (-1334.779) (-1338.285) (-1337.320) [-1335.062] * (-1334.885) (-1349.115) (-1336.556) [-1337.483] -- 0:00:33
888500 -- (-1337.183) [-1338.797] (-1335.852) (-1337.661) * (-1334.804) (-1338.143) (-1342.024) [-1334.345] -- 0:00:32
889000 -- (-1340.285) (-1336.063) [-1344.478] (-1348.505) * (-1344.137) (-1335.133) [-1342.964] (-1342.726) -- 0:00:32
889500 -- [-1338.150] (-1336.299) (-1332.853) (-1341.042) * (-1346.713) [-1337.697] (-1340.600) (-1341.847) -- 0:00:32
890000 -- [-1339.011] (-1337.749) (-1345.988) (-1340.241) * (-1343.093) (-1343.018) (-1343.820) [-1334.020] -- 0:00:32
Average standard deviation of split frequencies: 0.002798
890500 -- (-1351.562) (-1338.464) (-1342.055) [-1335.906] * (-1340.730) [-1339.694] (-1342.039) (-1340.285) -- 0:00:32
891000 -- (-1344.544) (-1339.893) [-1341.165] (-1338.101) * (-1351.167) (-1350.649) (-1343.197) [-1333.865] -- 0:00:32
891500 -- [-1340.318] (-1342.469) (-1343.756) (-1335.571) * [-1338.689] (-1336.101) (-1348.209) (-1339.126) -- 0:00:32
892000 -- (-1335.928) (-1356.864) [-1338.269] (-1337.918) * (-1337.449) [-1336.062] (-1337.720) (-1338.484) -- 0:00:31
892500 -- (-1335.570) [-1334.325] (-1345.985) (-1336.840) * (-1337.045) (-1340.034) (-1338.201) [-1337.899] -- 0:00:31
893000 -- [-1332.370] (-1337.208) (-1342.770) (-1340.731) * (-1335.954) (-1336.281) (-1343.977) [-1338.272] -- 0:00:31
893500 -- [-1335.965] (-1336.274) (-1340.394) (-1335.179) * (-1338.977) (-1334.191) (-1348.712) [-1334.506] -- 0:00:31
894000 -- (-1339.332) (-1343.441) [-1331.546] (-1332.993) * (-1339.170) (-1336.069) [-1337.679] (-1337.289) -- 0:00:31
894500 -- [-1338.609] (-1346.516) (-1341.914) (-1334.527) * (-1344.523) (-1338.683) [-1334.467] (-1342.666) -- 0:00:31
895000 -- (-1337.769) (-1341.630) [-1332.695] (-1334.011) * (-1342.561) (-1339.364) [-1333.461] (-1339.469) -- 0:00:30
Average standard deviation of split frequencies: 0.003157
895500 -- (-1338.020) [-1340.386] (-1336.422) (-1336.979) * [-1340.868] (-1336.224) (-1339.528) (-1341.368) -- 0:00:30
896000 -- [-1339.950] (-1341.903) (-1331.356) (-1337.214) * (-1338.949) (-1335.997) [-1340.078] (-1337.373) -- 0:00:30
896500 -- (-1347.582) [-1336.379] (-1344.853) (-1335.930) * (-1335.524) (-1333.605) [-1337.907] (-1340.124) -- 0:00:30
897000 -- (-1341.550) (-1336.292) [-1343.967] (-1334.987) * (-1336.474) [-1334.816] (-1343.288) (-1338.001) -- 0:00:30
897500 -- (-1344.483) [-1336.824] (-1341.391) (-1340.037) * (-1340.134) (-1338.428) (-1342.646) [-1338.685] -- 0:00:30
898000 -- [-1340.819] (-1335.550) (-1342.998) (-1348.410) * (-1334.846) [-1336.404] (-1353.380) (-1343.419) -- 0:00:30
898500 -- (-1344.420) (-1338.601) [-1341.673] (-1343.189) * [-1342.232] (-1338.366) (-1334.839) (-1336.785) -- 0:00:29
899000 -- [-1334.395] (-1339.275) (-1338.444) (-1338.459) * (-1338.906) [-1337.254] (-1335.022) (-1342.853) -- 0:00:29
899500 -- (-1334.172) (-1344.880) [-1345.795] (-1336.329) * (-1341.772) [-1340.714] (-1340.374) (-1347.664) -- 0:00:29
900000 -- (-1334.731) (-1336.660) (-1339.369) [-1342.457] * (-1338.646) (-1341.627) [-1340.917] (-1334.150) -- 0:00:29
Average standard deviation of split frequencies: 0.002916
900500 -- (-1338.666) (-1342.219) (-1338.334) [-1337.531] * (-1339.324) (-1332.406) (-1337.287) [-1334.505] -- 0:00:29
901000 -- (-1334.898) (-1342.649) (-1337.960) [-1340.385] * (-1338.606) [-1333.576] (-1341.522) (-1335.070) -- 0:00:29
901500 -- [-1341.789] (-1349.458) (-1336.703) (-1333.823) * [-1349.263] (-1338.827) (-1350.542) (-1334.358) -- 0:00:29
902000 -- (-1342.382) (-1341.131) [-1337.519] (-1340.931) * (-1339.291) [-1334.754] (-1344.412) (-1343.397) -- 0:00:28
902500 -- (-1337.326) (-1332.150) [-1337.239] (-1344.697) * (-1337.880) (-1336.773) (-1349.800) [-1339.113] -- 0:00:28
903000 -- [-1335.849] (-1337.818) (-1337.380) (-1340.006) * (-1353.362) [-1335.641] (-1337.303) (-1336.532) -- 0:00:28
903500 -- (-1340.167) [-1336.937] (-1339.762) (-1343.551) * (-1340.298) (-1338.564) [-1341.591] (-1332.352) -- 0:00:28
904000 -- [-1342.749] (-1345.799) (-1335.631) (-1341.292) * (-1339.094) (-1343.699) (-1345.507) [-1334.979] -- 0:00:28
904500 -- (-1340.462) (-1338.101) (-1338.356) [-1337.954] * [-1337.012] (-1337.800) (-1338.694) (-1340.427) -- 0:00:28
905000 -- (-1331.404) (-1337.936) [-1335.998] (-1338.400) * (-1341.630) (-1346.220) [-1342.983] (-1342.355) -- 0:00:28
Average standard deviation of split frequencies: 0.003122
905500 -- (-1328.913) [-1341.270] (-1335.719) (-1333.361) * (-1335.541) [-1341.311] (-1341.644) (-1335.944) -- 0:00:27
906000 -- (-1349.832) [-1338.859] (-1337.077) (-1339.840) * (-1336.689) (-1341.027) [-1333.831] (-1336.607) -- 0:00:27
906500 -- (-1334.266) (-1336.282) [-1336.117] (-1340.422) * [-1337.258] (-1340.088) (-1337.570) (-1334.275) -- 0:00:27
907000 -- (-1337.939) [-1336.761] (-1332.877) (-1340.321) * (-1339.018) (-1333.564) (-1335.864) [-1338.911] -- 0:00:27
907500 -- [-1342.597] (-1341.085) (-1342.088) (-1332.023) * (-1346.492) (-1333.633) [-1333.987] (-1339.686) -- 0:00:27
908000 -- (-1338.660) (-1344.123) (-1332.467) [-1336.093] * [-1337.232] (-1338.134) (-1332.570) (-1345.892) -- 0:00:27
908500 -- (-1341.039) (-1337.810) (-1339.663) [-1331.382] * (-1348.061) [-1334.383] (-1343.640) (-1340.729) -- 0:00:26
909000 -- (-1334.068) (-1340.423) [-1332.651] (-1333.655) * (-1355.651) [-1333.989] (-1339.760) (-1349.053) -- 0:00:26
909500 -- (-1346.972) (-1342.795) (-1342.719) [-1336.160] * (-1345.725) [-1339.674] (-1336.371) (-1332.827) -- 0:00:26
910000 -- (-1343.140) [-1341.623] (-1348.773) (-1329.897) * [-1335.687] (-1338.536) (-1339.377) (-1338.941) -- 0:00:26
Average standard deviation of split frequencies: 0.002810
910500 -- (-1339.894) (-1338.436) (-1340.340) [-1338.424] * (-1338.552) [-1341.052] (-1340.945) (-1334.050) -- 0:00:26
911000 -- (-1341.806) (-1338.268) (-1333.387) [-1345.307] * (-1337.447) [-1335.426] (-1346.533) (-1339.575) -- 0:00:26
911500 -- (-1344.904) (-1338.550) (-1342.222) [-1334.902] * (-1338.489) [-1334.690] (-1350.075) (-1341.648) -- 0:00:26
912000 -- (-1333.615) (-1334.797) [-1337.031] (-1333.711) * (-1334.545) (-1337.026) (-1342.288) [-1334.952] -- 0:00:25
912500 -- [-1344.009] (-1338.206) (-1343.615) (-1340.497) * (-1331.951) [-1335.013] (-1343.611) (-1338.144) -- 0:00:25
913000 -- [-1336.910] (-1335.350) (-1352.820) (-1342.557) * (-1332.105) (-1338.420) [-1331.667] (-1335.365) -- 0:00:25
913500 -- (-1334.905) (-1345.178) [-1341.535] (-1335.185) * [-1337.794] (-1337.152) (-1334.072) (-1344.618) -- 0:00:25
914000 -- [-1340.599] (-1341.822) (-1345.944) (-1336.672) * (-1335.539) (-1340.609) [-1340.211] (-1336.437) -- 0:00:25
914500 -- (-1334.395) (-1340.410) (-1346.391) [-1341.268] * (-1337.715) [-1333.920] (-1333.389) (-1335.163) -- 0:00:25
915000 -- [-1342.041] (-1334.361) (-1341.142) (-1341.631) * (-1339.113) (-1335.710) (-1345.456) [-1337.348] -- 0:00:25
Average standard deviation of split frequencies: 0.002720
915500 -- [-1333.962] (-1341.401) (-1335.040) (-1337.574) * (-1340.523) [-1331.504] (-1343.195) (-1337.833) -- 0:00:24
916000 -- [-1333.324] (-1336.943) (-1335.192) (-1334.541) * (-1337.102) [-1337.770] (-1342.849) (-1340.558) -- 0:00:24
916500 -- (-1350.191) (-1341.126) [-1335.275] (-1335.243) * (-1335.144) (-1344.562) [-1336.544] (-1338.173) -- 0:00:24
917000 -- (-1346.584) (-1351.309) (-1346.786) [-1333.449] * (-1339.686) (-1338.912) [-1336.809] (-1337.576) -- 0:00:24
917500 -- (-1338.849) (-1336.520) (-1340.686) [-1338.227] * (-1349.168) (-1339.708) (-1332.464) [-1336.710] -- 0:00:24
918000 -- [-1335.751] (-1337.406) (-1337.025) (-1347.283) * (-1347.432) [-1341.933] (-1338.186) (-1338.184) -- 0:00:24
918500 -- (-1333.253) (-1343.781) (-1340.453) [-1341.094] * (-1342.158) (-1340.319) (-1335.670) [-1340.773] -- 0:00:24
919000 -- [-1336.131] (-1347.859) (-1333.572) (-1343.564) * [-1333.840] (-1332.806) (-1331.209) (-1334.451) -- 0:00:23
919500 -- (-1339.343) (-1345.235) [-1332.085] (-1338.086) * [-1339.222] (-1347.948) (-1332.775) (-1333.364) -- 0:00:23
920000 -- (-1338.247) [-1339.637] (-1337.522) (-1347.208) * (-1340.957) (-1340.479) (-1336.356) [-1334.753] -- 0:00:23
Average standard deviation of split frequencies: 0.002780
920500 -- [-1337.095] (-1342.266) (-1334.030) (-1340.082) * (-1336.091) (-1342.485) [-1331.611] (-1341.824) -- 0:00:23
921000 -- (-1334.140) (-1338.396) [-1334.515] (-1340.416) * (-1338.707) (-1342.968) [-1332.864] (-1347.349) -- 0:00:23
921500 -- [-1334.678] (-1340.128) (-1341.053) (-1334.856) * (-1341.004) (-1334.598) (-1336.764) [-1339.890] -- 0:00:23
922000 -- (-1342.954) [-1336.841] (-1341.450) (-1336.394) * (-1337.789) (-1346.597) [-1337.369] (-1336.543) -- 0:00:23
922500 -- (-1339.337) (-1352.317) [-1338.829] (-1332.699) * (-1336.527) (-1340.237) [-1339.820] (-1337.336) -- 0:00:22
923000 -- (-1342.023) (-1340.372) [-1338.701] (-1338.796) * (-1334.329) [-1342.752] (-1338.213) (-1335.788) -- 0:00:22
923500 -- (-1339.615) (-1342.411) (-1345.682) [-1335.456] * [-1334.064] (-1345.388) (-1338.254) (-1345.125) -- 0:00:22
924000 -- [-1333.294] (-1341.871) (-1337.695) (-1337.279) * (-1336.980) [-1333.429] (-1341.865) (-1341.320) -- 0:00:22
924500 -- [-1339.429] (-1345.251) (-1336.464) (-1342.625) * (-1343.317) (-1335.363) (-1336.956) [-1337.135] -- 0:00:22
925000 -- (-1332.146) (-1335.326) [-1339.520] (-1350.107) * [-1335.838] (-1337.304) (-1335.319) (-1338.506) -- 0:00:22
Average standard deviation of split frequencies: 0.002618
925500 -- [-1334.563] (-1338.854) (-1340.495) (-1335.340) * (-1341.837) [-1334.137] (-1340.265) (-1334.348) -- 0:00:21
926000 -- (-1335.127) [-1338.855] (-1345.679) (-1337.590) * (-1341.463) (-1344.815) (-1341.145) [-1337.091] -- 0:00:21
926500 -- (-1344.556) [-1342.016] (-1337.203) (-1337.287) * (-1336.395) (-1343.619) [-1339.111] (-1335.110) -- 0:00:21
927000 -- (-1340.926) (-1338.087) (-1338.755) [-1335.560] * (-1343.973) (-1344.438) [-1339.256] (-1338.255) -- 0:00:21
927500 -- [-1348.004] (-1339.078) (-1339.469) (-1333.552) * (-1337.612) (-1339.169) [-1339.132] (-1334.956) -- 0:00:21
928000 -- (-1337.371) (-1345.532) (-1337.647) [-1333.097] * (-1336.235) (-1340.055) (-1343.108) [-1341.622] -- 0:00:21
928500 -- (-1343.764) [-1336.214] (-1342.111) (-1347.406) * [-1339.198] (-1344.043) (-1336.788) (-1341.638) -- 0:00:21
929000 -- (-1331.787) [-1333.258] (-1347.586) (-1338.937) * (-1340.397) [-1335.923] (-1336.587) (-1343.052) -- 0:00:20
929500 -- (-1340.608) [-1343.457] (-1337.285) (-1342.011) * (-1341.162) (-1341.224) (-1343.354) [-1334.839] -- 0:00:20
930000 -- (-1344.167) (-1331.006) (-1338.975) [-1336.565] * [-1340.241] (-1341.245) (-1340.127) (-1341.437) -- 0:00:20
Average standard deviation of split frequencies: 0.002822
930500 -- [-1332.985] (-1340.275) (-1333.713) (-1351.838) * (-1341.504) (-1336.004) (-1349.634) [-1334.702] -- 0:00:20
931000 -- [-1342.310] (-1337.440) (-1338.022) (-1344.005) * (-1335.090) (-1337.224) [-1334.627] (-1346.389) -- 0:00:20
931500 -- (-1338.375) (-1338.862) (-1335.296) [-1336.728] * (-1330.965) (-1341.647) [-1336.427] (-1337.273) -- 0:00:20
932000 -- (-1338.905) [-1334.102] (-1334.527) (-1334.833) * (-1340.413) (-1336.206) (-1337.087) [-1335.225] -- 0:00:20
932500 -- (-1341.135) [-1336.640] (-1331.102) (-1338.328) * [-1335.652] (-1337.856) (-1332.510) (-1337.995) -- 0:00:19
933000 -- [-1339.427] (-1335.710) (-1342.090) (-1336.937) * (-1340.621) [-1332.462] (-1339.217) (-1340.177) -- 0:00:19
933500 -- (-1347.355) (-1339.120) [-1332.752] (-1349.593) * [-1338.757] (-1338.473) (-1335.563) (-1335.773) -- 0:00:19
934000 -- [-1334.745] (-1340.260) (-1336.413) (-1344.020) * [-1338.242] (-1335.656) (-1336.748) (-1338.505) -- 0:00:19
934500 -- [-1335.578] (-1338.231) (-1339.430) (-1334.642) * (-1337.038) (-1338.921) [-1338.007] (-1336.611) -- 0:00:19
935000 -- (-1336.190) (-1339.020) [-1336.062] (-1338.349) * (-1341.244) (-1334.849) (-1343.003) [-1339.457] -- 0:00:19
Average standard deviation of split frequencies: 0.003382
935500 -- (-1332.972) (-1336.722) (-1343.469) [-1336.451] * (-1337.908) (-1340.711) [-1338.636] (-1337.843) -- 0:00:19
936000 -- (-1332.823) (-1338.130) (-1337.833) [-1336.545] * [-1332.954] (-1348.115) (-1348.336) (-1340.048) -- 0:00:18
936500 -- [-1335.862] (-1332.361) (-1344.127) (-1337.052) * (-1338.873) (-1342.326) [-1334.098] (-1342.273) -- 0:00:18
937000 -- [-1333.277] (-1340.409) (-1340.494) (-1340.275) * [-1335.822] (-1341.211) (-1335.765) (-1333.846) -- 0:00:18
937500 -- (-1346.237) (-1340.352) [-1345.486] (-1344.905) * [-1336.335] (-1336.190) (-1332.767) (-1337.575) -- 0:00:18
938000 -- (-1341.618) [-1334.350] (-1365.851) (-1348.779) * (-1334.081) (-1335.404) (-1342.701) [-1332.172] -- 0:00:18
938500 -- [-1334.670] (-1336.086) (-1332.367) (-1350.021) * [-1336.811] (-1344.218) (-1345.202) (-1339.145) -- 0:00:18
939000 -- (-1337.131) (-1348.566) [-1334.144] (-1344.008) * [-1338.830] (-1342.186) (-1336.723) (-1343.585) -- 0:00:17
939500 -- [-1337.239] (-1344.418) (-1342.721) (-1339.575) * [-1332.850] (-1343.269) (-1338.496) (-1337.258) -- 0:00:17
940000 -- (-1341.451) (-1347.364) (-1345.178) [-1338.505] * (-1343.624) [-1339.781] (-1336.237) (-1341.221) -- 0:00:17
Average standard deviation of split frequencies: 0.004295
940500 -- [-1334.872] (-1335.925) (-1344.186) (-1337.571) * (-1339.201) (-1341.150) (-1341.519) [-1333.991] -- 0:00:17
941000 -- (-1336.478) [-1332.537] (-1339.785) (-1336.791) * (-1337.573) (-1337.256) [-1340.691] (-1340.760) -- 0:00:17
941500 -- (-1336.482) (-1337.783) [-1335.578] (-1343.778) * (-1352.723) (-1334.686) (-1336.583) [-1335.733] -- 0:00:17
942000 -- [-1331.356] (-1335.869) (-1344.055) (-1342.160) * (-1342.135) [-1334.148] (-1349.340) (-1337.434) -- 0:00:17
942500 -- (-1349.762) (-1341.124) (-1337.792) [-1336.697] * (-1343.446) [-1336.895] (-1346.555) (-1335.769) -- 0:00:16
943000 -- (-1348.890) (-1332.801) [-1336.338] (-1344.789) * (-1351.184) [-1343.371] (-1340.892) (-1341.424) -- 0:00:16
943500 -- (-1342.377) (-1347.534) (-1342.468) [-1334.951] * (-1342.395) (-1333.423) [-1340.800] (-1340.572) -- 0:00:16
944000 -- (-1360.800) (-1334.534) (-1343.976) [-1341.445] * [-1340.245] (-1345.078) (-1332.679) (-1342.550) -- 0:00:16
944500 -- (-1332.349) (-1333.083) [-1335.956] (-1345.682) * (-1331.131) [-1342.591] (-1335.882) (-1346.545) -- 0:00:16
945000 -- [-1345.416] (-1341.203) (-1339.928) (-1342.509) * (-1338.253) (-1339.673) (-1346.221) [-1338.859] -- 0:00:16
Average standard deviation of split frequencies: 0.004770
945500 -- (-1339.051) (-1334.979) [-1334.058] (-1338.106) * (-1334.624) (-1337.448) [-1349.747] (-1348.389) -- 0:00:16
946000 -- (-1338.711) (-1334.731) [-1340.388] (-1337.624) * (-1341.787) (-1337.431) [-1338.165] (-1344.606) -- 0:00:15
946500 -- (-1340.729) (-1349.541) [-1338.807] (-1338.148) * (-1334.822) (-1349.633) (-1337.660) [-1341.682] -- 0:00:15
947000 -- (-1334.794) [-1332.624] (-1341.318) (-1339.268) * (-1336.737) (-1339.394) [-1332.765] (-1341.466) -- 0:00:15
947500 -- [-1339.991] (-1335.392) (-1342.294) (-1341.493) * (-1338.842) (-1339.832) (-1342.187) [-1335.710] -- 0:00:15
948000 -- [-1341.512] (-1338.884) (-1343.778) (-1338.629) * [-1336.063] (-1338.584) (-1339.905) (-1341.911) -- 0:00:15
948500 -- (-1339.864) (-1341.766) [-1336.453] (-1344.316) * (-1335.473) [-1341.113] (-1336.130) (-1340.139) -- 0:00:15
949000 -- (-1340.708) [-1336.502] (-1338.675) (-1341.111) * (-1333.369) (-1338.051) (-1342.981) [-1339.015] -- 0:00:15
949500 -- (-1340.322) [-1334.839] (-1337.678) (-1346.443) * (-1336.012) (-1341.325) [-1340.233] (-1333.910) -- 0:00:14
950000 -- (-1338.021) (-1339.750) [-1336.014] (-1340.338) * [-1336.280] (-1333.394) (-1344.853) (-1337.587) -- 0:00:14
Average standard deviation of split frequencies: 0.004321
950500 -- (-1340.002) [-1334.925] (-1334.651) (-1343.801) * (-1341.934) (-1335.409) (-1342.350) [-1338.000] -- 0:00:14
951000 -- (-1339.259) (-1342.392) [-1334.892] (-1334.569) * [-1328.379] (-1342.257) (-1343.471) (-1340.210) -- 0:00:14
951500 -- (-1343.862) (-1345.234) [-1335.523] (-1335.104) * [-1334.540] (-1345.757) (-1339.183) (-1335.978) -- 0:00:14
952000 -- (-1339.016) (-1337.151) (-1342.153) [-1339.176] * (-1344.199) [-1339.158] (-1338.687) (-1334.459) -- 0:00:14
952500 -- (-1346.989) [-1341.285] (-1340.815) (-1345.598) * (-1337.786) (-1343.319) [-1339.351] (-1335.900) -- 0:00:14
953000 -- (-1341.354) [-1338.120] (-1343.283) (-1336.965) * (-1339.042) (-1332.563) (-1350.969) [-1338.621] -- 0:00:13
953500 -- (-1341.251) (-1337.827) [-1334.897] (-1340.317) * (-1336.743) [-1339.957] (-1344.940) (-1341.879) -- 0:00:13
954000 -- (-1349.981) (-1336.381) [-1337.012] (-1333.499) * (-1339.419) (-1341.267) (-1350.815) [-1333.636] -- 0:00:13
954500 -- (-1347.418) (-1335.742) [-1344.751] (-1337.768) * [-1335.336] (-1341.833) (-1334.893) (-1345.449) -- 0:00:13
955000 -- (-1341.979) [-1338.841] (-1343.062) (-1342.081) * (-1340.481) (-1339.494) [-1340.018] (-1339.983) -- 0:00:13
Average standard deviation of split frequencies: 0.004086
955500 -- [-1342.724] (-1334.870) (-1339.715) (-1350.303) * [-1334.699] (-1345.362) (-1337.334) (-1347.982) -- 0:00:13
956000 -- (-1334.778) [-1334.742] (-1341.674) (-1343.683) * (-1338.351) (-1347.334) (-1345.197) [-1337.551] -- 0:00:12
956500 -- [-1333.852] (-1331.283) (-1350.724) (-1339.533) * [-1340.097] (-1336.226) (-1342.954) (-1339.275) -- 0:00:12
957000 -- (-1341.609) (-1332.165) [-1337.545] (-1340.232) * (-1334.456) (-1339.301) [-1340.985] (-1345.031) -- 0:00:12
957500 -- (-1342.961) (-1335.845) (-1337.180) [-1335.013] * [-1339.446] (-1344.560) (-1350.154) (-1337.754) -- 0:00:12
958000 -- (-1338.531) (-1338.023) [-1333.369] (-1341.633) * (-1332.648) (-1341.723) (-1348.547) [-1342.933] -- 0:00:12
958500 -- (-1334.054) [-1332.365] (-1335.048) (-1354.708) * [-1331.706] (-1349.843) (-1338.623) (-1341.324) -- 0:00:12
959000 -- (-1339.255) (-1338.922) [-1334.361] (-1344.412) * [-1331.144] (-1344.714) (-1343.038) (-1340.914) -- 0:00:12
959500 -- (-1332.633) (-1344.212) [-1332.606] (-1340.881) * (-1332.547) (-1350.591) [-1336.953] (-1339.882) -- 0:00:11
960000 -- (-1339.935) (-1343.016) [-1336.953] (-1340.766) * (-1344.112) (-1348.432) [-1336.955] (-1338.913) -- 0:00:11
Average standard deviation of split frequencies: 0.004136
960500 -- (-1341.734) (-1337.076) (-1337.948) [-1339.051] * (-1336.898) (-1339.641) [-1341.319] (-1343.188) -- 0:00:11
961000 -- (-1340.490) (-1346.025) (-1339.091) [-1336.738] * (-1343.713) (-1345.881) [-1334.892] (-1333.836) -- 0:00:11
961500 -- [-1333.782] (-1345.576) (-1343.386) (-1339.391) * (-1339.479) (-1335.112) (-1343.835) [-1333.253] -- 0:00:11
962000 -- (-1338.095) [-1338.883] (-1343.589) (-1332.391) * (-1352.196) [-1335.049] (-1345.307) (-1347.421) -- 0:00:11
962500 -- (-1334.302) [-1335.012] (-1348.510) (-1349.211) * [-1337.573] (-1344.944) (-1346.413) (-1346.920) -- 0:00:11
963000 -- (-1348.200) (-1346.828) [-1339.970] (-1336.330) * (-1348.313) (-1345.532) (-1341.336) [-1340.197] -- 0:00:10
963500 -- (-1336.549) [-1344.684] (-1335.801) (-1331.155) * (-1340.702) [-1341.080] (-1336.665) (-1340.463) -- 0:00:10
964000 -- (-1341.634) (-1334.223) (-1337.028) [-1338.782] * [-1334.654] (-1344.114) (-1338.804) (-1341.014) -- 0:00:10
964500 -- [-1337.534] (-1337.412) (-1342.119) (-1338.412) * (-1339.829) (-1334.033) [-1334.643] (-1340.746) -- 0:00:10
965000 -- (-1342.536) [-1334.262] (-1335.597) (-1341.188) * [-1336.487] (-1339.302) (-1338.205) (-1343.752) -- 0:00:10
Average standard deviation of split frequencies: 0.004741
965500 -- (-1343.000) (-1339.149) (-1340.308) [-1341.674] * (-1345.264) (-1342.971) [-1337.162] (-1338.064) -- 0:00:10
966000 -- (-1335.460) (-1340.734) (-1345.904) [-1342.767] * (-1339.586) [-1342.596] (-1333.340) (-1336.414) -- 0:00:10
966500 -- (-1335.573) (-1340.065) [-1338.547] (-1334.324) * [-1339.176] (-1345.379) (-1338.158) (-1336.662) -- 0:00:09
967000 -- [-1336.612] (-1337.446) (-1339.902) (-1340.538) * (-1338.087) [-1335.614] (-1345.454) (-1346.505) -- 0:00:09
967500 -- (-1335.348) (-1344.036) [-1339.524] (-1335.394) * [-1339.737] (-1333.454) (-1336.345) (-1341.000) -- 0:00:09
968000 -- (-1334.993) (-1339.979) [-1345.623] (-1336.412) * (-1349.971) (-1345.400) (-1340.415) [-1347.188] -- 0:00:09
968500 -- (-1338.853) [-1333.472] (-1340.103) (-1343.158) * (-1331.841) [-1337.846] (-1340.221) (-1344.894) -- 0:00:09
969000 -- (-1345.096) (-1338.328) (-1340.246) [-1338.278] * (-1337.293) (-1344.238) [-1349.656] (-1342.282) -- 0:00:09
969500 -- (-1346.677) (-1337.089) [-1340.664] (-1346.627) * (-1343.464) (-1337.081) (-1344.666) [-1337.718] -- 0:00:08
970000 -- (-1343.749) [-1346.407] (-1340.208) (-1336.789) * (-1337.974) (-1342.530) (-1350.778) [-1340.713] -- 0:00:08
Average standard deviation of split frequencies: 0.004440
970500 -- (-1341.956) (-1333.585) [-1336.767] (-1338.807) * [-1336.295] (-1341.786) (-1338.822) (-1336.324) -- 0:00:08
971000 -- (-1337.747) [-1335.964] (-1343.048) (-1340.532) * (-1334.823) (-1338.258) [-1334.271] (-1329.035) -- 0:00:08
971500 -- (-1336.087) (-1342.825) (-1334.953) [-1336.428] * [-1333.079] (-1340.774) (-1346.100) (-1335.452) -- 0:00:08
972000 -- (-1342.270) [-1334.890] (-1343.757) (-1334.373) * (-1337.961) [-1335.684] (-1339.874) (-1339.198) -- 0:00:08
972500 -- [-1343.147] (-1337.549) (-1344.104) (-1339.129) * [-1333.993] (-1340.468) (-1332.603) (-1331.091) -- 0:00:08
973000 -- (-1341.114) [-1337.759] (-1333.912) (-1343.186) * [-1336.785] (-1335.038) (-1338.682) (-1339.448) -- 0:00:07
973500 -- (-1338.688) (-1338.103) [-1335.147] (-1347.632) * (-1335.947) [-1335.801] (-1341.100) (-1347.300) -- 0:00:07
974000 -- [-1342.839] (-1348.744) (-1337.631) (-1333.781) * (-1336.555) [-1344.002] (-1345.914) (-1334.302) -- 0:00:07
974500 -- [-1341.037] (-1346.135) (-1343.636) (-1339.602) * (-1340.692) (-1342.183) (-1333.921) [-1332.591] -- 0:00:07
975000 -- [-1333.260] (-1332.996) (-1334.994) (-1333.839) * (-1340.925) (-1341.446) [-1335.599] (-1332.364) -- 0:00:07
Average standard deviation of split frequencies: 0.004623
975500 -- (-1345.925) (-1345.426) [-1334.849] (-1339.244) * (-1338.149) [-1333.340] (-1332.682) (-1330.257) -- 0:00:07
976000 -- (-1345.236) (-1336.967) (-1334.370) [-1344.189] * (-1340.700) [-1340.180] (-1336.889) (-1334.250) -- 0:00:07
976500 -- (-1347.744) (-1339.265) [-1330.761] (-1332.914) * [-1336.218] (-1337.959) (-1335.396) (-1341.070) -- 0:00:06
977000 -- [-1335.334] (-1344.774) (-1337.673) (-1334.932) * [-1335.949] (-1344.171) (-1342.166) (-1336.869) -- 0:00:06
977500 -- (-1341.807) (-1343.183) [-1337.779] (-1342.352) * (-1338.634) (-1336.598) (-1338.403) [-1337.125] -- 0:00:06
978000 -- (-1337.871) (-1333.197) (-1338.294) [-1338.817] * (-1339.557) [-1332.884] (-1336.069) (-1340.209) -- 0:00:06
978500 -- (-1337.457) (-1342.373) [-1336.375] (-1352.922) * (-1344.207) [-1332.333] (-1345.459) (-1346.991) -- 0:00:06
979000 -- (-1340.950) [-1334.005] (-1344.043) (-1344.833) * (-1344.957) [-1337.947] (-1337.523) (-1348.310) -- 0:00:06
979500 -- (-1336.446) (-1342.764) [-1334.279] (-1345.899) * [-1346.227] (-1340.093) (-1333.228) (-1340.324) -- 0:00:06
980000 -- (-1349.294) [-1338.692] (-1336.121) (-1346.748) * (-1344.458) (-1341.004) (-1345.669) [-1335.166] -- 0:00:05
Average standard deviation of split frequencies: 0.004464
980500 -- (-1350.474) (-1345.008) [-1337.054] (-1339.736) * (-1337.457) [-1338.339] (-1338.657) (-1341.758) -- 0:00:05
981000 -- [-1343.075] (-1340.210) (-1333.067) (-1339.696) * [-1339.168] (-1338.647) (-1337.561) (-1341.029) -- 0:00:05
981500 -- [-1335.516] (-1343.448) (-1342.710) (-1335.916) * [-1342.807] (-1338.573) (-1333.420) (-1342.625) -- 0:00:05
982000 -- (-1334.776) [-1346.299] (-1340.659) (-1344.052) * (-1339.862) (-1342.340) [-1333.568] (-1341.745) -- 0:00:05
982500 -- (-1335.788) (-1346.310) (-1337.782) [-1337.990] * [-1338.947] (-1339.893) (-1340.663) (-1344.656) -- 0:00:05
983000 -- [-1333.612] (-1342.441) (-1340.263) (-1332.547) * (-1347.473) (-1339.499) (-1343.760) [-1338.928] -- 0:00:05
983500 -- [-1329.273] (-1330.690) (-1344.109) (-1332.423) * (-1342.390) [-1342.640] (-1336.588) (-1336.040) -- 0:00:04
984000 -- (-1341.665) (-1335.083) (-1334.040) [-1339.650] * (-1344.198) [-1333.438] (-1340.037) (-1345.783) -- 0:00:04
984500 -- (-1337.201) [-1338.261] (-1336.364) (-1332.074) * (-1340.485) [-1335.215] (-1336.195) (-1340.978) -- 0:00:04
985000 -- [-1343.819] (-1335.122) (-1334.799) (-1340.177) * [-1336.984] (-1337.477) (-1338.341) (-1332.378) -- 0:00:04
Average standard deviation of split frequencies: 0.004986
985500 -- [-1343.963] (-1338.147) (-1346.510) (-1343.285) * [-1330.836] (-1348.616) (-1340.454) (-1339.975) -- 0:00:04
986000 -- (-1337.831) [-1345.708] (-1338.853) (-1332.813) * [-1338.119] (-1340.321) (-1334.378) (-1337.523) -- 0:00:04
986500 -- (-1342.854) (-1334.950) [-1334.992] (-1345.720) * (-1337.621) (-1342.598) (-1339.573) [-1333.101] -- 0:00:03
987000 -- [-1334.470] (-1334.454) (-1338.754) (-1335.946) * [-1336.788] (-1342.015) (-1335.034) (-1337.555) -- 0:00:03
987500 -- [-1340.955] (-1335.914) (-1338.248) (-1337.101) * [-1341.852] (-1338.075) (-1333.775) (-1336.093) -- 0:00:03
988000 -- (-1334.607) (-1335.963) (-1336.799) [-1340.276] * (-1347.378) (-1334.855) [-1335.755] (-1336.262) -- 0:00:03
988500 -- [-1340.511] (-1336.016) (-1343.835) (-1340.846) * (-1338.837) (-1335.735) [-1336.916] (-1336.723) -- 0:00:03
989000 -- (-1334.301) [-1346.044] (-1340.257) (-1339.070) * (-1343.928) (-1333.602) (-1335.556) [-1333.907] -- 0:00:03
989500 -- (-1341.909) (-1337.367) (-1331.025) [-1339.266] * (-1339.254) [-1329.474] (-1341.589) (-1335.756) -- 0:00:03
990000 -- (-1341.684) [-1339.403] (-1339.861) (-1347.890) * [-1345.411] (-1334.421) (-1345.907) (-1339.795) -- 0:00:02
Average standard deviation of split frequencies: 0.005098
990500 -- (-1340.558) [-1336.962] (-1336.506) (-1343.202) * (-1345.013) (-1334.199) (-1346.469) [-1338.131] -- 0:00:02
991000 -- [-1333.308] (-1335.766) (-1335.476) (-1341.612) * [-1336.650] (-1337.082) (-1340.482) (-1343.490) -- 0:00:02
991500 -- (-1335.688) (-1341.062) (-1339.007) [-1347.378] * [-1340.468] (-1341.874) (-1344.095) (-1338.053) -- 0:00:02
992000 -- (-1346.847) [-1336.377] (-1333.454) (-1345.186) * [-1335.811] (-1339.415) (-1341.092) (-1333.780) -- 0:00:02
992500 -- [-1336.750] (-1343.315) (-1337.971) (-1336.866) * (-1339.666) (-1335.742) (-1337.173) [-1344.667] -- 0:00:02
993000 -- [-1341.643] (-1341.845) (-1344.516) (-1333.092) * (-1340.587) (-1335.122) [-1340.550] (-1340.181) -- 0:00:02
993500 -- (-1336.666) [-1339.381] (-1340.329) (-1339.657) * (-1335.008) [-1331.915] (-1337.363) (-1338.756) -- 0:00:01
994000 -- (-1349.053) (-1344.919) (-1339.782) [-1339.370] * (-1337.994) (-1344.194) (-1337.201) [-1336.249] -- 0:00:01
994500 -- (-1345.588) (-1340.275) (-1341.128) [-1339.666] * [-1337.138] (-1340.990) (-1341.837) (-1338.202) -- 0:00:01
995000 -- (-1344.410) (-1337.710) (-1337.522) [-1336.512] * (-1338.604) [-1342.624] (-1346.918) (-1340.423) -- 0:00:01
Average standard deviation of split frequencies: 0.005139
995500 -- [-1339.270] (-1336.790) (-1338.106) (-1344.922) * (-1340.298) (-1341.312) (-1339.841) [-1333.828] -- 0:00:01
996000 -- (-1346.267) (-1336.104) (-1339.877) [-1339.622] * (-1333.170) (-1336.795) [-1342.998] (-1342.361) -- 0:00:01
996500 -- (-1337.544) (-1333.763) [-1339.133] (-1342.664) * (-1340.018) [-1339.269] (-1337.419) (-1339.333) -- 0:00:01
997000 -- (-1341.781) (-1340.551) [-1340.974] (-1341.359) * [-1344.335] (-1348.546) (-1335.028) (-1334.205) -- 0:00:00
997500 -- [-1341.272] (-1340.974) (-1341.517) (-1342.147) * (-1340.337) [-1336.185] (-1336.966) (-1333.696) -- 0:00:00
998000 -- (-1338.826) [-1339.190] (-1343.813) (-1345.481) * [-1336.840] (-1332.238) (-1340.231) (-1333.456) -- 0:00:00
998500 -- (-1339.061) [-1338.401] (-1343.282) (-1339.856) * (-1335.409) (-1337.596) (-1342.982) [-1335.849] -- 0:00:00
999000 -- (-1335.777) (-1336.183) [-1339.764] (-1338.148) * [-1338.162] (-1343.203) (-1336.103) (-1333.404) -- 0:00:00
999500 -- (-1343.428) (-1340.084) [-1335.150] (-1345.541) * (-1336.413) (-1335.393) [-1338.602] (-1342.888) -- 0:00:00
1000000 -- (-1333.561) (-1348.705) (-1334.468) [-1339.170] * (-1338.553) (-1341.551) [-1336.321] (-1346.348) -- 0:00:00
Average standard deviation of split frequencies: 0.005249
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1333.561174 -- 17.421948
Chain 1 -- -1333.561172 -- 17.421948
Chain 2 -- -1348.704538 -- 17.365440
Chain 2 -- -1348.704535 -- 17.365440
Chain 3 -- -1334.468482 -- 13.331164
Chain 3 -- -1334.468494 -- 13.331164
Chain 4 -- -1339.169821 -- 15.792317
Chain 4 -- -1339.169813 -- 15.792317
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1338.552885 -- 11.074766
Chain 1 -- -1338.552880 -- 11.074766
Chain 2 -- -1341.550844 -- 13.253183
Chain 2 -- -1341.550834 -- 13.253183
Chain 3 -- -1336.321141 -- 18.101981
Chain 3 -- -1336.321152 -- 18.101981
Chain 4 -- -1346.348205 -- 16.576227
Chain 4 -- -1346.348203 -- 16.576227
Analysis completed in 4 mins 55 seconds
Analysis used 294.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1327.38
Likelihood of best state for "cold" chain of run 2 was -1327.44
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
51.2 % ( 38 %) Dirichlet(Revmat{all})
66.3 % ( 53 %) Slider(Revmat{all})
31.1 % ( 29 %) Dirichlet(Pi{all})
31.7 % ( 32 %) Slider(Pi{all})
37.4 % ( 27 %) Multiplier(Alpha{1,2})
46.4 % ( 26 %) Multiplier(Alpha{3})
70.1 % ( 35 %) Slider(Pinvar{all})
8.4 % ( 12 %) ExtSPR(Tau{all},V{all})
4.0 % ( 3 %) ExtTBR(Tau{all},V{all})
16.4 % ( 20 %) NNI(Tau{all},V{all})
18.5 % ( 13 %) ParsSPR(Tau{all},V{all})
26.3 % ( 26 %) Multiplier(V{all})
36.4 % ( 36 %) Nodeslider(V{all})
25.7 % ( 16 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
51.8 % ( 35 %) Dirichlet(Revmat{all})
65.8 % ( 51 %) Slider(Revmat{all})
30.9 % ( 28 %) Dirichlet(Pi{all})
31.7 % ( 28 %) Slider(Pi{all})
37.7 % ( 31 %) Multiplier(Alpha{1,2})
45.8 % ( 23 %) Multiplier(Alpha{3})
70.2 % ( 36 %) Slider(Pinvar{all})
8.4 % ( 2 %) ExtSPR(Tau{all},V{all})
4.1 % ( 6 %) ExtTBR(Tau{all},V{all})
15.9 % ( 13 %) NNI(Tau{all},V{all})
18.4 % ( 11 %) ParsSPR(Tau{all},V{all})
26.3 % ( 32 %) Multiplier(V{all})
36.0 % ( 31 %) Nodeslider(V{all})
25.6 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.47
2 | 166490 0.81 0.65
3 | 166566 166670 0.82
4 | 166824 166497 166953
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.47
2 | 166743 0.81 0.64
3 | 166882 167046 0.83
4 | 166486 166620 166223
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1336.23
| 1 2 2 21 |
| 2 2 2 |
| 2 2 1 2 1 2 21 2 * |
|2 * 21 12 2 2 1 2 11 2 |
| 1 1 2121 2 2 2 |
|1 1* 2 2 1 1 1 1 * 2 2 1 21 |
| 2 21 11*1 21 2 * 2 2 1 1 |
| 1 2 1 1 1 1 21 11 2 |
| 2 1 1 212 2|
| 2 11 12 2 111 2 2 |
| 2 2 2 2 |
| 2 2 2 1 1 |
| 1 |
| 1 1 1 |
| 1 1|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1339.45
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1333.88 -1345.39
2 -1333.57 -1343.99
--------------------------------------
TOTAL -1333.71 -1344.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.782904 0.008735 0.609100 0.966890 0.775981 1480.48 1490.74 1.000
r(A<->C){all} 0.072984 0.000483 0.033537 0.117809 0.070899 1158.01 1158.66 1.000
r(A<->G){all} 0.271650 0.002069 0.186489 0.364233 0.269257 640.36 745.49 1.000
r(A<->T){all} 0.148092 0.001407 0.077244 0.220917 0.145749 818.40 909.47 1.000
r(C<->G){all} 0.131101 0.000789 0.079258 0.186107 0.129670 614.63 825.78 1.001
r(C<->T){all} 0.323568 0.002656 0.226810 0.425021 0.320781 742.61 826.80 1.000
r(G<->T){all} 0.052605 0.000597 0.009429 0.101796 0.049546 1020.94 1029.90 1.001
pi(A){all} 0.290388 0.000488 0.246440 0.332570 0.290917 1191.03 1295.76 1.000
pi(C){all} 0.280306 0.000461 0.241257 0.324293 0.280062 874.68 1049.33 1.000
pi(G){all} 0.257499 0.000437 0.215769 0.296684 0.257256 1137.64 1162.26 1.000
pi(T){all} 0.171806 0.000323 0.135921 0.206246 0.171047 1130.54 1162.26 1.000
alpha{1,2} 0.275464 0.006078 0.153402 0.426597 0.261891 1501.00 1501.00 1.000
alpha{3} 1.914358 0.495246 0.816722 3.375295 1.781559 1363.06 1432.03 1.001
pinvar{all} 0.102394 0.005213 0.000047 0.242077 0.089959 1091.67 1256.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
Key to taxon bipartitions (saved to file "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
--------------
1 -- .*******
2 -- .*......
3 -- ..*.....
4 -- ...*....
5 -- ....*...
6 -- .....*..
7 -- ......*.
8 -- .......*
9 -- .....***
10 -- ...*****
11 -- ...**...
12 -- .**.....
13 -- ......**
14 -- .....*.*
15 -- .....**.
--------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
9 3002 1.000000 0.000000 1.000000 1.000000 2
10 3001 0.999667 0.000471 0.999334 1.000000 2
11 2802 0.933378 0.006595 0.928714 0.938041 2
12 2599 0.865756 0.002355 0.864091 0.867422 2
13 1751 0.583278 0.013662 0.573618 0.592938 2
14 907 0.302132 0.008951 0.295803 0.308461 2
15 344 0.114590 0.004711 0.111259 0.117921 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.056968 0.000297 0.025439 0.090163 0.055202 1.000 2
length{all}[2] 0.130967 0.000876 0.077322 0.190129 0.128198 1.000 2
length{all}[3] 0.019851 0.000108 0.002413 0.040227 0.018204 1.000 2
length{all}[4] 0.064441 0.000360 0.029240 0.101967 0.062248 1.000 2
length{all}[5] 0.068588 0.000399 0.031881 0.106936 0.066536 1.000 2
length{all}[6] 0.106233 0.000759 0.054251 0.159740 0.103682 1.000 2
length{all}[7] 0.090075 0.000626 0.043207 0.137933 0.087590 1.001 2
length{all}[8] 0.090012 0.000614 0.045936 0.139991 0.087791 1.000 2
length{all}[9] 0.051595 0.000355 0.020641 0.091057 0.049184 1.000 2
length{all}[10] 0.047199 0.000330 0.015578 0.084336 0.045238 1.000 2
length{all}[11] 0.026699 0.000214 0.000720 0.053685 0.024653 1.000 2
length{all}[12] 0.015072 0.000102 0.000013 0.033682 0.013359 1.000 2
length{all}[13] 0.018892 0.000156 0.000084 0.041424 0.016632 0.999 2
length{all}[14] 0.017173 0.000157 0.000054 0.041131 0.014777 0.999 2
length{all}[15] 0.012358 0.000111 0.000071 0.032721 0.009805 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005249
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------ C4 (4)
| /-----------------93----------------+
| | \------------------ C5 (5)
| |
|-------100-------+ /------------------------------------ C6 (6)
+ | |
| \-------100-------+ /------------------ C7 (7)
| \--------58-------+
| \------------------ C8 (8)
|
| /------------------ C2 (2)
\--------------------------87-------------------------+
\------------------ C3 (3)
Phylogram (based on average branch lengths):
/-------------------- C1 (1)
|
| /----------------------- C4 (4)
| /--------+
| | \------------------------ C5 (5)
| |
|---------------+ /-------------------------------------- C6 (6)
+ | |
| \-----------------+ /-------------------------------- C7 (7)
| \-----+
| \-------------------------------- C8 (8)
|
| /---------------------------------------------- C2 (2)
\----+
\------ C3 (3)
|-----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (23 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 6 trees
95 % credible set contains 9 trees
99 % credible set contains 14 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 8 ls = 357
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Sequences read..
Counting site patterns.. 0:00
104 patterns at 119 / 119 sites (100.0%), 0:00
Counting codons..
224 bytes for distance
101504 bytes for conP
14144 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
304512 bytes for conP, adjusted
0.110686 0.089350 0.081483 0.140680 0.129705 0.071761 0.225066 0.001413 0.196828 0.208446 0.038104 0.262536 0.023905 0.300000 1.300000
ntime & nrate & np: 13 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 15
lnL0 = -1461.774417
Iterating by ming2
Initial: fx= 1461.774417
x= 0.11069 0.08935 0.08148 0.14068 0.12970 0.07176 0.22507 0.00141 0.19683 0.20845 0.03810 0.26254 0.02391 0.30000 1.30000
1 h-m-p 0.0000 0.0061 615.8137 ++YYCCCC 1451.021156 5 0.0003 30 | 0/15
2 h-m-p 0.0007 0.0036 203.6737 ++ 1386.682271 m 0.0036 48 | 0/15
3 h-m-p 0.0001 0.0007 2445.8087 +CCCCC 1347.716477 4 0.0006 75 | 0/15
4 h-m-p 0.0004 0.0021 245.5271 ++ 1318.334383 m 0.0021 93 | 0/15
5 h-m-p 0.0000 0.0000 216.5731
h-m-p: 4.10689329e-20 2.05344665e-19 2.16573137e+02 1318.334383
.. | 0/15
6 h-m-p 0.0000 0.0018 471.2606 ++CYYCC 1314.084660 4 0.0001 134 | 0/15
7 h-m-p 0.0003 0.0015 122.3763 +YCCC 1302.842834 3 0.0013 158 | 0/15
8 h-m-p 0.0004 0.0020 98.6785 +YCYCCC 1298.532781 5 0.0012 185 | 0/15
9 h-m-p 0.0002 0.0011 76.7281 YCCCC 1297.739576 4 0.0004 210 | 0/15
10 h-m-p 0.0019 0.0117 17.6074 YCCC 1297.594579 3 0.0011 233 | 0/15
11 h-m-p 0.0016 0.0096 11.7812 YCC 1297.539738 2 0.0011 254 | 0/15
12 h-m-p 0.0012 0.1388 10.5845 ++CCC 1296.888419 2 0.0206 278 | 0/15
13 h-m-p 0.0019 0.0175 112.3394 YCCCC 1295.498334 4 0.0040 303 | 0/15
14 h-m-p 0.0029 0.0143 135.7202 YYCC 1294.713952 3 0.0020 325 | 0/15
15 h-m-p 0.0063 0.0313 23.4466 CCC 1294.600110 2 0.0019 347 | 0/15
16 h-m-p 0.0273 0.1365 1.3583 -CC 1294.595935 1 0.0025 368 | 0/15
17 h-m-p 0.0053 0.5756 0.6392 +CCC 1294.547220 2 0.0312 391 | 0/15
18 h-m-p 0.0051 0.3223 3.8931 +CCC 1294.188795 2 0.0265 429 | 0/15
19 h-m-p 0.0074 0.0369 9.6680 CC 1294.145183 1 0.0017 449 | 0/15
20 h-m-p 0.0202 0.4645 0.8074 -YC 1294.144454 1 0.0020 469 | 0/15
21 h-m-p 0.0113 1.6352 0.1459 C 1294.143840 0 0.0122 502 | 0/15
22 h-m-p 0.0314 3.0309 0.0569 +YC 1294.095134 1 0.2590 537 | 0/15
23 h-m-p 1.3651 8.0000 0.0108 CCC 1294.052848 2 1.9975 574 | 0/15
24 h-m-p 1.2037 8.0000 0.0179 CCC 1294.027826 2 1.4293 611 | 0/15
25 h-m-p 1.6000 8.0000 0.0061 YC 1294.026220 1 0.9029 645 | 0/15
26 h-m-p 1.6000 8.0000 0.0016 YC 1294.026153 1 0.8297 679 | 0/15
27 h-m-p 1.6000 8.0000 0.0001 Y 1294.026152 0 1.0010 712 | 0/15
28 h-m-p 1.6000 8.0000 0.0000 Y 1294.026152 0 0.8968 745 | 0/15
29 h-m-p 1.6000 8.0000 0.0000 Y 1294.026152 0 0.7598 778 | 0/15
30 h-m-p 1.6000 8.0000 0.0000 ------Y 1294.026152 0 0.0001 817
Out..
lnL = -1294.026152
818 lfun, 818 eigenQcodon, 10634 P(t)
Time used: 0:04
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
0.110686 0.089350 0.081483 0.140680 0.129705 0.071761 0.225066 0.001413 0.196828 0.208446 0.038104 0.262536 0.023905 1.733510 0.700642 0.304419
ntime & nrate & np: 13 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.617590
np = 16
lnL0 = -1313.858592
Iterating by ming2
Initial: fx= 1313.858592
x= 0.11069 0.08935 0.08148 0.14068 0.12970 0.07176 0.22507 0.00141 0.19683 0.20845 0.03810 0.26254 0.02391 1.73351 0.70064 0.30442
1 h-m-p 0.0000 0.0028 386.8099 ++YCYCCC 1307.496639 5 0.0003 31 | 0/16
2 h-m-p 0.0004 0.0021 148.0865 +YYYYYC 1280.953590 5 0.0017 56 | 0/16
3 h-m-p 0.0009 0.0045 17.1696 YYC 1280.832077 2 0.0008 77 | 0/16
4 h-m-p 0.0016 0.0418 8.5989 YCC 1280.795010 2 0.0012 99 | 0/16
5 h-m-p 0.0013 0.0083 7.9227 YCC 1280.778824 2 0.0008 121 | 0/16
6 h-m-p 0.0012 0.1227 5.4026 C 1280.767952 0 0.0012 140 | 0/16
7 h-m-p 0.0034 0.2003 1.9590 YC 1280.755866 1 0.0063 160 | 0/16
8 h-m-p 0.0028 0.0493 4.4665 CC 1280.740675 1 0.0037 181 | 0/16
9 h-m-p 0.0019 0.1143 8.8116 YC 1280.713326 1 0.0035 201 | 0/16
10 h-m-p 0.0028 0.0788 10.8319 YC 1280.662412 1 0.0052 221 | 0/16
11 h-m-p 0.0098 0.1283 5.7824 CC 1280.648984 1 0.0027 242 | 0/16
12 h-m-p 0.0204 0.4423 0.7660 CC 1280.643580 1 0.0073 263 | 0/16
13 h-m-p 0.0084 0.3905 0.6708 YC 1280.620850 1 0.0157 299 | 0/16
14 h-m-p 0.0048 0.2640 2.1812 ++YYCC 1280.030748 3 0.0601 340 | 0/16
15 h-m-p 0.0033 0.0163 29.5350 YYC 1279.707875 2 0.0025 361 | 0/16
16 h-m-p 0.0887 0.4433 0.5036 CCC 1279.641081 2 0.0337 384 | 0/16
17 h-m-p 0.0049 0.0474 3.4531 +CYCCC 1278.701971 4 0.0261 427 | 0/16
18 h-m-p 1.0595 8.0000 0.0850 YC 1278.529242 1 0.6458 447 | 0/16
19 h-m-p 0.0122 0.0971 4.4934 CC 1278.493965 1 0.0039 484 | 0/16
20 h-m-p 1.6000 8.0000 0.0052 YC 1278.486857 1 0.7072 504 | 0/16
21 h-m-p 1.6000 8.0000 0.0022 YC 1278.486735 1 1.0225 540 | 0/16
22 h-m-p 1.6000 8.0000 0.0003 Y 1278.486734 0 0.9427 575 | 0/16
23 h-m-p 1.6000 8.0000 0.0000 Y 1278.486734 0 0.9338 610 | 0/16
24 h-m-p 1.6000 8.0000 0.0000 -C 1278.486734 0 0.1390 646 | 0/16
25 h-m-p 0.1488 8.0000 0.0000 ---------------.. | 0/16
26 h-m-p 0.0160 8.0000 0.0002 ------------- | 0/16
27 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1278.486734
787 lfun, 2361 eigenQcodon, 20462 P(t)
Time used: 0:10
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
initial w for M2:NSpselection reset.
0.110686 0.089350 0.081483 0.140680 0.129705 0.071761 0.225066 0.001413 0.196828 0.208446 0.038104 0.262536 0.023905 1.822323 0.878998 0.263736 0.186073 2.329016
ntime & nrate & np: 13 3 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.155085
np = 18
lnL0 = -1325.771753
Iterating by ming2
Initial: fx= 1325.771753
x= 0.11069 0.08935 0.08148 0.14068 0.12970 0.07176 0.22507 0.00141 0.19683 0.20845 0.03810 0.26254 0.02391 1.82232 0.87900 0.26374 0.18607 2.32902
1 h-m-p 0.0000 0.0026 387.0703 +++YCYCCC 1318.540811 5 0.0004 52 | 0/18
2 h-m-p 0.0004 0.0019 116.2301 +CYCCC 1303.199981 4 0.0017 100 | 0/18
3 h-m-p 0.0022 0.0109 53.6846 YCCC 1299.333273 3 0.0034 144 | 0/18
4 h-m-p 0.0032 0.0208 56.3914 CYCCC 1297.249537 4 0.0028 190 | 0/18
5 h-m-p 0.0014 0.0068 82.6623 YCCCC 1294.399837 4 0.0025 236 | 0/18
6 h-m-p 0.0040 0.0202 47.3710 YCCC 1290.768181 3 0.0079 280 | 0/18
7 h-m-p 0.0007 0.0037 91.6438 +CYC 1288.052221 2 0.0031 323 | 0/18
8 h-m-p 0.0008 0.0038 86.5953 YCCC 1286.884195 3 0.0017 367 | 0/18
9 h-m-p 0.0069 0.0417 20.9326 YCCC 1286.564191 3 0.0029 411 | 0/18
10 h-m-p 0.0044 0.0220 13.2543 CYC 1286.379201 2 0.0037 453 | 0/18
11 h-m-p 0.0083 0.2091 5.9602 +YCCCC 1285.139600 4 0.0817 500 | 0/18
12 h-m-p 0.0009 0.0045 165.0068 ++ 1283.177117 m 0.0045 539 | 1/18
13 h-m-p 0.0040 0.0202 54.9904 YCCC 1282.813605 3 0.0030 583 | 1/18
14 h-m-p 0.0518 0.2591 1.5640 CC 1282.748004 1 0.0170 623 | 1/18
15 h-m-p 0.0045 0.4365 5.9454 ++YCC 1281.500654 2 0.0609 666 | 1/18
16 h-m-p 0.0070 0.0351 12.7861 CC 1281.388765 1 0.0027 706 | 1/18
17 h-m-p 0.0153 1.7898 2.2190 +YCCC 1280.883277 3 0.1079 750 | 1/18
18 h-m-p 0.0148 0.0739 8.0655 CCC 1280.820351 2 0.0043 792 | 1/18
19 h-m-p 0.1483 3.0273 0.2314 +CCCCC 1279.935297 4 0.9990 839 | 1/18
20 h-m-p 0.4836 2.4181 0.0768 YCCCC 1279.133987 4 0.9522 884 | 1/18
21 h-m-p 0.2846 1.4228 0.0661 YCCCC 1278.651153 4 0.5885 929 | 1/18
22 h-m-p 0.1982 5.9242 0.1962 +YCC 1278.514521 2 0.6179 971 | 1/18
23 h-m-p 1.6000 8.0000 0.0419 CC 1278.488895 1 0.3749 1011 | 1/18
24 h-m-p 1.6000 8.0000 0.0058 YC 1278.486853 1 0.8089 1050 | 1/18
25 h-m-p 0.7537 8.0000 0.0063 C 1278.486749 0 0.6776 1088 | 1/18
26 h-m-p 1.6000 8.0000 0.0013 Y 1278.486735 0 0.9369 1126 | 1/18
27 h-m-p 1.6000 8.0000 0.0001 Y 1278.486734 0 0.6828 1164 | 1/18
28 h-m-p 1.6000 8.0000 0.0001 Y 1278.486734 0 0.7085 1202 | 1/18
29 h-m-p 1.6000 8.0000 0.0000 Y 1278.486734 0 0.7150 1240 | 1/18
30 h-m-p 1.6000 8.0000 0.0000 Y 1278.486734 0 0.4000 1278 | 1/18
31 h-m-p 0.4226 8.0000 0.0000 -----------Y 1278.486734 0 0.0000 1327
Out..
lnL = -1278.486734
1328 lfun, 5312 eigenQcodon, 51792 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1287.666960 S = -1210.806976 -68.786608
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 104 patterns 0:27
did 20 / 104 patterns 0:27
did 30 / 104 patterns 0:28
did 40 / 104 patterns 0:28
did 50 / 104 patterns 0:28
did 60 / 104 patterns 0:28
did 70 / 104 patterns 0:28
did 80 / 104 patterns 0:28
did 90 / 104 patterns 0:28
did 100 / 104 patterns 0:28
did 104 / 104 patterns 0:28
Time used: 0:28
Model 3: discrete
TREE # 1
(1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
0.110686 0.089350 0.081483 0.140680 0.129705 0.071761 0.225066 0.001413 0.196828 0.208446 0.038104 0.262536 0.023905 1.822324 0.062503 0.014820 0.079264 0.185068 0.317553
ntime & nrate & np: 13 4 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 12.396234
np = 19
lnL0 = -1293.348812
Iterating by ming2
Initial: fx= 1293.348812
x= 0.11069 0.08935 0.08148 0.14068 0.12970 0.07176 0.22507 0.00141 0.19683 0.20845 0.03810 0.26254 0.02391 1.82232 0.06250 0.01482 0.07926 0.18507 0.31755
1 h-m-p 0.0000 0.0011 451.9856 ++CYYCC 1289.394275 4 0.0001 51 | 0/19
2 h-m-p 0.0002 0.0009 97.7228 ++ 1281.706640 m 0.0009 92 | 1/19
3 h-m-p 0.0004 0.0020 62.2926 YCYCCC 1280.267270 5 0.0011 141 | 1/19
4 h-m-p 0.0004 0.0018 111.1077 +YCYCCC 1278.202846 5 0.0010 190 | 1/19
5 h-m-p 0.0003 0.0017 54.5858 YCCCC 1277.718476 4 0.0007 237 | 1/19
6 h-m-p 0.0017 0.0151 22.6977 YCCC 1277.303174 3 0.0026 282 | 1/19
7 h-m-p 0.0029 0.0171 20.3127 YCCC 1277.179733 3 0.0012 327 | 1/19
8 h-m-p 0.0039 0.0529 6.5002 YC 1277.136598 1 0.0026 368 | 0/19
9 h-m-p 0.0019 0.0816 9.0075 CCC 1277.121947 2 0.0005 412 | 0/19
10 h-m-p 0.0011 0.0477 3.6815 +CC 1277.091816 1 0.0062 456 | 0/19
11 h-m-p 0.0032 0.1363 7.1003 +CCC 1276.961898 2 0.0153 502 | 0/19
12 h-m-p 0.0041 0.0235 26.2224 CCC 1276.801504 2 0.0053 547 | 0/19
13 h-m-p 0.0259 0.1297 3.8346 -CC 1276.792554 1 0.0026 591 | 0/19
14 h-m-p 0.0082 0.2884 1.2045 YC 1276.789379 1 0.0038 633 | 0/19
15 h-m-p 0.0043 1.1076 1.0676 ++YC 1276.742077 1 0.0562 677 | 0/19
16 h-m-p 0.0020 0.0820 29.7704 +YC 1276.605766 1 0.0059 720 | 0/19
17 h-m-p 0.0159 0.0850 11.0291 YC 1276.586027 1 0.0023 762 | 0/19
18 h-m-p 0.0254 0.4593 1.0194 YC 1276.579837 1 0.0107 804 | 0/19
19 h-m-p 0.0043 0.9195 2.5394 +YC 1276.532278 1 0.0357 847 | 0/19
20 h-m-p 1.2884 8.0000 0.0704 CYC 1276.467702 2 1.2685 891 | 0/19
21 h-m-p 1.6000 8.0000 0.0225 CCC 1276.397206 2 2.6193 936 | 0/19
22 h-m-p 1.0967 8.0000 0.0537 CC 1276.381964 1 1.3789 979 | 0/19
23 h-m-p 1.6000 8.0000 0.0072 CC 1276.378970 1 1.7967 1022 | 0/19
24 h-m-p 1.6000 8.0000 0.0079 +YCC 1276.371403 2 5.2494 1067 | 0/19
25 h-m-p 1.6000 8.0000 0.0082 CCC 1276.366798 2 1.7762 1112 | 0/19
26 h-m-p 0.9746 8.0000 0.0150 YC 1276.365819 1 0.7177 1154 | 0/19
27 h-m-p 1.6000 8.0000 0.0055 YY 1276.364967 1 1.2270 1196 | 0/19
28 h-m-p 1.1974 8.0000 0.0056 C 1276.364728 0 1.5713 1237 | 0/19
29 h-m-p 1.6000 8.0000 0.0043 YC 1276.364703 1 0.8055 1279 | 0/19
30 h-m-p 1.6000 8.0000 0.0009 Y 1276.364701 0 0.8494 1320 | 0/19
31 h-m-p 1.6000 8.0000 0.0000 Y 1276.364701 0 1.0893 1361 | 0/19
32 h-m-p 1.6000 8.0000 0.0000 Y 1276.364701 0 0.8426 1402 | 0/19
33 h-m-p 1.6000 8.0000 0.0000 Y 1276.364701 0 0.8803 1443 | 0/19
34 h-m-p 1.6000 8.0000 0.0000 +Y 1276.364701 0 4.4783 1485 | 0/19
35 h-m-p 1.2788 8.0000 0.0000 ----------------.. | 0/19
36 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1276.364701
1593 lfun, 6372 eigenQcodon, 62127 P(t)
Time used: 0:48
Model 7: beta
TREE # 1
(1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
0.110686 0.089350 0.081483 0.140680 0.129705 0.071761 0.225066 0.001413 0.196828 0.208446 0.038104 0.262536 0.023905 1.730166 0.942968 1.067294
ntime & nrate & np: 13 1 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.067814
np = 16
lnL0 = -1308.815870
Iterating by ming2
Initial: fx= 1308.815870
x= 0.11069 0.08935 0.08148 0.14068 0.12970 0.07176 0.22507 0.00141 0.19683 0.20845 0.03810 0.26254 0.02391 1.73017 0.94297 1.06729
1 h-m-p 0.0000 0.0057 359.5794 ++CCYCC 1304.857978 4 0.0001 46 | 0/16
2 h-m-p 0.0008 0.0049 67.4037 +CCCC 1300.202912 3 0.0026 88 | 0/16
3 h-m-p 0.0007 0.0033 93.5057 +YYYYYC 1292.627860 5 0.0026 129 | 0/16
4 h-m-p 0.0005 0.0024 326.4238 CYCCCC 1284.237797 5 0.0010 173 | 0/16
5 h-m-p 0.0004 0.0020 101.0857 YCCCC 1282.185557 4 0.0010 215 | 0/16
6 h-m-p 0.0022 0.0108 14.9459 CCCC 1281.824117 3 0.0035 256 | 0/16
7 h-m-p 0.0018 0.0090 29.0517 CCCC 1281.440807 3 0.0024 297 | 0/16
8 h-m-p 0.0025 0.0181 27.0966 YCCC 1280.612872 3 0.0063 337 | 0/16
9 h-m-p 0.0027 0.0136 20.4437 CCCC 1280.267029 3 0.0042 378 | 0/16
10 h-m-p 0.0128 0.0642 3.2914 CC 1280.238394 1 0.0040 415 | 0/16
11 h-m-p 0.0047 0.2242 2.7800 +CYC 1280.117085 2 0.0173 454 | 0/16
12 h-m-p 0.0036 0.1465 13.2488 +CCCC 1279.305846 3 0.0212 496 | 0/16
13 h-m-p 0.0049 0.0247 19.6007 YYCC 1279.104851 3 0.0035 535 | 0/16
14 h-m-p 0.0190 0.0951 2.5326 CCC 1279.037669 2 0.0068 574 | 0/16
15 h-m-p 0.0042 0.1194 4.1606 +CCC 1278.668282 2 0.0169 614 | 0/16
16 h-m-p 0.0039 0.0432 17.8072 YCCC 1277.768239 3 0.0090 654 | 0/16
17 h-m-p 0.0218 0.1092 2.0500 -CC 1277.763184 1 0.0021 692 | 0/16
18 h-m-p 0.0189 4.7864 0.2324 +++YYC 1277.307145 2 1.0248 732 | 0/16
19 h-m-p 1.0769 7.4617 0.2211 YCYCCC 1276.688440 5 2.7208 775 | 0/16
20 h-m-p 1.4136 7.0680 0.1467 YCCC 1276.534675 3 0.7847 815 | 0/16
21 h-m-p 1.6000 8.0000 0.0581 YC 1276.460467 1 0.7087 851 | 0/16
22 h-m-p 1.6000 8.0000 0.0241 YC 1276.451958 1 0.9195 887 | 0/16
23 h-m-p 1.6000 8.0000 0.0044 YC 1276.451570 1 1.0860 923 | 0/16
24 h-m-p 0.8941 8.0000 0.0054 C 1276.451423 0 1.1399 958 | 0/16
25 h-m-p 1.6000 8.0000 0.0012 C 1276.451320 0 1.3413 993 | 0/16
26 h-m-p 1.6000 8.0000 0.0007 Y 1276.451308 0 1.0172 1028 | 0/16
27 h-m-p 1.6000 8.0000 0.0004 Y 1276.451307 0 0.8569 1063 | 0/16
28 h-m-p 1.6000 8.0000 0.0000 Y 1276.451307 0 0.7481 1098 | 0/16
29 h-m-p 1.6000 8.0000 0.0000 Y 1276.451307 0 0.8594 1133 | 0/16
30 h-m-p 1.6000 8.0000 0.0000 Y 1276.451307 0 0.9091 1168 | 0/16
31 h-m-p 1.6000 8.0000 0.0000 C 1276.451307 0 1.6000 1203 | 0/16
32 h-m-p 1.6000 8.0000 0.0000 -C 1276.451307 0 0.1000 1239
Out..
lnL = -1276.451307
1240 lfun, 13640 eigenQcodon, 161200 P(t)
Time used: 1:40
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
initial w for M8:NSbetaw>1 reset.
0.110686 0.089350 0.081483 0.140680 0.129705 0.071761 0.225066 0.001413 0.196828 0.208446 0.038104 0.262536 0.023905 1.728272 0.900000 1.091300 1.180709 2.396835
ntime & nrate & np: 13 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.360289
np = 18
lnL0 = -1318.646242
Iterating by ming2
Initial: fx= 1318.646242
x= 0.11069 0.08935 0.08148 0.14068 0.12970 0.07176 0.22507 0.00141 0.19683 0.20845 0.03810 0.26254 0.02391 1.72827 0.90000 1.09130 1.18071 2.39683
1 h-m-p 0.0000 0.0010 384.1361 ++YYCCCC 1312.350538 5 0.0003 51 | 0/18
2 h-m-p 0.0002 0.0009 109.9314 ++ 1305.578415 m 0.0009 90 | 1/18
3 h-m-p 0.0005 0.0023 89.3361 YCYCCC 1302.842514 5 0.0012 137 | 1/18
4 h-m-p 0.0001 0.0007 241.6285 +YCCC 1298.865586 3 0.0006 181 | 1/18
5 h-m-p 0.0002 0.0015 698.7168 +YYYYCCC 1283.196676 6 0.0008 228 | 1/18
6 h-m-p 0.0005 0.0025 95.4320 YCCC 1281.742942 3 0.0009 271 | 0/18
7 h-m-p 0.0005 0.0025 76.5739 YCCCC 1281.235734 4 0.0003 316 | 0/18
8 h-m-p 0.0011 0.0055 18.3500 CCC 1281.077277 2 0.0012 359 | 0/18
9 h-m-p 0.0018 0.0118 11.8659 +CC 1280.716070 1 0.0069 401 | 0/18
10 h-m-p 0.0038 0.0546 21.4680 YC 1280.128613 1 0.0072 441 | 0/18
11 h-m-p 0.0072 0.0358 18.8483 YCC 1279.831995 2 0.0048 483 | 0/18
12 h-m-p 0.0170 0.1240 5.3076 CC 1279.778399 1 0.0047 524 | 0/18
13 h-m-p 0.0077 0.1412 3.2639 YC 1279.747248 1 0.0058 564 | 0/18
14 h-m-p 0.0033 0.2457 5.7613 +YC 1279.442061 1 0.0324 605 | 0/18
15 h-m-p 0.0043 0.0220 43.4481 CCCC 1279.097133 3 0.0049 650 | 0/18
16 h-m-p 0.0171 0.0856 8.2254 YC 1279.058565 1 0.0032 690 | 0/18
17 h-m-p 0.0068 0.2720 3.8843 ++YYC 1278.519886 2 0.0950 733 | 0/18
18 h-m-p 0.0016 0.0081 83.9500 ++ 1277.575501 m 0.0081 772 | 0/18
19 h-m-p -0.0000 -0.0000 0.7776
h-m-p: -3.62788229e-17 -1.81394114e-16 7.77636137e-01 1277.575501
.. | 0/18
20 h-m-p 0.0000 0.0033 43.3276 +++CCC 1277.058127 2 0.0006 854 | 0/18
21 h-m-p 0.0014 0.0166 19.2976 YCCC 1276.913179 3 0.0010 898 | 0/18
22 h-m-p 0.0010 0.0060 17.6792 YYC 1276.831057 2 0.0009 939 | 0/18
23 h-m-p 0.0012 0.0096 13.1378 YC 1276.692002 1 0.0029 979 | 0/18
24 h-m-p 0.0002 0.0009 10.2107 ++ 1276.665477 m 0.0009 1018 | 1/18
25 h-m-p 0.0029 0.0378 3.0222 YC 1276.659816 1 0.0016 1058 | 1/18
26 h-m-p 0.0020 0.0587 2.4178 YC 1276.657655 1 0.0012 1097 | 1/18
27 h-m-p 0.0023 0.1662 1.2977 CC 1276.656521 1 0.0020 1137 | 1/18
28 h-m-p 0.0048 1.0379 0.5428 CC 1276.655756 1 0.0064 1177 | 1/18
29 h-m-p 0.0037 1.8374 1.3263 +CC 1276.651782 1 0.0158 1218 | 1/18
30 h-m-p 0.0028 0.2312 7.5422 YC 1276.644970 1 0.0048 1257 | 1/18
31 h-m-p 0.0158 0.2834 2.3023 YC 1276.643824 1 0.0029 1296 | 1/18
32 h-m-p 0.0101 2.2997 0.6507 YC 1276.641673 1 0.0235 1335 | 1/18
33 h-m-p 0.0026 0.3302 5.8789 +YC 1276.622146 1 0.0238 1375 | 1/18
34 h-m-p 0.0025 0.0319 56.3180 +YYCCC 1276.544454 4 0.0083 1420 | 1/18
35 h-m-p 0.0481 0.2404 5.6480 -YC 1276.542883 1 0.0021 1460 | 1/18
36 h-m-p 0.0217 1.3404 0.5334 YC 1276.542154 1 0.0092 1499 | 1/18
37 h-m-p 0.0050 0.4879 0.9959 ++CCC 1276.522459 2 0.1055 1543 | 1/18
38 h-m-p 0.6468 3.2341 0.0469 CC 1276.495618 1 0.6552 1583 | 1/18
39 h-m-p 0.1420 2.0747 0.2167 +CYCCC 1276.472555 4 0.9717 1629 | 1/18
40 h-m-p 0.2900 1.4498 0.0642 ++ 1276.453849 m 1.4498 1667 | 2/18
41 h-m-p 0.0019 0.1488 46.9627 -YC 1276.453167 1 0.0002 1707 | 2/18
42 h-m-p 0.8812 8.0000 0.0109 C 1276.452071 0 0.9719 1744 | 2/18
43 h-m-p 1.6000 8.0000 0.0017 C 1276.451918 0 1.7502 1781 | 2/18
44 h-m-p 1.6000 8.0000 0.0016 +CC 1276.451392 1 5.5222 1821 | 2/18
45 h-m-p 1.6000 8.0000 0.0010 YC 1276.451314 1 1.1001 1859 | 2/18
46 h-m-p 1.6000 8.0000 0.0002 Y 1276.451313 0 0.9749 1896 | 2/18
47 h-m-p 1.6000 8.0000 0.0000 Y 1276.451313 0 1.0444 1933 | 2/18
48 h-m-p 1.6000 8.0000 0.0000 -Y 1276.451313 0 0.1000 1971
Out..
lnL = -1276.451313
1972 lfun, 23664 eigenQcodon, 281996 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1285.952884 S = -1211.880539 -66.661950
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 104 patterns 3:11
did 20 / 104 patterns 3:11
did 30 / 104 patterns 3:11
did 40 / 104 patterns 3:12
did 50 / 104 patterns 3:12
did 60 / 104 patterns 3:12
did 70 / 104 patterns 3:12
did 80 / 104 patterns 3:12
did 90 / 104 patterns 3:13
did 100 / 104 patterns 3:13
did 104 / 104 patterns 3:13
Time used: 3:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=8, Len=119
D_melanogaster_CG5157-PA MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYG
D_sechellia_CG5157-PA MSQLYEISEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
D_simulans_CG5157-PA MSQLYDLSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
D_yakuba_CG5157-PA MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG
D_erecta_CG5157-PA MSQLYELSEVEQQNGKNGKPCWLIIKGNVYDVTKFLAEHPGGGDVLLEYG
D_suzukii_CG5157-PA MSQLYELSEVAVQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYG
D_eugracilis_CG5157-PA MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYA
D_elegans_CG5157-PA MSQLYEVSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEALLEYG
*****::*** ************************.*****.:.****.
D_melanogaster_CG5157-PA GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPTAN
D_sechellia_CG5157-PA GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPAAH
D_simulans_CG5157-PA GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGSAKPAAN
D_yakuba_CG5157-PA GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSIGAAKPTEN
D_erecta_CG5157-PA GKDATKAFKQAGHSSDAEKELKNYKIGEINSAAPIQVQPTSITAAKVTEN
D_suzukii_CG5157-PA GKDATKAFKQAGHSADAEKELKNYKIGEINSAAPIQIQPTSIAASKPAEN
D_eugracilis_CG5157-PA GKDATKAFKQAGHSSDAEKDLKKFKIGEINSAAPIQTQPTSNAATKPAEN
D_elegans_CG5157-PA GKDASKAFKQAGHSSDAEKDLKNFKIGEINSAAPIQIQPTSLAASKPTEN
****:*********:****:**::************ **** ::* : :
D_melanogaster_CG5157-PA TISEDPEPAKNSSSGFCCC
D_sechellia_CG5157-PA TISRRSRTREEELLRFCCC
D_simulans_CG5157-PA TISGDPEPAKKSSSGFCCC
D_yakuba_CG5157-PA TILADPEPAKKSSSGFCCC
D_erecta_CG5157-PA TISGDPEPAKKSSSGFCCC
D_suzukii_CG5157-PA TISEDPKPAEKSSSGFCCC
D_eugracilis_CG5157-PA TITEDPEPAKKSSSGFCCC
D_elegans_CG5157-PA TITGDPEPAKKSSSGFCCC
** ... ::. ****
>D_melanogaster_CG5157-PA ATGTCACAGTTGTACGAACTCTCGGAGGTGGCCCAGCAGAACGGCAAGAA TGGCAAACCCTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA AGTTCCTCGGCGAGCATCCTGGCGGCAGTGAAGCACTACTCGAATATGGC GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCATTCCTCCGACGC AGAAAAGGATCTAAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCAC CCATTCAAGTGCAGCCAACGTCCAATGGTGCAGCAAAGCCGACGGCAAAC ACAATATCCGAAGATCCCGAACCCGCGAAGAATAGCTCCTCCGGTTTCTG TTGCTGC >D_sechellia_CG5157-PA ATGTCACAGTTGTACGAAATCTCCGAGGTGGCCCAGCAGAACGGCAAGAA TGGCAAACCGTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA AGTTCCTTGGCGAGCATCCTGGCGGCGGCGAAGCACTGCTCGAATACGGC GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCACTCCTCCGATGC CGAAAAGGATCTGAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCGC CCATTCAAGTGCAGCCCACGTCCAACGGTGCAGCAAAGCCGGCGGCCCAC ACAATATCCCGGAGATCCCGAACCCGCGAAGAAGAGCTCCTCCGTTTCTG TTGCTGC >D_simulans_CG5157-PA ATGTCACAGTTGTACGATCTCTCCGAGGTGGCCCAGCAGAACGGCAAGAA TGGCAAGCCCTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA AGTTCCTGGGCGAGCATCCTGGCGGCGGCGAAGCACTGCTCGAATACGGC GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGCCACTCCTCCGATGC CGAAAAGGATCTGAAGAACTACAAAATCGGAGAAATCAACTCAGCTGCGC CCATTCAAGTGCAGCCCACGTCCAATGGTTCAGCAAAGCCGGCGGCCAAC ACAATATCCGGCGATCCCGAACCCGCGAAGAAGAGCTCCTCCGGTTTCTG TTGCTGC >D_yakuba_CG5157-PA ATGTCACAGTTGTACGAACTCTCCGAAGTGGCCCAGCAGAACGGCAAGAA TGGCAAACCTTGCTGGCTAATCATTAAGGGGAACGTCTACGATGTAACCA AGTTTCTGGGCGAACATCCTGGTGGCGGCGAAGCACTACTCGAATACGGC GGCAAGGATGCTACCAAGGCGTTCAAGCAAGCAGGCCACTCCTCCGATGC CGAAAAGGACCTGAAGAACTACAAAATTGGAGAAATTAACTCAGCTGCAC CCATTCAAGTCCAGCCCACGTCCATTGGTGCAGCAAAACCCACGGAAAAC ACAATTTTAGCAGATCCCGAACCCGCGAAGAAGAGCTCTTCAGGCTTCTG CTGCTGC >D_erecta_CG5157-PA ATGTCACAGTTGTACGAACTCTCCGAGGTGGAACAGCAGAACGGCAAGAA TGGCAAACCTTGCTGGCTGATCATCAAGGGGAACGTGTACGATGTAACCA AGTTCCTGGCCGAACATCCTGGCGGCGGCGATGTACTGCTGGAATACGGC GGCAAGGATGCTACCAAGGCCTTCAAGCAAGCAGGCCACTCGTCCGATGC CGAAAAGGAACTGAAGAACTACAAAATTGGAGAAATTAACTCAGCTGCAC CCATTCAGGTCCAGCCCACGTCCATTACTGCAGCGAAAGTCACGGAGAAC ACAATATCTGGAGATCCCGAACCCGCGAAGAAGAGCTCTTCCGGATTCTG CTGCTGC >D_suzukii_CG5157-PA ATGTCACAGTTGTACGAACTCTCCGAGGTGGCCGTGCAGAATGGCAAGAA CGGCAAACCCTGCTGGCTGATCATCAAGGGAAACGTCTACGATGTGACCA AGTTCCTCAGCGAACATCCTGGCGGTGGCGAAGTACTCCTCGAATATGGC GGCAAGGATGCCACCAAGGCCTTCAAGCAAGCGGGACACTCCGCCGATGC CGAAAAGGAACTAAAAAACTACAAAATCGGAGAAATTAACTCTGCTGCAC CCATTCAAATTCAGCCCACTTCCATTGCTGCATCGAAACCGGCGGAAAAC ACAATATCAGAAGATCCCAAGCCGGCGGAGAAAAGCTCTTCCGGCTTCTG CTGCTGC >D_eugracilis_CG5157-PA ATGTCACAATTGTACGAACTCTCTGAGGTGGCCCAGCAGAATGGCAAGAA TGGCAAACCTTGCTGGCTGATCATCAAGGGAAACGTCTACGATGTAACCA AGTTTCTGAGCGAACATCCAGGCGGTGGCGAAGTACTCCTCGAATACGCC GGCAAGGATGCCACCAAGGCCTTCAAGCAGGCAGGACACTCATCCGATGC CGAAAAGGATCTAAAGAAGTTCAAAATCGGAGAAATCAATTCAGCTGCAC CCATTCAAACGCAACCAACGTCTAATGCTGCCACAAAACCAGCGGAAAAC ACAATAACTGAAGATCCCGAACCCGCGAAGAAGAGCTCTTCCGGTTTCTG CTGCTGC >D_elegans_CG5157-PA ATGTCCCAGTTGTACGAAGTTTCCGAGGTGGCCCAGCAGAATGGCAAGAA TGGCAAACCCTGCTGGCTGATCATCAAGGGAAACGTATACGACGTGACCA AGTTCCTGAGCGAGCATCCTGGCGGTGGCGAAGCACTCCTCGAATACGGC GGCAAGGATGCCAGCAAGGCCTTCAAGCAGGCTGGACACTCCTCCGATGC CGAAAAGGATCTGAAGAACTTTAAAATCGGAGAAATAAATTCAGCGGCGC CCATTCAAATCCAGCCCACGTCCCTTGCTGCATCGAAGCCAACGGAAAAC ACAATAACCGGAGATCCGGAGCCCGCGAAGAAGAGCTCTTCCGGTTTCTG CTGCTGC
>D_melanogaster_CG5157-PA MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYG GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPTAN TISEDPEPAKNSSSGFCCC >D_sechellia_CG5157-PA MSQLYEISEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGAAKPAAH TISRRSRTREEELLRFCCC >D_simulans_CG5157-PA MSQLYDLSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSNGSAKPAAN TISGDPEPAKKSSSGFCCC >D_yakuba_CG5157-PA MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGGEALLEYG GKDATKAFKQAGHSSDAEKDLKNYKIGEINSAAPIQVQPTSIGAAKPTEN TILADPEPAKKSSSGFCCC >D_erecta_CG5157-PA MSQLYELSEVEQQNGKNGKPCWLIIKGNVYDVTKFLAEHPGGGDVLLEYG GKDATKAFKQAGHSSDAEKELKNYKIGEINSAAPIQVQPTSITAAKVTEN TISGDPEPAKKSSSGFCCC >D_suzukii_CG5157-PA MSQLYELSEVAVQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYG GKDATKAFKQAGHSADAEKELKNYKIGEINSAAPIQIQPTSIAASKPAEN TISEDPKPAEKSSSGFCCC >D_eugracilis_CG5157-PA MSQLYELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEVLLEYA GKDATKAFKQAGHSSDAEKDLKKFKIGEINSAAPIQTQPTSNAATKPAEN TITEDPEPAKKSSSGFCCC >D_elegans_CG5157-PA MSQLYEVSEVAQQNGKNGKPCWLIIKGNVYDVTKFLSEHPGGGEALLEYG GKDASKAFKQAGHSSDAEKDLKNFKIGEINSAAPIQIQPTSLAASKPTEN TITGDPEPAKKSSSGFCCC
#NEXUS
[ID: 2318246733]
begin taxa;
dimensions ntax=8;
taxlabels
D_melanogaster_CG5157-PA
D_sechellia_CG5157-PA
D_simulans_CG5157-PA
D_yakuba_CG5157-PA
D_erecta_CG5157-PA
D_suzukii_CG5157-PA
D_eugracilis_CG5157-PA
D_elegans_CG5157-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG5157-PA,
2 D_sechellia_CG5157-PA,
3 D_simulans_CG5157-PA,
4 D_yakuba_CG5157-PA,
5 D_erecta_CG5157-PA,
6 D_suzukii_CG5157-PA,
7 D_eugracilis_CG5157-PA,
8 D_elegans_CG5157-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05520213,((4:0.06224829,5:0.06653596)0.933:0.02465268,(6:0.1036816,(7:0.08759045,8:0.08779055)0.583:0.01663183)1.000:0.04918393)1.000:0.04523796,(2:0.1281976,3:0.0182044)0.866:0.01335871);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05520213,((4:0.06224829,5:0.06653596):0.02465268,(6:0.1036816,(7:0.08759045,8:0.08779055):0.01663183):0.04918393):0.04523796,(2:0.1281976,3:0.0182044):0.01335871);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1333.88 -1345.39
2 -1333.57 -1343.99
--------------------------------------
TOTAL -1333.71 -1344.92
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/166/CG5157-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.782904 0.008735 0.609100 0.966890 0.775981 1480.48 1490.74 1.000
r(A<->C){all} 0.072984 0.000483 0.033537 0.117809 0.070899 1158.01 1158.66 1.000
r(A<->G){all} 0.271650 0.002069 0.186489 0.364233 0.269257 640.36 745.49 1.000
r(A<->T){all} 0.148092 0.001407 0.077244 0.220917 0.145749 818.40 909.47 1.000
r(C<->G){all} 0.131101 0.000789 0.079258 0.186107 0.129670 614.63 825.78 1.001
r(C<->T){all} 0.323568 0.002656 0.226810 0.425021 0.320781 742.61 826.80 1.000
r(G<->T){all} 0.052605 0.000597 0.009429 0.101796 0.049546 1020.94 1029.90 1.001
pi(A){all} 0.290388 0.000488 0.246440 0.332570 0.290917 1191.03 1295.76 1.000
pi(C){all} 0.280306 0.000461 0.241257 0.324293 0.280062 874.68 1049.33 1.000
pi(G){all} 0.257499 0.000437 0.215769 0.296684 0.257256 1137.64 1162.26 1.000
pi(T){all} 0.171806 0.000323 0.135921 0.206246 0.171047 1130.54 1162.26 1.000
alpha{1,2} 0.275464 0.006078 0.153402 0.426597 0.261891 1501.00 1501.00 1.000
alpha{3} 1.914358 0.495246 0.816722 3.375295 1.781559 1363.06 1432.03 1.001
pinvar{all} 0.102394 0.005213 0.000047 0.242077 0.089959 1091.67 1256.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/166/CG5157-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 8 ls = 119
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 1 0 0 | Ser TCT 0 0 0 1 2 2 | Tyr TAT 1 0 0 0 0 1 | Cys TGT 1 1 1 0 0 0
TTC 3 3 3 2 3 3 | TCC 6 6 7 4 4 4 | TAC 3 4 4 4 4 3 | TGC 3 3 3 4 4 4
Leu TTA 0 0 0 1 0 0 | TCA 2 2 3 3 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 0 0 0 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 1 0 0 0 0 | Pro CCT 1 1 1 2 2 1 | His CAT 2 1 1 1 1 1 | Arg CGT 0 1 0 0 0 0
CTC 3 3 2 2 1 4 | CCC 4 2 5 5 4 4 | CAC 0 2 1 1 1 1 | CGC 0 1 0 0 0 0
CTA 2 0 0 2 0 1 | CCA 1 0 0 0 0 0 | Gln CAA 1 1 1 2 1 2 | CGA 0 1 0 0 0 0
CTG 1 3 4 2 5 1 | CCG 1 2 1 0 0 2 | CAG 5 5 5 4 5 3 | CGG 0 1 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 6 4 4 | Thr ACT 0 0 0 0 1 1 | Asn AAT 3 1 2 1 1 1 | Ser AGT 1 0 0 0 0 0
ATC 4 5 4 1 2 3 | ACC 2 3 2 2 2 2 | AAC 5 5 5 5 5 5 | AGC 1 0 1 1 1 2
ATA 1 1 1 0 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 1 3 3 5 | Arg AGA 0 1 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 2 1 1 2 2 0 | AAG 10 9 12 10 10 8 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 1 1 2 2 2 | Asp GAT 4 4 6 4 5 4 | Gly GGT 2 1 2 2 0 1
GTC 0 0 0 2 2 1 | GCC 3 5 5 2 3 5 | GAC 1 0 0 1 0 0 | GGC 8 9 10 9 8 7
GTA 1 1 1 1 2 1 | GCA 7 4 3 6 3 2 | Glu GAA 7 7 5 9 8 9 | GGA 1 1 1 1 3 3
GTG 3 3 3 1 2 3 | GCG 1 2 3 2 2 3 | GAG 2 3 2 0 2 2 | GGG 1 1 1 1 1 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------
Phe TTT 1 1 | Ser TCT 3 1 | Tyr TAT 0 0 | Cys TGT 0 0
TTC 3 3 | TCC 2 6 | TAC 3 3 | TGC 4 4
Leu TTA 0 0 | TCA 3 1 | *** TAA 0 0 | *** TGA 0 0
TTG 1 1 | TCG 0 1 | TAG 0 0 | Trp TGG 1 1
----------------------------------------------------------------------
Leu CTT 0 1 | Pro CCT 1 1 | His CAT 1 1 | Arg CGT 0 0
CTC 3 2 | CCC 3 4 | CAC 1 1 | CGC 0 0
CTA 1 0 | CCA 3 1 | Gln CAA 3 1 | CGA 0 0
CTG 2 3 | CCG 0 1 | CAG 3 5 | CGG 0 0
----------------------------------------------------------------------
Ile ATT 1 1 | Thr ACT 1 0 | Asn AAT 4 3 | Ser AGT 0 0
ATC 4 4 | ACC 2 2 | AAC 2 3 | AGC 2 3
ATA 1 2 | ACA 2 1 | Lys AAA 3 2 | Arg AGA 0 0
Met ATG 1 1 | ACG 2 2 | AAG 11 11 | AGG 0 0
----------------------------------------------------------------------
Val GTT 0 1 | Ala GCT 2 2 | Asp GAT 5 4 | Gly GGT 2 2
GTC 1 0 | GCC 6 4 | GAC 0 1 | GGC 5 6
GTA 2 1 | GCA 2 2 | Glu GAA 9 6 | GGA 3 4
GTG 1 2 | GCG 2 3 | GAG 1 3 | GGG 0 0
----------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG5157-PA
position 1: T:0.18487 C:0.17647 A:0.28571 G:0.35294
position 2: T:0.17647 C:0.27731 A:0.38655 G:0.15966
position 3: T:0.14286 C:0.38655 A:0.21849 G:0.25210
Average T:0.16807 C:0.28011 A:0.29692 G:0.25490
#2: D_sechellia_CG5157-PA
position 1: T:0.17647 C:0.21008 A:0.26050 G:0.35294
position 2: T:0.19328 C:0.25210 A:0.36975 G:0.18487
position 3: T:0.10924 C:0.42857 A:0.18487 G:0.27731
Average T:0.15966 C:0.29692 A:0.27171 G:0.27171
#3: D_simulans_CG5157-PA
position 1: T:0.19328 C:0.17647 A:0.26891 G:0.36134
position 2: T:0.17647 C:0.27731 A:0.37815 G:0.16807
position 3: T:0.12605 C:0.43697 A:0.14286 G:0.29412
Average T:0.16527 C:0.29692 A:0.26331 G:0.27451
#4: D_yakuba_CG5157-PA
position 1: T:0.18487 C:0.17647 A:0.27731 G:0.36134
position 2: T:0.19328 C:0.26891 A:0.37815 G:0.15966
position 3: T:0.16807 C:0.37815 A:0.24370 G:0.21008
Average T:0.18207 C:0.27451 A:0.29972 G:0.24370
#5: D_erecta_CG5157-PA
position 1: T:0.18487 C:0.16807 A:0.28571 G:0.36134
position 2: T:0.20168 C:0.26050 A:0.38655 G:0.15126
position 3: T:0.15126 C:0.36975 A:0.20168 G:0.27731
Average T:0.17927 C:0.26611 A:0.29132 G:0.26331
#6: D_suzukii_CG5157-PA
position 1: T:0.18487 C:0.16807 A:0.28571 G:0.36134
position 2: T:0.20168 C:0.26891 A:0.37815 G:0.15126
position 3: T:0.15126 C:0.40336 A:0.22689 G:0.21849
Average T:0.17927 C:0.28011 A:0.29692 G:0.24370
#7: D_eugracilis_CG5157-PA
position 1: T:0.17647 C:0.17647 A:0.30252 G:0.34454
position 2: T:0.18487 C:0.28571 A:0.38655 G:0.14286
position 3: T:0.17647 C:0.34454 A:0.26891 G:0.21008
Average T:0.17927 C:0.26891 A:0.31933 G:0.23249
#8: D_elegans_CG5157-PA
position 1: T:0.18487 C:0.17647 A:0.29412 G:0.34454
position 2: T:0.19328 C:0.26891 A:0.36975 G:0.16807
position 3: T:0.15126 C:0.38655 A:0.17647 G:0.28571
Average T:0.17647 C:0.27731 A:0.28011 G:0.26611
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 3 | Ser S TCT 9 | Tyr Y TAT 2 | Cys C TGT 3
TTC 23 | TCC 39 | TAC 28 | TGC 29
Leu L TTA 1 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 8 | TCG 4 | TAG 0 | Trp W TGG 8
------------------------------------------------------------------------------
Leu L CTT 2 | Pro P CCT 10 | His H CAT 9 | Arg R CGT 1
CTC 20 | CCC 31 | CAC 8 | CGC 1
CTA 6 | CCA 5 | Gln Q CAA 12 | CGA 1
CTG 21 | CCG 7 | CAG 35 | CGG 1
------------------------------------------------------------------------------
Ile I ATT 19 | Thr T ACT 3 | Asn N AAT 16 | Ser S AGT 1
ATC 27 | ACC 17 | AAC 35 | AGC 11
ATA 8 | ACA 9 | Lys K AAA 21 | Arg R AGA 1
Met M ATG 8 | ACG 12 | AAG 81 | AGG 0
------------------------------------------------------------------------------
Val V GTT 1 | Ala A GCT 13 | Asp D GAT 36 | Gly G GGT 12
GTC 6 | GCC 33 | GAC 3 | GGC 62
GTA 10 | GCA 29 | Glu E GAA 60 | GGA 17
GTG 18 | GCG 18 | GAG 15 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18382 C:0.17857 A:0.28256 G:0.35504
position 2: T:0.19013 C:0.26996 A:0.37920 G:0.16071
position 3: T:0.14706 C:0.39181 A:0.20798 G:0.25315
Average T:0.17367 C:0.28011 A:0.28992 G:0.25630
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG5157-PA
D_sechellia_CG5157-PA 0.4173 (0.1005 0.2408)
D_simulans_CG5157-PA 0.1328 (0.0242 0.1819) 0.8805 (0.0925 0.1050)
D_yakuba_CG5157-PA 0.0460 (0.0241 0.5253) 0.2148 (0.1092 0.5086) 0.0716 (0.0299 0.4179)
D_erecta_CG5157-PA 0.1205 (0.0550 0.4562) 0.3666 (0.1396 0.3808) 0.1886 (0.0571 0.3029) 0.1923 (0.0453 0.2356)
D_suzukii_CG5157-PA 0.1295 (0.0627 0.4842) 0.2301 (0.1326 0.5762) 0.1338 (0.0669 0.5001) 0.1032 (0.0530 0.5135) 0.1314 (0.0629 0.4786)
D_eugracilis_CG5157-PA 0.1169 (0.0528 0.4517) 0.2592 (0.1369 0.5282) 0.1343 (0.0569 0.4238) 0.1092 (0.0549 0.5032) 0.1575 (0.0715 0.4539) 0.1099 (0.0509 0.4629)
D_elegans_CG5157-PA 0.1027 (0.0548 0.5333) 0.2865 (0.1347 0.4702) 0.1568 (0.0569 0.3630) 0.0641 (0.0426 0.6641) 0.1192 (0.0628 0.5269) 0.1229 (0.0528 0.4299) 0.0975 (0.0431 0.4420)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
lnL(ntime: 13 np: 15): -1294.026152 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..6 12..13 13..7 13..8 9..14 14..2 14..3
0.117534 0.099127 0.045924 0.132644 0.153410 0.110100 0.225354 0.035172 0.203292 0.175992 0.028442 0.281679 0.033476 1.733510 0.158527
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.64215
(1: 0.117534, ((4: 0.132644, 5: 0.153410): 0.045924, (6: 0.225354, (7: 0.203292, 8: 0.175992): 0.035172): 0.110100): 0.099127, (2: 0.281679, 3: 0.033476): 0.028442);
(D_melanogaster_CG5157-PA: 0.117534, ((D_yakuba_CG5157-PA: 0.132644, D_erecta_CG5157-PA: 0.153410): 0.045924, (D_suzukii_CG5157-PA: 0.225354, (D_eugracilis_CG5157-PA: 0.203292, D_elegans_CG5157-PA: 0.175992): 0.035172): 0.110100): 0.099127, (D_sechellia_CG5157-PA: 0.281679, D_simulans_CG5157-PA: 0.033476): 0.028442);
Detailed output identifying parameters
kappa (ts/tv) = 1.73351
omega (dN/dS) = 0.15853
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.118 277.7 79.3 0.1585 0.0180 0.1134 5.0 9.0
9..10 0.099 277.7 79.3 0.1585 0.0152 0.0957 4.2 7.6
10..11 0.046 277.7 79.3 0.1585 0.0070 0.0443 2.0 3.5
11..4 0.133 277.7 79.3 0.1585 0.0203 0.1280 5.6 10.1
11..5 0.153 277.7 79.3 0.1585 0.0235 0.1481 6.5 11.7
10..12 0.110 277.7 79.3 0.1585 0.0168 0.1063 4.7 8.4
12..6 0.225 277.7 79.3 0.1585 0.0345 0.2175 9.6 17.2
12..13 0.035 277.7 79.3 0.1585 0.0054 0.0339 1.5 2.7
13..7 0.203 277.7 79.3 0.1585 0.0311 0.1962 8.6 15.6
13..8 0.176 277.7 79.3 0.1585 0.0269 0.1698 7.5 13.5
9..14 0.028 277.7 79.3 0.1585 0.0044 0.0274 1.2 2.2
14..2 0.282 277.7 79.3 0.1585 0.0431 0.2718 12.0 21.6
14..3 0.033 277.7 79.3 0.1585 0.0051 0.0323 1.4 2.6
tree length for dN: 0.2512
tree length for dS: 1.5848
Time used: 0:04
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
check convergence..
lnL(ntime: 13 np: 16): -1278.486734 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..6 12..13 13..7 13..8 9..14 14..2 14..3
0.122374 0.101002 0.052591 0.140023 0.158298 0.112484 0.242503 0.034676 0.209572 0.192898 0.026798 0.299922 0.035891 1.822323 0.807965 0.053421
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.72903
(1: 0.122374, ((4: 0.140023, 5: 0.158298): 0.052591, (6: 0.242503, (7: 0.209572, 8: 0.192898): 0.034676): 0.112484): 0.101002, (2: 0.299922, 3: 0.035891): 0.026798);
(D_melanogaster_CG5157-PA: 0.122374, ((D_yakuba_CG5157-PA: 0.140023, D_erecta_CG5157-PA: 0.158298): 0.052591, (D_suzukii_CG5157-PA: 0.242503, (D_eugracilis_CG5157-PA: 0.209572, D_elegans_CG5157-PA: 0.192898): 0.034676): 0.112484): 0.101002, (D_sechellia_CG5157-PA: 0.299922, D_simulans_CG5157-PA: 0.035891): 0.026798);
Detailed output identifying parameters
kappa (ts/tv) = 1.82232
dN/dS (w) for site classes (K=2)
p: 0.80796 0.19204
w: 0.05342 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.122 277.0 80.0 0.2352 0.0236 0.1003 6.5 8.0
9..10 0.101 277.0 80.0 0.2352 0.0195 0.0828 5.4 6.6
10..11 0.053 277.0 80.0 0.2352 0.0101 0.0431 2.8 3.4
11..4 0.140 277.0 80.0 0.2352 0.0270 0.1148 7.5 9.2
11..5 0.158 277.0 80.0 0.2352 0.0305 0.1298 8.5 10.4
10..12 0.112 277.0 80.0 0.2352 0.0217 0.0922 6.0 7.4
12..6 0.243 277.0 80.0 0.2352 0.0468 0.1989 13.0 15.9
12..13 0.035 277.0 80.0 0.2352 0.0067 0.0284 1.9 2.3
13..7 0.210 277.0 80.0 0.2352 0.0404 0.1718 11.2 13.7
13..8 0.193 277.0 80.0 0.2352 0.0372 0.1582 10.3 12.6
9..14 0.027 277.0 80.0 0.2352 0.0052 0.0220 1.4 1.8
14..2 0.300 277.0 80.0 0.2352 0.0578 0.2459 16.0 19.7
14..3 0.036 277.0 80.0 0.2352 0.0069 0.0294 1.9 2.4
Time used: 0:10
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
lnL(ntime: 13 np: 18): -1278.486734 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..6 12..13 13..7 13..8 9..14 14..2 14..3
0.122374 0.101002 0.052591 0.140024 0.158298 0.112484 0.242503 0.034676 0.209572 0.192898 0.026798 0.299922 0.035891 1.822324 0.807965 0.139373 0.053421 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.72903
(1: 0.122374, ((4: 0.140024, 5: 0.158298): 0.052591, (6: 0.242503, (7: 0.209572, 8: 0.192898): 0.034676): 0.112484): 0.101002, (2: 0.299922, 3: 0.035891): 0.026798);
(D_melanogaster_CG5157-PA: 0.122374, ((D_yakuba_CG5157-PA: 0.140024, D_erecta_CG5157-PA: 0.158298): 0.052591, (D_suzukii_CG5157-PA: 0.242503, (D_eugracilis_CG5157-PA: 0.209572, D_elegans_CG5157-PA: 0.192898): 0.034676): 0.112484): 0.101002, (D_sechellia_CG5157-PA: 0.299922, D_simulans_CG5157-PA: 0.035891): 0.026798);
Detailed output identifying parameters
kappa (ts/tv) = 1.82232
dN/dS (w) for site classes (K=3)
p: 0.80796 0.13937 0.05266
w: 0.05342 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.122 277.0 80.0 0.2352 0.0236 0.1003 6.5 8.0
9..10 0.101 277.0 80.0 0.2352 0.0195 0.0828 5.4 6.6
10..11 0.053 277.0 80.0 0.2352 0.0101 0.0431 2.8 3.4
11..4 0.140 277.0 80.0 0.2352 0.0270 0.1148 7.5 9.2
11..5 0.158 277.0 80.0 0.2352 0.0305 0.1298 8.5 10.4
10..12 0.112 277.0 80.0 0.2352 0.0217 0.0922 6.0 7.4
12..6 0.243 277.0 80.0 0.2352 0.0468 0.1989 13.0 15.9
12..13 0.035 277.0 80.0 0.2352 0.0067 0.0284 1.9 2.3
13..7 0.210 277.0 80.0 0.2352 0.0404 0.1718 11.2 13.7
13..8 0.193 277.0 80.0 0.2352 0.0372 0.1582 10.3 12.6
9..14 0.027 277.0 80.0 0.2352 0.0052 0.0220 1.4 1.8
14..2 0.300 277.0 80.0 0.2352 0.0578 0.2459 16.0 19.7
14..3 0.036 277.0 80.0 0.2352 0.0069 0.0294 1.9 2.4
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5157-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.997 0.003 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.654 0.131 0.057 0.035 0.026 0.022 0.020 0.019 0.018 0.017
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.299
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.010 0.147 0.482
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.010 0.036 0.002
sum of density on p0-p1 = 1.000000
Time used: 0:28
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
check convergence..
lnL(ntime: 13 np: 19): -1276.364701 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..6 12..13 13..7 13..8 9..14 14..2 14..3
0.121057 0.101236 0.049152 0.136733 0.156637 0.112407 0.236811 0.033901 0.207939 0.186562 0.027562 0.295364 0.034681 1.730166 0.325917 0.400810 0.028348 0.028349 0.579945
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.70004
(1: 0.121057, ((4: 0.136733, 5: 0.156637): 0.049152, (6: 0.236811, (7: 0.207939, 8: 0.186562): 0.033901): 0.112407): 0.101236, (2: 0.295364, 3: 0.034681): 0.027562);
(D_melanogaster_CG5157-PA: 0.121057, ((D_yakuba_CG5157-PA: 0.136733, D_erecta_CG5157-PA: 0.156637): 0.049152, (D_suzukii_CG5157-PA: 0.236811, (D_eugracilis_CG5157-PA: 0.207939, D_elegans_CG5157-PA: 0.186562): 0.033901): 0.112407): 0.101236, (D_sechellia_CG5157-PA: 0.295364, D_simulans_CG5157-PA: 0.034681): 0.027562);
Detailed output identifying parameters
kappa (ts/tv) = 1.73017
dN/dS (w) for site classes (K=3)
p: 0.32592 0.40081 0.27327
w: 0.02835 0.02835 0.57995
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.121 277.7 79.3 0.1791 0.0200 0.1117 5.6 8.9
9..10 0.101 277.7 79.3 0.1791 0.0167 0.0934 4.6 7.4
10..11 0.049 277.7 79.3 0.1791 0.0081 0.0453 2.3 3.6
11..4 0.137 277.7 79.3 0.1791 0.0226 0.1261 6.3 10.0
11..5 0.157 277.7 79.3 0.1791 0.0259 0.1445 7.2 11.5
10..12 0.112 277.7 79.3 0.1791 0.0186 0.1037 5.2 8.2
12..6 0.237 277.7 79.3 0.1791 0.0391 0.2185 10.9 17.3
12..13 0.034 277.7 79.3 0.1791 0.0056 0.0313 1.6 2.5
13..7 0.208 277.7 79.3 0.1791 0.0344 0.1918 9.5 15.2
13..8 0.187 277.7 79.3 0.1791 0.0308 0.1721 8.6 13.6
9..14 0.028 277.7 79.3 0.1791 0.0046 0.0254 1.3 2.0
14..2 0.295 277.7 79.3 0.1791 0.0488 0.2725 13.6 21.6
14..3 0.035 277.7 79.3 0.1791 0.0057 0.0320 1.6 2.5
Naive Empirical Bayes (NEB) analysis
Time used: 0:48
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
lnL(ntime: 13 np: 16): -1276.451307 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..6 12..13 13..7 13..8 9..14 14..2 14..3
0.121301 0.101764 0.049131 0.137168 0.157200 0.112695 0.237243 0.034009 0.208508 0.187112 0.027247 0.295922 0.034854 1.728272 0.207211 0.928859
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.70415
(1: 0.121301, ((4: 0.137168, 5: 0.157200): 0.049131, (6: 0.237243, (7: 0.208508, 8: 0.187112): 0.034009): 0.112695): 0.101764, (2: 0.295922, 3: 0.034854): 0.027247);
(D_melanogaster_CG5157-PA: 0.121301, ((D_yakuba_CG5157-PA: 0.137168, D_erecta_CG5157-PA: 0.157200): 0.049131, (D_suzukii_CG5157-PA: 0.237243, (D_eugracilis_CG5157-PA: 0.208508, D_elegans_CG5157-PA: 0.187112): 0.034009): 0.112695): 0.101764, (D_sechellia_CG5157-PA: 0.295922, D_simulans_CG5157-PA: 0.034854): 0.027247);
Detailed output identifying parameters
kappa (ts/tv) = 1.72827
Parameters in M7 (beta):
p = 0.20721 q = 0.92886
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00012 0.00138 0.00701 0.02357 0.06193 0.13802 0.27286 0.49087 0.81177
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.121 277.8 79.2 0.1808 0.0202 0.1115 5.6 8.8
9..10 0.102 277.8 79.2 0.1808 0.0169 0.0936 4.7 7.4
10..11 0.049 277.8 79.2 0.1808 0.0082 0.0452 2.3 3.6
11..4 0.137 277.8 79.2 0.1808 0.0228 0.1261 6.3 10.0
11..5 0.157 277.8 79.2 0.1808 0.0261 0.1445 7.3 11.5
10..12 0.113 277.8 79.2 0.1808 0.0187 0.1036 5.2 8.2
12..6 0.237 277.8 79.2 0.1808 0.0394 0.2181 11.0 17.3
12..13 0.034 277.8 79.2 0.1808 0.0057 0.0313 1.6 2.5
13..7 0.209 277.8 79.2 0.1808 0.0346 0.1917 9.6 15.2
13..8 0.187 277.8 79.2 0.1808 0.0311 0.1720 8.6 13.6
9..14 0.027 277.8 79.2 0.1808 0.0045 0.0250 1.3 2.0
14..2 0.296 277.8 79.2 0.1808 0.0492 0.2720 13.7 21.6
14..3 0.035 277.8 79.2 0.1808 0.0058 0.0320 1.6 2.5
Time used: 1:40
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), (6, (7, 8))), (2, 3)); MP score: 150
lnL(ntime: 13 np: 18): -1276.451313 +0.000000
9..1 9..10 10..11 11..4 11..5 10..12 12..6 12..13 13..7 13..8 9..14 14..2 14..3
0.121301 0.101764 0.049131 0.137168 0.157200 0.112695 0.237243 0.034009 0.208508 0.187112 0.027247 0.295922 0.034854 1.728273 0.999990 0.207216 0.928926 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.70415
(1: 0.121301, ((4: 0.137168, 5: 0.157200): 0.049131, (6: 0.237243, (7: 0.208508, 8: 0.187112): 0.034009): 0.112695): 0.101764, (2: 0.295922, 3: 0.034854): 0.027247);
(D_melanogaster_CG5157-PA: 0.121301, ((D_yakuba_CG5157-PA: 0.137168, D_erecta_CG5157-PA: 0.157200): 0.049131, (D_suzukii_CG5157-PA: 0.237243, (D_eugracilis_CG5157-PA: 0.208508, D_elegans_CG5157-PA: 0.187112): 0.034009): 0.112695): 0.101764, (D_sechellia_CG5157-PA: 0.295922, D_simulans_CG5157-PA: 0.034854): 0.027247);
Detailed output identifying parameters
kappa (ts/tv) = 1.72827
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.20722 q = 0.92893
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00012 0.00138 0.00701 0.02357 0.06193 0.13802 0.27285 0.49085 0.81174 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
9..1 0.121 277.8 79.2 0.1808 0.0202 0.1115 5.6 8.8
9..10 0.102 277.8 79.2 0.1808 0.0169 0.0936 4.7 7.4
10..11 0.049 277.8 79.2 0.1808 0.0082 0.0452 2.3 3.6
11..4 0.137 277.8 79.2 0.1808 0.0228 0.1261 6.3 10.0
11..5 0.157 277.8 79.2 0.1808 0.0261 0.1445 7.3 11.5
10..12 0.113 277.8 79.2 0.1808 0.0187 0.1036 5.2 8.2
12..6 0.237 277.8 79.2 0.1808 0.0394 0.2181 11.0 17.3
12..13 0.034 277.8 79.2 0.1808 0.0057 0.0313 1.6 2.5
13..7 0.209 277.8 79.2 0.1808 0.0346 0.1917 9.6 15.2
13..8 0.187 277.8 79.2 0.1808 0.0311 0.1720 8.6 13.6
9..14 0.027 277.8 79.2 0.1808 0.0045 0.0250 1.3 2.0
14..2 0.296 277.8 79.2 0.1808 0.0492 0.2720 13.7 21.6
14..3 0.035 277.8 79.2 0.1808 0.0058 0.0320 1.6 2.5
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG5157-PA)
Pr(w>1) post mean +- SE for w
93 G 0.524 1.208 +- 0.649
104 E 0.746 1.523 +- 0.821
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.022 0.978
p : 0.658 0.337 0.005 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.005 0.132 0.202 0.146 0.091 0.076 0.093 0.119 0.138
ws: 0.823 0.109 0.029 0.012 0.007 0.005 0.004 0.004 0.003 0.003
Time used: 3:13
Model 1: NearlyNeutral -1278.486734 Model 2: PositiveSelection -1278.486734 Model 0: one-ratio -1294.026152 Model 3: discrete -1276.364701 Model 7: beta -1276.451307 Model 8: beta&w>1 -1276.451313 Model 0 vs 1 31.078835999999683 Model 2 vs 1 0.0 Model 8 vs 7 1.1999999969702912E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
