--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 02 14:35:40 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/14/Arl4-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.67 -544.69
2 -533.85 -547.86
--------------------------------------
TOTAL -533.76 -547.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.338529 0.022736 0.084209 0.628346 0.312298 714.73 903.46 1.000
r(A<->C){all} 0.096544 0.005122 0.000118 0.235020 0.079067 435.09 480.13 1.000
r(A<->G){all} 0.431210 0.020094 0.168960 0.700296 0.429661 187.62 303.30 1.004
r(A<->T){all} 0.079932 0.003606 0.000083 0.193898 0.066785 443.47 545.21 1.000
r(C<->G){all} 0.056981 0.003307 0.000032 0.173778 0.039717 432.18 511.45 1.002
r(C<->T){all} 0.211053 0.013148 0.011808 0.433601 0.194551 169.46 266.28 1.011
r(G<->T){all} 0.124280 0.006773 0.001521 0.282328 0.108516 313.28 397.50 1.000
pi(A){all} 0.345884 0.000675 0.293378 0.395541 0.345833 1244.96 1269.36 1.000
pi(C){all} 0.149426 0.000409 0.111153 0.188664 0.148740 1047.02 1156.91 1.000
pi(G){all} 0.236982 0.000531 0.190244 0.280612 0.236830 1163.39 1228.74 1.000
pi(T){all} 0.267708 0.000609 0.220603 0.316854 0.267350 1126.91 1253.70 1.000
alpha{1,2} 0.068074 0.007552 0.000133 0.173050 0.051494 892.00 1018.85 1.001
alpha{3} 1.339010 0.493600 0.320151 2.782082 1.214454 1141.69 1314.97 1.000
pinvar{all} 0.714722 0.014450 0.483432 0.876275 0.740931 696.61 772.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -494.189903
Model 2: PositiveSelection -494.189804
Model 0: one-ratio -494.189804
Model 3: discrete -494.189804
Model 7: beta -494.191101
Model 8: beta&w>1 -494.191199
Model 0 vs 1 1.9800000006853224E-4
Model 2 vs 1 1.9800000006853224E-4
Model 8 vs 7 1.9599999995989492E-4
>C1
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C2
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C3
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C4
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C5
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=100
C1 MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
C2 MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
C3 MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
C4 MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
C5 MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
**************************************************
C1 NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
C2 NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
C3 NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
C4 NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
C5 NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
*********************************************.****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
ins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2000]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [2000]--->[2000]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.249 Mb, Max= 30.423 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C2
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C3
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C4
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C5
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
FORMAT of file /tmp/tmp121887551155636606aln Not Supported[FATAL:T-COFFEE]
>C1
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C2
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C3
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C4
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C5
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:100 S:100 BS:100
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 99.00 C1 C2 99.00
TOP 1 0 99.00 C2 C1 99.00
BOT 0 2 99.00 C1 C3 99.00
TOP 2 0 99.00 C3 C1 99.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 99.00 C2 C4 99.00
TOP 3 1 99.00 C4 C2 99.00
BOT 1 4 99.00 C2 C5 99.00
TOP 4 1 99.00 C5 C2 99.00
BOT 2 3 99.00 C3 C4 99.00
TOP 3 2 99.00 C4 C3 99.00
BOT 2 4 99.00 C3 C5 99.00
TOP 4 2 99.00 C5 C3 99.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
AVG 0 C1 * 99.50
AVG 1 C2 * 99.25
AVG 2 C3 * 99.25
AVG 3 C4 * 99.50
AVG 4 C5 * 99.50
TOT TOT * 99.40
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGTGCTACAATGGTAAAACCGTTGGTAAAAAATGGAAATATTTTGGA
C2 ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA
C3 ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA
C4 ATGGGGGCTACGATGGTAAAACCTTTGGTAAAGAATGGAAATATTTTGGA
C5 ATGGGGGCTACAATGGTAAAACCTTTAGTAAAGAATGGAAATATTTTGGA
***** *****.*********** **.*****.*****************
C1 TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
C2 TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
C3 TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
C4 TGCACTGCCATCACAGGCAACTCTGCATGTAGTTATGTTAGGTTTGGATT
C5 TGCTTTGCCATCGCAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
***: *******.***********.*************************
C1 CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
C2 CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
C3 CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
C4 CTGCGGGAAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA
C5 CTGCGGGTAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA
*******:***********:***********************.******
C1 AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACCCT
C2 AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT
C3 AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT
C4 AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT
C5 AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT
** *********************** ** *****************.**
C1 TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
C2 TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG
C3 TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG
C4 TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
C5 TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
************************************************.*
C1 AAAAATTGAGACCACTTTGGAGAAGTTATACACGAAAGAATGGAAGAAGC
C2 AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC
C3 AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC
C4 AGAAATTAAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
C5 AAAAATTGAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
*.*****.************.***************.*************
>C1
ATGGGTGCTACAATGGTAAAACCGTTGGTAAAAAATGGAAATATTTTGGA
TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACCCT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
AAAAATTGAGACCACTTTGGAGAAGTTATACACGAAAGAATGGAAGAAGC
>C2
ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA
TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG
AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC
>C3
ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA
TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG
AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC
>C4
ATGGGGGCTACGATGGTAAAACCTTTGGTAAAGAATGGAAATATTTTGGA
TGCACTGCCATCACAGGCAACTCTGCATGTAGTTATGTTAGGTTTGGATT
CTGCGGGAAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA
AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
AGAAATTAAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
>C5
ATGGGGGCTACAATGGTAAAACCTTTAGTAAAGAATGGAAATATTTTGGA
TGCTTTGCCATCGCAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
CTGCGGGTAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA
AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
AAAAATTGAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
>C1
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C2
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C3
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C4
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C5
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 300 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478097162
Setting output file names to "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1029836742
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1333697368
Seed = 1967666340
Swapseed = 1478097162
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 17 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -717.921241 -- -25.624409
Chain 2 -- -717.921241 -- -25.624409
Chain 3 -- -694.892957 -- -25.624409
Chain 4 -- -719.833681 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -717.921241 -- -25.624409
Chain 2 -- -705.490392 -- -25.624409
Chain 3 -- -715.359656 -- -25.624409
Chain 4 -- -715.359656 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-717.921] (-717.921) (-694.893) (-719.834) * [-717.921] (-705.490) (-715.360) (-715.360)
500 -- [-541.934] (-546.956) (-540.865) (-550.020) * (-545.247) (-536.720) [-540.758] (-552.290) -- 0:00:00
1000 -- [-542.115] (-535.190) (-535.439) (-541.822) * [-539.669] (-537.411) (-538.126) (-542.221) -- 0:00:00
1500 -- (-542.814) (-540.227) [-535.186] (-538.637) * (-540.875) (-538.851) [-538.223] (-543.275) -- 0:00:00
2000 -- (-545.500) [-537.733] (-538.447) (-540.748) * (-542.289) [-537.232] (-537.859) (-537.999) -- 0:00:00
2500 -- [-538.815] (-536.248) (-540.918) (-535.614) * (-542.974) (-537.785) (-539.660) [-537.185] -- 0:00:00
3000 -- (-542.741) (-538.223) (-539.767) [-535.723] * (-538.630) [-538.561] (-538.500) (-542.431) -- 0:00:00
3500 -- (-539.089) (-542.249) [-533.615] (-535.750) * (-543.468) [-540.560] (-536.273) (-540.237) -- 0:00:00
4000 -- (-538.226) (-546.359) (-535.705) [-539.482] * (-546.748) (-540.651) (-538.027) [-540.473] -- 0:00:00
4500 -- [-539.401] (-534.537) (-542.938) (-535.055) * (-544.329) [-535.593] (-546.644) (-539.149) -- 0:03:41
5000 -- (-545.066) (-538.449) (-539.664) [-538.400] * [-540.436] (-538.867) (-540.957) (-545.002) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-546.784) [-534.447] (-546.433) (-533.755) * [-537.440] (-540.766) (-538.183) (-543.878) -- 0:03:00
6000 -- (-542.428) [-537.117] (-542.339) (-539.623) * (-549.092) (-538.951) [-538.452] (-536.737) -- 0:02:45
6500 -- [-541.178] (-540.654) (-542.164) (-534.620) * (-541.500) [-540.263] (-536.089) (-543.910) -- 0:02:32
7000 -- (-543.867) (-542.594) (-533.168) [-535.442] * (-541.290) [-539.858] (-536.402) (-539.021) -- 0:02:21
7500 -- (-548.672) (-539.580) [-537.499] (-539.676) * (-542.178) (-544.412) (-538.079) [-542.106] -- 0:02:12
8000 -- (-540.755) (-537.823) (-545.190) [-539.891] * [-542.254] (-536.527) (-539.406) (-539.274) -- 0:02:04
8500 -- (-544.119) [-537.464] (-546.416) (-538.654) * (-538.166) (-535.624) (-536.627) [-541.424] -- 0:01:56
9000 -- (-542.283) [-538.634] (-536.721) (-539.452) * (-534.975) [-535.721] (-537.706) (-537.462) -- 0:01:50
9500 -- (-539.629) [-534.747] (-546.041) (-547.930) * (-540.516) (-536.468) [-533.849] (-541.479) -- 0:01:44
10000 -- (-543.091) [-533.500] (-538.756) (-543.206) * (-537.256) (-536.968) (-538.872) [-536.576] -- 0:01:39
Average standard deviation of split frequencies: 0.022097
10500 -- (-540.334) (-535.964) [-537.460] (-543.441) * [-536.652] (-538.660) (-542.768) (-535.034) -- 0:01:34
11000 -- (-545.656) [-532.991] (-543.057) (-537.159) * (-539.909) (-535.052) [-532.672] (-534.542) -- 0:01:29
11500 -- (-545.934) [-535.645] (-542.213) (-540.383) * (-532.160) [-536.153] (-536.591) (-540.974) -- 0:01:25
12000 -- (-540.465) (-537.331) [-536.637] (-541.176) * (-535.423) [-541.146] (-541.433) (-539.611) -- 0:01:22
12500 -- (-537.610) [-536.817] (-539.267) (-540.227) * (-533.869) [-542.120] (-537.987) (-540.408) -- 0:01:19
13000 -- (-542.044) (-538.324) [-536.287] (-540.518) * (-539.598) [-534.246] (-542.891) (-539.037) -- 0:02:31
13500 -- (-550.791) (-532.377) (-537.780) [-534.886] * (-541.562) [-536.837] (-533.588) (-532.156) -- 0:02:26
14000 -- [-541.515] (-534.393) (-541.931) (-538.902) * (-535.859) (-535.517) (-539.218) [-535.717] -- 0:02:20
14500 -- [-540.593] (-534.298) (-547.470) (-547.662) * (-539.367) [-535.021] (-543.565) (-539.135) -- 0:02:15
15000 -- (-538.085) (-539.098) (-543.943) [-536.225] * [-535.699] (-533.069) (-540.551) (-546.034) -- 0:02:11
Average standard deviation of split frequencies: 0.029463
15500 -- (-540.560) (-536.022) [-538.853] (-540.519) * (-532.379) [-532.555] (-539.054) (-537.856) -- 0:02:07
16000 -- (-541.807) [-533.696] (-539.798) (-544.385) * (-540.958) [-537.654] (-537.948) (-536.401) -- 0:02:03
16500 -- [-542.068] (-537.823) (-541.938) (-537.368) * [-539.901] (-534.981) (-543.824) (-532.849) -- 0:01:59
17000 -- (-538.539) (-534.311) [-539.122] (-540.289) * (-541.420) [-537.068] (-544.460) (-535.322) -- 0:01:55
17500 -- (-535.558) [-532.283] (-535.483) (-540.303) * (-549.216) (-541.542) (-536.928) [-533.778] -- 0:01:52
18000 -- (-540.378) [-537.957] (-548.611) (-538.686) * (-544.029) [-534.465] (-546.113) (-541.278) -- 0:01:49
18500 -- [-534.230] (-537.377) (-543.384) (-536.777) * (-534.193) (-540.701) [-535.626] (-537.793) -- 0:01:46
19000 -- [-539.057] (-541.027) (-541.265) (-540.222) * (-538.478) (-544.032) (-544.094) [-537.304] -- 0:01:43
19500 -- (-535.678) (-539.537) (-541.452) [-535.386] * [-536.314] (-536.254) (-536.264) (-540.275) -- 0:01:40
20000 -- (-535.197) [-536.717] (-537.778) (-536.380) * [-533.327] (-539.761) (-541.594) (-539.575) -- 0:01:38
Average standard deviation of split frequencies: 0.022810
20500 -- (-535.050) [-537.370] (-542.122) (-549.753) * [-537.828] (-540.647) (-540.052) (-542.017) -- 0:01:35
21000 -- (-535.614) (-540.040) (-534.591) [-533.267] * (-539.594) [-532.310] (-539.112) (-540.990) -- 0:01:33
21500 -- (-540.285) (-540.917) (-538.847) [-535.109] * (-536.410) (-535.216) [-536.580] (-537.869) -- 0:02:16
22000 -- [-533.286] (-541.794) (-544.970) (-534.223) * (-543.629) [-537.961] (-545.058) (-536.853) -- 0:02:13
22500 -- (-536.565) [-531.836] (-544.366) (-539.179) * [-534.563] (-537.888) (-537.366) (-545.066) -- 0:02:10
23000 -- (-538.480) [-532.516] (-539.693) (-534.472) * (-533.323) (-542.110) (-537.167) [-536.526] -- 0:02:07
23500 -- (-543.753) [-541.255] (-539.298) (-537.094) * (-539.518) (-534.818) [-536.150] (-540.782) -- 0:02:04
24000 -- (-533.832) (-540.481) [-534.994] (-537.894) * (-540.977) (-551.529) (-540.560) [-539.799] -- 0:02:02
24500 -- (-545.088) (-539.716) [-539.005] (-537.789) * (-544.854) [-532.228] (-538.943) (-544.368) -- 0:01:59
25000 -- [-539.833] (-543.779) (-540.707) (-533.340) * [-535.444] (-535.531) (-532.864) (-537.643) -- 0:01:57
Average standard deviation of split frequencies: 0.009065
25500 -- (-533.167) [-545.706] (-542.894) (-537.591) * (-537.985) [-539.674] (-535.421) (-542.928) -- 0:01:54
26000 -- [-535.776] (-540.641) (-535.706) (-536.801) * [-535.281] (-533.910) (-538.202) (-537.791) -- 0:01:52
26500 -- (-541.176) (-541.551) (-542.535) [-533.226] * (-539.760) (-545.038) [-538.563] (-537.933) -- 0:01:50
27000 -- [-533.589] (-537.222) (-537.967) (-539.943) * (-543.236) (-546.750) [-536.925] (-537.911) -- 0:01:48
27500 -- (-534.177) (-534.629) (-542.607) [-535.618] * (-541.560) (-549.742) [-536.502] (-538.484) -- 0:01:46
28000 -- (-535.757) [-531.355] (-535.311) (-544.988) * (-536.434) (-537.624) [-537.758] (-537.026) -- 0:01:44
28500 -- (-535.524) (-535.439) [-539.483] (-534.334) * (-541.095) [-536.958] (-539.740) (-537.518) -- 0:01:42
29000 -- (-538.506) [-538.369] (-546.828) (-542.221) * [-543.635] (-544.754) (-534.421) (-538.749) -- 0:01:40
29500 -- [-536.502] (-537.826) (-541.347) (-535.266) * [-547.293] (-544.059) (-541.198) (-538.528) -- 0:01:38
30000 -- (-537.805) [-545.876] (-540.687) (-538.381) * (-549.025) [-533.913] (-537.907) (-543.197) -- 0:01:37
Average standard deviation of split frequencies: 0.015372
30500 -- (-536.191) [-538.949] (-544.875) (-532.743) * (-549.010) (-535.839) (-536.467) [-535.932] -- 0:02:07
31000 -- (-540.138) (-533.817) (-540.669) [-533.329] * (-548.140) (-546.868) [-540.322] (-533.225) -- 0:02:05
31500 -- [-534.336] (-536.550) (-542.099) (-536.072) * (-549.762) (-542.833) (-534.742) [-536.797] -- 0:02:02
32000 -- (-535.933) (-535.517) (-542.910) [-534.904] * (-552.336) [-541.827] (-535.756) (-533.447) -- 0:02:01
32500 -- (-539.428) [-533.794] (-542.876) (-542.236) * (-546.348) (-542.900) (-533.303) [-540.667] -- 0:01:59
33000 -- (-539.507) (-540.566) (-539.645) [-537.256] * (-548.806) (-537.885) (-536.801) [-536.422] -- 0:01:57
33500 -- (-541.184) [-539.426] (-537.719) (-539.860) * (-540.438) (-542.673) (-539.305) [-532.404] -- 0:01:55
34000 -- (-533.801) (-541.155) (-543.395) [-537.116] * (-541.504) (-543.321) [-539.159] (-537.505) -- 0:01:53
34500 -- (-537.341) (-535.924) (-539.126) [-532.604] * (-545.597) (-541.959) (-536.944) [-541.672] -- 0:01:51
35000 -- (-536.080) [-535.381] (-538.882) (-538.550) * [-538.396] (-537.300) (-535.405) (-539.519) -- 0:01:50
Average standard deviation of split frequencies: 0.026189
35500 -- (-535.094) (-540.118) (-540.492) [-534.240] * (-540.885) (-539.001) (-536.763) [-535.599] -- 0:01:48
36000 -- (-548.330) (-540.292) [-538.988] (-538.981) * (-537.838) (-539.682) [-533.310] (-542.994) -- 0:01:47
36500 -- (-538.681) (-539.937) [-540.364] (-542.282) * (-542.831) [-539.806] (-539.485) (-536.357) -- 0:01:45
37000 -- [-540.645] (-538.102) (-539.612) (-545.273) * (-537.837) (-541.155) [-535.249] (-541.736) -- 0:01:44
37500 -- (-536.203) (-534.079) (-539.262) [-545.292] * (-540.950) [-542.637] (-531.295) (-534.686) -- 0:01:42
38000 -- (-534.892) [-537.541] (-539.861) (-547.691) * (-552.364) (-533.477) [-531.738] (-537.976) -- 0:01:41
38500 -- [-535.742] (-536.819) (-538.258) (-547.982) * [-543.348] (-539.067) (-536.982) (-545.924) -- 0:01:39
39000 -- (-535.843) [-536.280] (-541.789) (-542.298) * [-538.709] (-542.477) (-534.757) (-540.966) -- 0:02:03
39500 -- [-541.709] (-538.647) (-550.443) (-541.870) * (-540.053) (-540.136) (-540.275) [-540.857] -- 0:02:01
40000 -- [-536.042] (-536.670) (-541.269) (-540.192) * (-542.378) [-533.841] (-536.173) (-540.108) -- 0:02:00
Average standard deviation of split frequencies: 0.023184
40500 -- (-535.549) [-537.074] (-540.490) (-539.417) * [-535.922] (-539.395) (-537.146) (-538.370) -- 0:01:58
41000 -- (-538.163) [-539.636] (-539.920) (-544.415) * (-542.283) (-537.752) (-533.966) [-534.527] -- 0:01:56
41500 -- [-537.169] (-540.226) (-538.584) (-539.954) * (-539.532) [-535.296] (-533.847) (-545.136) -- 0:01:55
42000 -- (-540.977) [-538.484] (-539.685) (-540.084) * (-538.824) [-539.483] (-532.448) (-550.093) -- 0:01:54
42500 -- (-536.030) [-533.390] (-541.447) (-543.224) * (-535.873) (-538.226) (-534.803) [-540.753] -- 0:01:52
43000 -- (-537.479) (-535.747) [-536.923] (-540.937) * (-536.189) (-539.923) (-535.793) [-538.899] -- 0:01:51
43500 -- (-538.837) (-542.269) [-539.328] (-539.661) * (-535.981) (-544.630) [-538.995] (-536.543) -- 0:01:49
44000 -- (-535.466) (-544.848) (-539.607) [-538.793] * (-543.058) (-537.530) [-537.892] (-533.245) -- 0:01:48
44500 -- [-532.827] (-550.272) (-544.136) (-539.307) * [-535.727] (-536.160) (-539.704) (-536.663) -- 0:01:47
45000 -- (-535.979) [-544.720] (-536.353) (-542.986) * (-542.062) (-539.532) [-531.946] (-536.664) -- 0:01:46
Average standard deviation of split frequencies: 0.020496
45500 -- (-536.098) (-548.196) [-535.488] (-538.517) * [-539.282] (-536.048) (-536.504) (-532.294) -- 0:01:44
46000 -- (-542.109) (-541.244) [-537.792] (-538.277) * (-538.509) (-535.898) (-534.284) [-534.983] -- 0:01:43
46500 -- (-537.007) [-538.917] (-543.572) (-540.107) * [-534.909] (-537.475) (-537.957) (-534.609) -- 0:01:42
47000 -- (-541.687) [-537.259] (-537.668) (-541.172) * [-534.776] (-543.152) (-542.279) (-534.220) -- 0:01:41
47500 -- [-537.515] (-537.242) (-544.329) (-536.704) * (-536.914) (-537.459) [-536.723] (-538.130) -- 0:01:40
48000 -- [-539.464] (-535.062) (-537.363) (-545.595) * (-538.568) (-539.269) (-536.573) [-537.848] -- 0:01:59
48500 -- (-536.529) (-535.637) [-535.279] (-533.758) * (-539.395) (-533.078) (-544.794) [-551.003] -- 0:01:57
49000 -- [-536.647] (-543.316) (-539.271) (-540.484) * [-539.940] (-537.425) (-531.756) (-540.993) -- 0:01:56
49500 -- (-540.451) [-533.145] (-539.221) (-538.259) * (-540.585) (-536.945) [-537.273] (-546.741) -- 0:01:55
50000 -- (-541.866) [-533.916] (-541.133) (-541.893) * (-543.282) [-531.351] (-536.236) (-537.258) -- 0:01:54
Average standard deviation of split frequencies: 0.023260
50500 -- (-545.863) (-539.434) (-539.273) [-535.474] * (-541.594) (-535.915) (-541.885) [-538.281] -- 0:01:52
51000 -- (-540.624) (-539.898) [-534.867] (-542.368) * [-537.336] (-537.809) (-536.626) (-539.889) -- 0:01:51
51500 -- [-541.026] (-537.514) (-535.066) (-542.073) * (-537.487) [-531.861] (-539.935) (-534.245) -- 0:01:50
52000 -- (-537.459) (-540.926) (-539.742) [-538.806] * (-539.888) (-548.158) (-547.993) [-534.081] -- 0:01:49
52500 -- (-542.052) [-536.269] (-534.619) (-549.869) * (-546.292) [-543.374] (-542.237) (-539.919) -- 0:01:48
53000 -- (-543.276) (-538.064) (-539.533) [-536.641] * (-536.558) (-543.032) [-533.766] (-533.710) -- 0:01:47
53500 -- (-542.879) (-536.690) [-536.344] (-536.351) * (-537.910) (-534.148) [-534.961] (-539.100) -- 0:01:46
54000 -- (-538.962) (-534.268) [-536.555] (-540.450) * (-537.308) (-533.745) [-537.765] (-537.776) -- 0:01:45
54500 -- (-541.082) (-534.333) [-534.449] (-538.965) * (-537.294) [-543.582] (-537.211) (-541.755) -- 0:01:44
55000 -- (-537.725) (-537.966) [-534.944] (-547.524) * [-537.935] (-533.903) (-540.559) (-544.543) -- 0:01:43
Average standard deviation of split frequencies: 0.012627
55500 -- (-539.420) [-541.491] (-536.179) (-545.495) * (-537.141) (-536.687) (-543.322) [-538.179] -- 0:01:42
56000 -- [-536.987] (-538.082) (-535.993) (-535.254) * [-534.591] (-536.993) (-535.499) (-539.900) -- 0:01:41
56500 -- [-536.574] (-532.086) (-534.128) (-542.932) * [-536.619] (-532.547) (-538.254) (-539.540) -- 0:01:40
57000 -- [-536.046] (-532.859) (-532.020) (-534.202) * [-534.680] (-538.345) (-538.281) (-545.335) -- 0:01:55
57500 -- (-544.564) (-536.358) (-533.550) [-534.755] * [-537.570] (-536.473) (-540.081) (-548.924) -- 0:01:54
58000 -- (-543.138) (-531.245) [-535.947] (-532.586) * [-539.014] (-536.096) (-533.629) (-541.639) -- 0:01:53
58500 -- (-546.819) (-538.514) [-531.819] (-534.337) * (-538.874) (-543.030) [-533.339] (-539.646) -- 0:01:52
59000 -- (-534.518) (-540.668) (-530.487) [-535.711] * (-536.925) (-541.026) [-540.512] (-538.551) -- 0:01:51
59500 -- (-542.279) (-543.193) (-543.119) [-535.878] * (-539.501) (-538.874) (-540.358) [-537.997] -- 0:01:50
60000 -- (-536.600) (-538.817) [-536.353] (-533.255) * (-535.739) [-535.907] (-543.603) (-532.034) -- 0:01:49
Average standard deviation of split frequencies: 0.015541
60500 -- [-537.039] (-541.345) (-538.587) (-534.547) * (-535.185) [-537.638] (-537.888) (-540.662) -- 0:01:48
61000 -- (-541.750) (-536.195) [-536.687] (-538.696) * (-538.812) (-541.501) [-542.033] (-543.520) -- 0:01:47
61500 -- (-543.716) [-538.972] (-533.462) (-538.137) * (-543.088) (-542.372) [-536.785] (-536.851) -- 0:01:46
62000 -- (-543.503) (-541.079) [-533.379] (-534.819) * (-540.218) (-537.521) [-538.002] (-536.849) -- 0:01:45
62500 -- (-538.454) [-536.988] (-534.519) (-537.643) * (-540.583) (-538.214) (-540.527) [-536.698] -- 0:01:45
63000 -- (-540.381) (-533.479) [-536.297] (-548.898) * [-537.615] (-539.484) (-539.362) (-541.858) -- 0:01:44
63500 -- (-544.709) [-533.693] (-538.657) (-539.050) * [-538.812] (-544.387) (-546.997) (-538.432) -- 0:01:43
64000 -- (-539.911) (-534.024) (-538.342) [-535.386] * (-543.798) [-535.777] (-542.252) (-535.511) -- 0:01:42
64500 -- (-543.818) [-537.094] (-539.996) (-534.828) * [-535.169] (-538.443) (-544.050) (-535.810) -- 0:01:41
65000 -- (-537.805) [-536.295] (-542.723) (-536.444) * [-535.642] (-538.479) (-541.343) (-536.954) -- 0:01:40
Average standard deviation of split frequencies: 0.010714
65500 -- [-538.884] (-540.711) (-545.587) (-536.659) * (-535.839) (-537.835) [-539.182] (-538.494) -- 0:01:54
66000 -- (-539.715) (-543.015) [-537.398] (-540.642) * [-533.796] (-547.718) (-535.083) (-534.473) -- 0:01:53
66500 -- (-543.843) [-536.674] (-540.779) (-540.104) * (-535.308) (-548.984) (-535.950) [-542.821] -- 0:01:52
67000 -- (-537.458) (-539.315) (-537.070) [-543.718] * [-535.128] (-544.078) (-536.778) (-537.311) -- 0:01:51
67500 -- [-534.136] (-539.590) (-534.924) (-540.940) * (-538.051) [-538.548] (-535.234) (-536.862) -- 0:01:50
68000 -- (-535.097) (-535.415) [-539.155] (-548.066) * (-534.804) (-545.651) [-544.606] (-536.270) -- 0:01:49
68500 -- [-541.133] (-536.854) (-544.740) (-542.839) * (-536.428) (-544.745) [-540.743] (-536.268) -- 0:01:48
69000 -- (-541.148) [-536.825] (-540.667) (-541.898) * [-536.434] (-543.364) (-538.592) (-539.529) -- 0:01:47
69500 -- (-539.781) [-534.248] (-552.909) (-539.765) * [-534.073] (-541.224) (-535.309) (-542.354) -- 0:01:47
70000 -- (-542.263) (-538.113) (-532.453) [-537.370] * [-536.190] (-541.874) (-536.308) (-539.030) -- 0:01:46
Average standard deviation of split frequencies: 0.016677
70500 -- (-538.697) [-540.202] (-537.223) (-534.313) * [-536.993] (-543.276) (-535.127) (-550.588) -- 0:01:45
71000 -- (-538.302) (-542.954) [-537.897] (-543.752) * [-536.822] (-548.873) (-536.675) (-546.955) -- 0:01:44
71500 -- (-537.959) [-539.913] (-538.231) (-534.731) * (-536.345) (-542.071) (-535.888) [-534.346] -- 0:01:43
72000 -- [-535.617] (-538.382) (-536.835) (-541.925) * [-535.222] (-542.495) (-535.318) (-539.326) -- 0:01:43
72500 -- (-535.192) (-542.316) (-537.159) [-538.796] * (-534.683) (-558.877) [-539.830] (-540.488) -- 0:01:42
73000 -- (-540.266) (-544.663) [-542.727] (-543.836) * (-539.229) (-544.625) [-536.273] (-536.855) -- 0:01:41
73500 -- (-541.914) (-535.792) [-533.604] (-542.592) * (-534.907) (-542.560) [-535.931] (-539.655) -- 0:01:40
74000 -- (-533.416) [-539.247] (-548.285) (-547.623) * (-535.394) (-541.881) [-531.499] (-539.513) -- 0:01:52
74500 -- (-531.599) [-536.456] (-540.588) (-537.361) * (-538.744) (-546.493) [-534.530] (-541.624) -- 0:01:51
75000 -- (-536.618) (-542.436) [-532.777] (-532.932) * (-536.362) (-547.801) [-534.211] (-540.378) -- 0:01:51
Average standard deviation of split frequencies: 0.015507
75500 -- (-534.770) (-538.322) [-538.871] (-536.527) * [-532.589] (-540.142) (-535.880) (-538.217) -- 0:01:50
76000 -- (-535.028) [-530.666] (-544.890) (-539.247) * (-534.236) (-537.909) [-537.773] (-536.307) -- 0:01:49
76500 -- (-543.148) [-543.791] (-537.622) (-546.193) * [-534.894] (-542.082) (-535.328) (-537.179) -- 0:01:48
77000 -- [-537.571] (-546.286) (-536.760) (-536.044) * (-536.610) (-542.700) (-539.534) [-538.083] -- 0:01:47
77500 -- (-538.563) (-549.845) (-539.233) [-536.063] * [-545.304] (-538.445) (-538.291) (-541.343) -- 0:01:47
78000 -- (-538.600) (-543.983) [-534.510] (-537.337) * (-539.540) (-546.747) (-533.802) [-537.607] -- 0:01:46
78500 -- (-535.475) (-548.322) (-537.622) [-532.738] * (-538.588) (-539.353) [-537.429] (-536.406) -- 0:01:45
79000 -- [-537.167] (-542.134) (-534.055) (-537.700) * (-537.501) (-545.094) (-538.138) [-533.129] -- 0:01:44
79500 -- [-542.674] (-535.334) (-537.929) (-541.142) * [-539.461] (-539.373) (-540.209) (-535.616) -- 0:01:44
80000 -- [-536.252] (-539.721) (-537.343) (-536.577) * (-537.121) (-542.431) [-539.926] (-541.802) -- 0:01:43
Average standard deviation of split frequencies: 0.017532
80500 -- (-540.200) [-542.251] (-543.413) (-538.061) * (-537.096) (-540.719) (-537.316) [-534.039] -- 0:01:42
81000 -- (-533.628) [-536.819] (-543.986) (-538.164) * (-541.289) (-540.421) (-540.126) [-539.255] -- 0:01:42
81500 -- (-537.697) (-534.931) [-536.845] (-538.271) * (-542.261) (-545.557) [-535.976] (-534.342) -- 0:01:41
82000 -- (-536.350) [-533.517] (-533.899) (-536.695) * [-538.215] (-548.913) (-538.744) (-543.620) -- 0:01:40
82500 -- (-534.082) [-537.583] (-544.901) (-540.153) * [-536.400] (-546.616) (-534.475) (-540.884) -- 0:01:51
83000 -- (-534.146) (-538.198) [-537.476] (-546.316) * (-543.027) (-542.087) [-536.507] (-539.956) -- 0:01:50
83500 -- [-536.575] (-536.781) (-540.875) (-541.702) * (-535.057) (-545.908) [-536.851] (-534.595) -- 0:01:49
84000 -- (-539.132) [-537.472] (-537.210) (-540.058) * [-536.574] (-541.859) (-543.313) (-533.694) -- 0:01:49
84500 -- [-531.134] (-538.840) (-543.482) (-538.818) * (-538.343) (-538.136) (-540.291) [-534.373] -- 0:01:48
85000 -- [-534.404] (-542.697) (-537.655) (-534.934) * (-537.131) (-541.315) [-536.224] (-540.793) -- 0:01:47
Average standard deviation of split frequencies: 0.016444
85500 -- [-537.252] (-541.580) (-539.239) (-539.740) * [-534.918] (-538.070) (-546.520) (-540.189) -- 0:01:46
86000 -- (-534.518) (-537.894) (-540.417) [-540.153] * (-538.403) [-534.253] (-541.314) (-538.541) -- 0:01:46
86500 -- [-533.269] (-537.257) (-539.531) (-544.620) * [-534.337] (-534.623) (-538.643) (-540.741) -- 0:01:45
87000 -- [-532.883] (-543.612) (-541.481) (-538.707) * (-537.911) (-540.386) [-539.634] (-546.821) -- 0:01:44
87500 -- (-533.679) (-540.437) (-540.455) [-532.278] * (-539.355) (-539.827) [-535.529] (-540.323) -- 0:01:44
88000 -- [-536.293] (-537.119) (-535.752) (-536.587) * (-537.646) (-537.463) (-536.872) [-547.822] -- 0:01:43
88500 -- [-531.853] (-538.807) (-543.415) (-536.911) * (-536.003) (-543.068) [-532.825] (-535.979) -- 0:01:42
89000 -- (-532.628) (-537.294) [-546.631] (-540.298) * (-541.299) (-539.109) [-536.775] (-536.381) -- 0:01:42
89500 -- (-533.552) (-537.150) (-541.094) [-531.856] * (-540.000) [-537.169] (-534.564) (-537.418) -- 0:01:41
90000 -- (-531.730) [-536.957] (-539.505) (-537.912) * (-543.282) (-538.668) (-539.596) [-537.871] -- 0:01:41
Average standard deviation of split frequencies: 0.015598
90500 -- [-531.808] (-543.599) (-543.077) (-534.394) * (-542.715) [-536.949] (-539.765) (-538.351) -- 0:01:40
91000 -- [-536.973] (-539.100) (-546.215) (-534.666) * (-547.891) (-538.706) (-545.302) [-533.843] -- 0:01:39
91500 -- [-534.192] (-537.239) (-538.774) (-544.111) * (-535.257) [-539.963] (-538.834) (-535.816) -- 0:01:49
92000 -- (-535.239) [-538.809] (-537.506) (-536.334) * (-535.891) [-540.009] (-536.327) (-539.434) -- 0:01:48
92500 -- [-535.590] (-531.445) (-538.269) (-539.654) * (-543.478) (-543.873) [-540.392] (-539.203) -- 0:01:47
93000 -- (-535.558) (-533.490) (-540.381) [-535.486] * [-538.048] (-537.265) (-542.282) (-534.187) -- 0:01:47
93500 -- (-533.074) (-537.191) [-536.254] (-534.391) * (-535.610) [-535.139] (-541.263) (-537.386) -- 0:01:46
94000 -- (-538.605) (-540.510) [-535.455] (-536.698) * (-539.031) (-536.879) [-537.178] (-536.224) -- 0:01:46
94500 -- [-533.272] (-537.544) (-533.864) (-537.775) * [-537.940] (-537.631) (-539.951) (-544.261) -- 0:01:45
95000 -- (-539.534) (-544.904) [-540.263] (-538.897) * (-538.287) (-541.958) (-539.760) [-535.081] -- 0:01:44
Average standard deviation of split frequencies: 0.012276
95500 -- [-540.270] (-548.103) (-539.159) (-536.837) * (-540.743) [-538.007] (-540.382) (-534.073) -- 0:01:44
96000 -- (-541.731) (-538.332) (-544.735) [-537.578] * [-534.394] (-537.956) (-538.751) (-534.963) -- 0:01:43
96500 -- [-532.848] (-543.788) (-536.304) (-535.529) * [-537.533] (-539.404) (-536.111) (-538.041) -- 0:01:42
97000 -- (-537.402) (-542.347) [-534.426] (-535.138) * (-540.248) (-534.860) [-534.943] (-537.638) -- 0:01:42
97500 -- (-538.394) (-541.017) (-539.930) [-535.957] * (-538.311) [-535.402] (-542.948) (-537.604) -- 0:01:41
98000 -- (-537.803) (-537.941) (-539.226) [-536.939] * (-538.073) [-535.303] (-536.589) (-543.854) -- 0:01:41
98500 -- (-539.185) [-538.394] (-540.669) (-543.050) * (-538.752) (-534.022) [-537.654] (-539.540) -- 0:01:40
99000 -- [-544.216] (-548.752) (-538.932) (-549.280) * (-536.076) (-534.068) [-540.542] (-540.610) -- 0:01:40
99500 -- (-540.680) [-539.133] (-538.902) (-539.736) * [-538.986] (-535.539) (-539.234) (-536.591) -- 0:01:39
100000 -- (-539.684) (-545.231) (-550.431) [-545.226] * (-535.949) [-532.407] (-542.883) (-537.457) -- 0:01:48
Average standard deviation of split frequencies: 0.009366
100500 -- (-541.080) (-533.796) (-551.561) [-538.348] * (-541.604) [-538.920] (-538.978) (-531.775) -- 0:01:47
101000 -- (-534.478) (-535.429) [-544.796] (-535.950) * (-542.090) [-540.342] (-544.696) (-535.893) -- 0:01:46
101500 -- [-538.281] (-538.492) (-541.733) (-539.724) * (-537.452) [-534.592] (-549.507) (-535.926) -- 0:01:46
102000 -- (-535.797) (-539.394) (-539.525) [-535.657] * (-541.145) [-537.105] (-540.664) (-535.418) -- 0:01:45
102500 -- [-532.862] (-538.837) (-544.371) (-533.736) * [-535.846] (-534.600) (-542.205) (-537.169) -- 0:01:45
103000 -- (-537.869) (-539.825) (-543.393) [-536.327] * (-538.512) [-538.967] (-539.959) (-535.685) -- 0:01:44
103500 -- (-540.908) (-540.223) (-550.216) [-536.461] * (-536.727) (-538.082) (-538.495) [-539.325] -- 0:01:43
104000 -- (-537.103) [-537.411] (-548.516) (-541.769) * (-535.493) [-536.216] (-538.865) (-535.223) -- 0:01:43
104500 -- (-534.879) (-537.998) [-539.901] (-537.842) * (-536.212) (-534.808) (-544.344) [-532.642] -- 0:01:42
105000 -- (-537.003) (-548.161) (-540.462) [-536.406] * [-536.608] (-539.139) (-544.056) (-532.006) -- 0:01:42
Average standard deviation of split frequencies: 0.011118
105500 -- (-537.822) (-536.328) [-545.314] (-535.078) * (-536.880) (-540.920) (-546.663) [-538.655] -- 0:01:41
106000 -- (-538.333) (-536.483) (-542.188) [-537.013] * (-538.729) [-539.653] (-545.269) (-532.781) -- 0:01:41
106500 -- (-543.765) (-535.484) (-547.910) [-540.884] * (-536.019) [-537.900] (-548.890) (-534.487) -- 0:01:40
107000 -- (-541.143) [-534.330] (-540.256) (-542.810) * (-538.839) [-536.510] (-541.821) (-540.143) -- 0:01:40
107500 -- [-531.153] (-536.511) (-546.565) (-540.397) * (-535.293) (-538.223) [-539.950] (-542.802) -- 0:01:39
108000 -- [-531.194] (-542.081) (-552.585) (-539.892) * (-537.052) [-533.481] (-544.366) (-540.672) -- 0:01:39
108500 -- (-534.213) (-540.819) [-541.745] (-534.598) * (-532.942) [-537.769] (-538.350) (-541.982) -- 0:01:38
109000 -- [-536.162] (-540.178) (-542.384) (-535.240) * (-537.850) [-544.473] (-541.728) (-537.248) -- 0:01:46
109500 -- (-537.005) [-538.671] (-540.741) (-541.119) * [-533.056] (-536.925) (-545.550) (-544.550) -- 0:01:45
110000 -- [-535.502] (-537.605) (-537.374) (-539.232) * (-534.105) (-543.842) (-541.588) [-539.062] -- 0:01:45
Average standard deviation of split frequencies: 0.006390
110500 -- (-537.554) [-536.274] (-552.125) (-543.265) * (-537.166) [-536.617] (-543.278) (-542.773) -- 0:01:44
111000 -- (-536.162) [-538.378] (-535.822) (-534.311) * [-540.597] (-539.280) (-544.524) (-540.396) -- 0:01:44
111500 -- (-535.798) (-539.263) [-539.322] (-536.999) * [-539.154] (-542.859) (-545.515) (-543.348) -- 0:01:43
112000 -- [-535.697] (-544.252) (-539.193) (-532.240) * (-539.275) [-537.209] (-544.786) (-541.852) -- 0:01:43
112500 -- (-546.096) [-540.862] (-545.329) (-533.621) * (-538.246) (-539.634) [-538.168] (-545.669) -- 0:01:42
113000 -- [-541.524] (-538.779) (-537.191) (-536.492) * [-531.845] (-541.460) (-546.181) (-545.289) -- 0:01:42
113500 -- (-542.270) (-535.992) (-541.014) [-542.823] * [-534.630] (-542.135) (-542.972) (-544.262) -- 0:01:41
114000 -- (-535.605) (-535.943) (-546.426) [-537.397] * (-537.449) (-544.011) (-542.970) [-542.518] -- 0:01:41
114500 -- [-535.960] (-536.449) (-541.684) (-535.780) * (-538.915) (-534.886) (-541.277) [-538.117] -- 0:01:40
115000 -- (-533.333) (-538.969) (-544.980) [-538.512] * (-537.554) [-536.646] (-544.007) (-540.329) -- 0:01:40
Average standard deviation of split frequencies: 0.006096
115500 -- (-533.095) (-538.560) (-540.038) [-538.475] * (-539.316) [-540.580] (-544.412) (-538.805) -- 0:01:39
116000 -- (-534.468) (-537.358) (-539.829) [-540.124] * (-539.321) [-537.522] (-543.660) (-536.358) -- 0:01:39
116500 -- (-538.889) (-536.610) (-541.857) [-535.150] * (-546.865) (-545.007) [-542.691] (-542.048) -- 0:01:38
117000 -- [-534.869] (-536.779) (-546.968) (-542.072) * [-534.727] (-537.543) (-539.548) (-543.272) -- 0:01:38
117500 -- [-535.084] (-536.520) (-537.040) (-545.586) * (-542.668) [-539.612] (-546.610) (-537.870) -- 0:01:45
118000 -- [-533.199] (-545.029) (-548.915) (-539.944) * (-541.548) (-546.220) (-551.044) [-539.929] -- 0:01:44
118500 -- [-535.522] (-539.599) (-543.505) (-532.951) * (-539.897) (-538.827) [-537.519] (-540.743) -- 0:01:44
119000 -- (-540.838) (-540.093) (-544.209) [-537.948] * (-539.468) (-542.305) [-542.830] (-538.572) -- 0:01:43
119500 -- [-539.962] (-536.926) (-537.391) (-534.607) * [-533.969] (-538.655) (-535.610) (-538.527) -- 0:01:43
120000 -- (-532.815) (-538.621) [-536.066] (-540.520) * (-538.767) [-538.214] (-537.367) (-537.160) -- 0:01:42
Average standard deviation of split frequencies: 0.007813
120500 -- (-535.132) (-547.487) (-536.336) [-535.783] * [-536.605] (-536.598) (-535.333) (-541.361) -- 0:01:42
121000 -- (-537.548) (-544.596) [-536.792] (-533.915) * (-542.211) (-544.884) [-537.333] (-547.804) -- 0:01:41
121500 -- (-532.638) (-544.697) [-535.734] (-532.986) * (-535.604) (-541.381) [-539.735] (-542.279) -- 0:01:41
122000 -- (-534.436) (-545.003) (-536.077) [-533.124] * (-540.094) (-542.081) (-537.546) [-537.293] -- 0:01:40
122500 -- (-537.346) (-548.624) (-544.218) [-538.674] * (-541.058) [-535.207] (-537.567) (-539.450) -- 0:01:40
123000 -- (-531.841) (-548.885) (-538.179) [-539.094] * (-542.661) (-541.095) [-535.442] (-543.859) -- 0:01:39
123500 -- (-539.503) (-548.175) [-538.712] (-543.558) * (-538.677) [-536.584] (-539.928) (-539.053) -- 0:01:39
124000 -- (-534.226) (-539.669) (-545.143) [-539.059] * [-537.838] (-534.740) (-538.032) (-533.459) -- 0:01:38
124500 -- [-535.715] (-537.008) (-540.907) (-542.372) * (-539.915) (-535.525) (-535.671) [-538.826] -- 0:01:38
125000 -- [-532.299] (-535.542) (-540.104) (-536.131) * (-537.901) (-539.895) [-531.843] (-536.517) -- 0:01:38
Average standard deviation of split frequencies: 0.009353
125500 -- (-537.236) [-539.522] (-539.557) (-532.880) * (-533.951) [-535.582] (-542.234) (-540.127) -- 0:01:37
126000 -- (-531.476) [-538.843] (-538.482) (-538.272) * (-539.620) (-538.224) (-536.154) [-532.685] -- 0:01:44
126500 -- [-535.296] (-549.250) (-539.204) (-539.364) * (-540.703) (-536.586) (-537.694) [-537.680] -- 0:01:43
127000 -- [-536.050] (-545.138) (-534.583) (-537.258) * (-537.572) (-540.908) (-535.426) [-532.768] -- 0:01:43
127500 -- [-543.245] (-539.451) (-534.319) (-539.780) * (-543.186) (-535.573) (-537.999) [-538.825] -- 0:01:42
128000 -- [-541.795] (-535.877) (-536.493) (-539.185) * (-538.967) [-536.396] (-535.479) (-534.979) -- 0:01:42
128500 -- (-537.378) (-535.454) [-531.394] (-538.035) * [-542.504] (-535.110) (-544.748) (-532.626) -- 0:01:41
129000 -- (-542.680) (-536.514) [-537.777] (-536.707) * (-542.464) (-542.751) (-540.363) [-534.124] -- 0:01:41
129500 -- (-540.967) [-537.919] (-544.121) (-535.699) * [-535.185] (-536.703) (-541.853) (-534.616) -- 0:01:40
130000 -- [-536.688] (-544.471) (-536.807) (-545.039) * (-537.875) (-536.193) (-537.926) [-535.033] -- 0:01:40
Average standard deviation of split frequencies: 0.009019
130500 -- (-538.225) (-543.750) [-538.352] (-545.493) * (-541.322) (-534.805) [-533.274] (-537.768) -- 0:01:39
131000 -- (-542.751) [-542.039] (-544.163) (-535.122) * (-534.212) (-543.366) (-541.271) [-537.182] -- 0:01:39
131500 -- (-540.004) (-536.430) [-532.473] (-536.035) * (-535.274) (-537.276) (-547.104) [-537.020] -- 0:01:39
132000 -- (-542.867) (-542.153) [-534.805] (-538.450) * (-535.237) [-533.005] (-537.787) (-536.512) -- 0:01:38
132500 -- (-535.244) (-533.634) [-542.299] (-536.874) * (-543.010) [-537.820] (-534.649) (-537.897) -- 0:01:38
133000 -- (-537.027) (-537.588) (-534.751) [-537.573] * (-540.438) (-536.898) [-537.445] (-540.342) -- 0:01:37
133500 -- (-539.635) (-537.520) (-539.904) [-532.369] * (-539.265) (-537.532) (-542.496) [-539.672] -- 0:01:37
134000 -- (-535.296) [-536.534] (-537.249) (-536.164) * (-538.956) (-540.420) [-536.492] (-536.385) -- 0:01:36
134500 -- (-542.765) (-536.731) [-534.250] (-538.168) * [-536.552] (-538.407) (-544.870) (-539.553) -- 0:01:36
135000 -- (-535.794) (-538.629) [-533.290] (-543.122) * [-539.176] (-538.656) (-541.240) (-539.573) -- 0:01:42
Average standard deviation of split frequencies: 0.006932
135500 -- (-539.157) (-546.720) [-536.852] (-538.450) * (-538.813) (-536.401) (-539.724) [-540.147] -- 0:01:42
136000 -- (-541.101) [-531.428] (-537.739) (-538.729) * (-546.894) (-534.657) [-534.857] (-538.663) -- 0:01:41
136500 -- (-536.364) (-542.679) (-538.777) [-535.658] * (-537.743) (-540.970) (-538.860) [-538.007] -- 0:01:41
137000 -- [-534.465] (-537.315) (-533.767) (-536.299) * (-542.511) [-536.664] (-544.429) (-542.429) -- 0:01:40
137500 -- (-537.761) (-532.116) (-542.243) [-535.448] * (-536.677) (-550.048) [-534.929] (-537.716) -- 0:01:40
138000 -- (-534.190) [-532.213] (-537.951) (-533.432) * (-538.191) (-546.140) (-535.092) [-534.554] -- 0:01:39
138500 -- (-534.422) (-536.177) [-538.759] (-540.754) * (-536.862) (-536.212) [-533.169] (-534.894) -- 0:01:39
139000 -- (-542.326) (-534.146) [-537.424] (-540.984) * (-543.332) (-534.938) [-535.738] (-542.820) -- 0:01:39
139500 -- (-543.949) (-536.309) [-541.489] (-537.562) * (-540.806) (-531.754) [-532.859] (-548.708) -- 0:01:38
140000 -- (-542.591) [-531.787] (-533.206) (-534.790) * (-536.792) (-540.111) (-538.239) [-542.200] -- 0:01:38
Average standard deviation of split frequencies: 0.003351
140500 -- (-539.940) [-534.590] (-539.438) (-538.076) * [-537.856] (-533.230) (-536.390) (-543.287) -- 0:01:37
141000 -- (-534.878) (-544.444) [-538.086] (-543.174) * (-539.469) (-539.157) [-535.035] (-541.132) -- 0:01:37
141500 -- [-536.877] (-536.818) (-545.942) (-540.242) * (-547.484) (-538.704) (-532.972) [-546.830] -- 0:01:37
142000 -- (-536.450) (-537.834) [-533.802] (-543.073) * (-541.027) [-534.989] (-547.027) (-534.240) -- 0:01:36
142500 -- (-537.783) (-540.511) [-533.209] (-543.234) * (-536.799) [-533.354] (-540.630) (-536.530) -- 0:01:36
143000 -- (-534.576) [-532.322] (-533.039) (-539.804) * (-534.367) (-531.987) (-539.115) [-534.659] -- 0:01:35
143500 -- (-535.889) (-535.656) [-535.470] (-536.967) * (-538.886) [-536.680] (-541.738) (-539.591) -- 0:01:35
144000 -- (-534.819) [-534.623] (-541.423) (-538.560) * (-539.263) (-541.883) (-538.694) [-538.732] -- 0:01:41
144500 -- [-533.257] (-535.840) (-539.347) (-537.256) * (-534.994) (-547.430) (-533.665) [-542.416] -- 0:01:40
145000 -- (-541.013) (-541.395) (-535.928) [-532.650] * (-540.193) (-541.141) (-534.293) [-537.933] -- 0:01:40
Average standard deviation of split frequencies: 0.004843
145500 -- (-537.000) [-531.497] (-538.312) (-540.238) * (-533.616) (-540.304) [-533.592] (-533.277) -- 0:01:39
146000 -- (-539.085) (-541.504) (-535.185) [-534.379] * [-534.684] (-544.186) (-539.947) (-540.006) -- 0:01:39
146500 -- (-535.759) (-545.333) (-537.791) [-536.546] * (-541.977) (-540.989) [-534.326] (-542.244) -- 0:01:39
147000 -- (-541.295) (-538.409) [-533.749] (-536.952) * (-540.136) [-537.742] (-545.750) (-542.040) -- 0:01:38
147500 -- (-536.256) [-532.642] (-535.791) (-539.957) * (-535.119) [-541.470] (-540.191) (-539.305) -- 0:01:38
148000 -- [-542.903] (-533.496) (-539.833) (-531.493) * (-536.273) (-546.137) (-533.574) [-537.265] -- 0:01:37
148500 -- (-538.566) [-536.452] (-534.663) (-533.682) * (-543.155) (-538.251) (-550.495) [-534.387] -- 0:01:37
149000 -- (-541.964) [-533.756] (-536.305) (-537.504) * (-536.605) (-538.289) (-543.896) [-539.394] -- 0:01:37
149500 -- (-535.780) (-534.062) [-532.228] (-533.953) * [-534.204] (-534.886) (-540.081) (-537.559) -- 0:01:36
150000 -- [-538.098] (-537.166) (-537.111) (-536.545) * (-539.403) (-536.030) (-539.963) [-531.019] -- 0:01:36
Average standard deviation of split frequencies: 0.004693
150500 -- (-539.473) (-536.973) (-535.496) [-532.893] * [-535.134] (-534.910) (-534.981) (-533.387) -- 0:01:35
151000 -- (-535.930) [-536.663] (-535.048) (-533.602) * (-548.372) [-537.313] (-533.841) (-533.699) -- 0:01:35
151500 -- [-536.303] (-539.808) (-534.370) (-548.779) * (-537.560) (-538.683) [-531.252] (-538.042) -- 0:01:35
152000 -- (-538.152) [-535.447] (-538.181) (-534.205) * (-539.839) (-539.265) [-531.147] (-539.416) -- 0:01:34
152500 -- (-538.579) (-538.127) (-535.653) [-533.565] * (-539.804) (-536.309) [-535.276] (-537.392) -- 0:01:40
153000 -- (-537.882) (-536.228) (-537.142) [-538.287] * (-535.620) (-538.469) [-542.430] (-536.982) -- 0:01:39
153500 -- (-536.780) [-538.250] (-535.547) (-541.524) * [-535.780] (-543.479) (-543.900) (-535.185) -- 0:01:39
154000 -- (-544.516) (-537.621) [-537.503] (-542.768) * (-538.570) [-537.705] (-538.255) (-536.653) -- 0:01:38
154500 -- (-539.100) (-534.961) (-541.989) [-538.136] * (-536.324) (-539.104) (-538.553) [-529.867] -- 0:01:38
155000 -- (-543.894) (-542.482) [-537.463] (-541.385) * (-536.771) (-541.605) [-540.489] (-538.809) -- 0:01:38
Average standard deviation of split frequencies: 0.003022
155500 -- (-540.098) [-536.043] (-537.221) (-534.747) * (-539.264) (-536.549) (-535.894) [-532.290] -- 0:01:37
156000 -- [-534.329] (-539.043) (-535.397) (-547.214) * [-534.438] (-540.498) (-540.845) (-534.813) -- 0:01:37
156500 -- (-541.317) [-534.587] (-536.698) (-544.413) * (-530.958) [-545.277] (-538.678) (-535.520) -- 0:01:37
157000 -- (-538.423) (-542.500) [-534.576] (-546.248) * [-536.247] (-542.699) (-538.586) (-538.321) -- 0:01:36
157500 -- (-538.806) (-535.222) (-532.147) [-536.758] * [-538.080] (-538.471) (-534.011) (-537.893) -- 0:01:36
158000 -- [-534.743] (-537.204) (-533.869) (-540.815) * (-539.379) [-538.019] (-533.147) (-539.411) -- 0:01:35
158500 -- (-532.505) (-539.324) [-531.473] (-533.078) * (-541.597) [-537.955] (-544.089) (-534.072) -- 0:01:35
159000 -- (-539.101) (-533.568) [-538.696] (-536.887) * (-542.909) (-539.004) [-538.544] (-533.706) -- 0:01:35
159500 -- [-537.061] (-540.527) (-533.347) (-539.194) * (-538.758) [-538.457] (-538.248) (-539.433) -- 0:01:34
160000 -- (-543.503) (-538.993) (-533.125) [-536.405] * [-538.234] (-543.567) (-537.867) (-535.557) -- 0:01:34
Average standard deviation of split frequencies: 0.001467
160500 -- (-544.261) (-544.261) (-540.397) [-539.353] * (-540.155) (-540.317) (-540.430) [-539.152] -- 0:01:34
161000 -- (-544.023) (-537.064) (-542.033) [-536.050] * (-535.996) (-541.508) [-535.042] (-538.636) -- 0:01:39
161500 -- [-535.930] (-536.723) (-529.402) (-536.928) * [-538.441] (-552.359) (-537.585) (-535.334) -- 0:01:38
162000 -- (-537.803) (-544.500) [-531.285] (-534.197) * (-537.456) (-538.362) (-538.461) [-541.615] -- 0:01:38
162500 -- (-537.909) (-537.218) (-543.886) [-533.036] * [-538.829] (-546.439) (-543.659) (-543.818) -- 0:01:37
163000 -- [-537.430] (-545.557) (-533.548) (-532.296) * (-536.405) (-535.330) (-538.505) [-537.836] -- 0:01:37
163500 -- [-534.571] (-541.404) (-535.667) (-539.352) * (-535.827) [-539.223] (-538.321) (-540.680) -- 0:01:37
164000 -- [-539.128] (-537.909) (-539.294) (-536.292) * (-540.769) [-537.081] (-538.564) (-544.494) -- 0:01:36
164500 -- (-540.406) [-536.735] (-538.921) (-534.996) * [-538.148] (-537.300) (-535.414) (-542.334) -- 0:01:36
165000 -- (-545.847) (-535.986) [-535.642] (-532.718) * (-543.533) [-536.869] (-535.188) (-546.271) -- 0:01:36
Average standard deviation of split frequencies: 0.001420
165500 -- [-534.228] (-539.405) (-546.947) (-537.008) * (-542.502) [-536.594] (-531.110) (-542.477) -- 0:01:35
166000 -- (-541.954) (-533.801) (-539.164) [-539.262] * (-543.890) [-541.175] (-540.246) (-541.171) -- 0:01:35
166500 -- (-542.948) (-533.938) [-536.677] (-541.830) * (-539.547) (-537.210) (-537.318) [-534.515] -- 0:01:35
167000 -- (-546.591) [-533.879] (-540.533) (-535.626) * (-541.285) [-537.503] (-536.230) (-539.001) -- 0:01:34
167500 -- (-544.751) (-534.921) [-536.196] (-540.075) * (-544.422) (-547.122) [-540.750] (-540.038) -- 0:01:34
168000 -- (-542.151) (-541.281) (-541.459) [-542.373] * (-541.550) (-545.677) [-536.470] (-544.471) -- 0:01:34
168500 -- [-539.461] (-536.224) (-538.146) (-545.103) * (-543.624) (-537.305) [-533.019] (-548.603) -- 0:01:33
169000 -- [-535.306] (-539.320) (-537.136) (-551.038) * (-538.446) [-538.139] (-535.036) (-544.710) -- 0:01:33
169500 -- [-537.494] (-544.892) (-538.625) (-542.530) * (-538.871) (-541.076) (-537.432) [-541.032] -- 0:01:33
170000 -- (-536.486) (-540.697) [-536.639] (-542.560) * (-541.271) (-547.786) (-542.269) [-535.763] -- 0:01:37
Average standard deviation of split frequencies: 0.002762
170500 -- (-545.701) [-541.903] (-541.799) (-548.424) * (-539.963) (-537.704) (-542.213) [-542.130] -- 0:01:37
171000 -- (-543.719) (-536.194) [-538.913] (-539.969) * [-545.428] (-534.484) (-548.890) (-538.886) -- 0:01:36
171500 -- [-540.698] (-541.274) (-533.315) (-544.001) * (-540.376) (-535.653) [-537.647] (-539.186) -- 0:01:36
172000 -- (-541.068) [-537.614] (-536.451) (-540.134) * (-537.550) (-539.381) (-535.643) [-540.414] -- 0:01:36
172500 -- (-539.738) [-534.689] (-538.179) (-540.883) * [-537.710] (-545.016) (-540.947) (-540.439) -- 0:01:35
173000 -- [-535.035] (-533.740) (-537.938) (-537.088) * [-538.987] (-535.636) (-539.035) (-538.791) -- 0:01:35
173500 -- (-539.172) (-539.853) [-536.673] (-538.744) * (-542.419) [-533.773] (-538.348) (-544.004) -- 0:01:35
174000 -- [-537.348] (-535.273) (-547.715) (-544.855) * (-534.905) (-542.788) [-535.019] (-542.204) -- 0:01:34
174500 -- (-542.614) [-536.250] (-536.733) (-539.028) * (-540.648) (-536.911) (-534.613) [-538.507] -- 0:01:34
175000 -- (-541.576) (-541.379) [-541.546] (-542.532) * (-548.354) [-539.433] (-531.433) (-539.221) -- 0:01:34
Average standard deviation of split frequencies: 0.001339
175500 -- [-536.827] (-531.167) (-544.561) (-544.671) * (-540.170) [-535.009] (-540.198) (-538.289) -- 0:01:33
176000 -- (-534.698) (-536.156) (-542.440) [-542.089] * (-543.703) (-540.088) [-530.581] (-541.694) -- 0:01:33
176500 -- [-533.850] (-534.112) (-542.712) (-538.221) * (-540.809) (-537.119) [-539.069] (-545.588) -- 0:01:33
177000 -- [-536.167] (-538.461) (-537.520) (-539.673) * (-536.644) (-535.047) [-537.543] (-544.599) -- 0:01:32
177500 -- (-544.389) (-536.885) [-539.365] (-538.598) * (-542.844) [-537.256] (-539.211) (-544.428) -- 0:01:32
178000 -- (-543.230) (-533.838) (-541.091) [-536.925] * [-538.743] (-538.235) (-541.918) (-543.660) -- 0:01:32
178500 -- (-541.603) [-534.711] (-540.776) (-535.629) * (-542.066) (-545.646) (-543.478) [-535.901] -- 0:01:36
179000 -- (-539.833) (-533.790) [-543.529] (-536.512) * [-539.753] (-539.831) (-540.753) (-542.397) -- 0:01:36
179500 -- (-535.898) [-535.305] (-542.492) (-537.665) * (-543.194) (-535.679) [-531.083] (-542.087) -- 0:01:35
180000 -- (-538.808) [-533.708] (-544.180) (-539.805) * [-538.090] (-539.906) (-537.260) (-544.649) -- 0:01:35
Average standard deviation of split frequencies: 0.001305
180500 -- [-533.991] (-541.383) (-545.483) (-536.165) * (-549.766) (-542.557) [-531.001] (-543.045) -- 0:01:35
181000 -- (-534.506) (-540.199) (-539.120) [-539.922] * (-542.037) (-537.632) [-534.349] (-539.869) -- 0:01:35
181500 -- [-538.895] (-536.464) (-536.329) (-535.780) * [-548.336] (-536.043) (-536.713) (-538.264) -- 0:01:34
182000 -- (-535.407) (-533.810) (-541.321) [-540.159] * (-545.679) (-537.788) [-539.758] (-543.434) -- 0:01:34
182500 -- (-540.783) [-534.632] (-542.458) (-538.675) * [-537.984] (-538.637) (-538.156) (-549.240) -- 0:01:34
183000 -- (-536.726) [-534.764] (-539.841) (-536.342) * (-538.733) (-539.206) [-541.357] (-547.391) -- 0:01:33
183500 -- (-536.640) [-536.110] (-534.587) (-541.184) * [-539.049] (-547.319) (-545.567) (-538.111) -- 0:01:33
184000 -- [-538.791] (-532.943) (-543.522) (-539.277) * (-550.139) (-540.584) (-541.630) [-539.539] -- 0:01:33
184500 -- (-535.485) (-537.912) (-542.816) [-542.231] * (-535.882) [-541.196] (-540.965) (-541.685) -- 0:01:32
185000 -- (-535.107) [-537.148] (-540.402) (-533.745) * (-537.379) [-540.706] (-544.876) (-542.925) -- 0:01:32
Average standard deviation of split frequencies: 0.001267
185500 -- [-534.649] (-534.309) (-538.568) (-541.764) * (-535.764) (-540.972) [-536.495] (-538.127) -- 0:01:32
186000 -- [-538.005] (-538.622) (-537.254) (-538.628) * (-539.027) [-540.574] (-537.258) (-540.841) -- 0:01:31
186500 -- (-547.630) (-535.577) [-540.528] (-538.172) * [-537.381] (-538.175) (-538.118) (-545.089) -- 0:01:31
187000 -- (-535.823) (-542.220) (-535.065) [-536.460] * (-531.324) [-535.373] (-543.436) (-543.451) -- 0:01:31
187500 -- (-540.915) [-536.984] (-534.010) (-536.471) * (-537.504) [-536.101] (-542.918) (-537.583) -- 0:01:35
188000 -- (-531.860) [-538.976] (-537.613) (-536.889) * (-543.786) (-535.904) (-540.619) [-540.052] -- 0:01:35
188500 -- (-548.311) (-534.503) (-535.130) [-536.727] * (-536.794) (-538.964) (-539.868) [-539.785] -- 0:01:34
189000 -- (-548.021) (-537.863) [-541.463] (-536.422) * [-535.733] (-543.244) (-535.651) (-540.809) -- 0:01:34
189500 -- (-535.573) [-531.904] (-540.777) (-533.277) * (-542.235) (-542.898) [-540.359] (-543.070) -- 0:01:34
190000 -- (-536.833) [-537.439] (-541.518) (-538.626) * (-543.060) (-544.086) (-545.609) [-539.712] -- 0:01:33
Average standard deviation of split frequencies: 0.003709
190500 -- (-544.168) (-534.028) (-550.403) [-536.702] * (-538.924) [-535.654] (-545.126) (-535.635) -- 0:01:33
191000 -- (-533.398) [-545.539] (-548.520) (-540.133) * [-535.588] (-540.582) (-542.476) (-542.447) -- 0:01:33
191500 -- (-535.180) [-535.683] (-543.243) (-544.182) * (-541.404) [-539.567] (-535.645) (-535.594) -- 0:01:32
192000 -- (-536.424) [-537.931] (-543.024) (-536.223) * [-533.280] (-545.181) (-544.806) (-534.100) -- 0:01:32
192500 -- (-538.239) (-539.201) [-545.172] (-537.208) * [-535.229] (-543.069) (-538.111) (-537.803) -- 0:01:32
193000 -- (-542.069) [-539.555] (-542.382) (-536.017) * (-543.342) [-533.205] (-539.589) (-538.629) -- 0:01:31
193500 -- [-535.538] (-542.609) (-550.103) (-542.307) * (-538.037) (-535.538) (-535.459) [-537.324] -- 0:01:31
194000 -- (-537.378) (-541.600) [-544.810] (-541.644) * (-536.737) (-538.951) [-537.431] (-535.459) -- 0:01:31
194500 -- (-538.862) (-540.326) (-542.558) [-534.326] * (-541.124) [-538.110] (-542.465) (-535.216) -- 0:01:31
195000 -- [-536.061] (-538.177) (-541.157) (-539.652) * [-536.480] (-535.636) (-537.804) (-539.187) -- 0:01:30
Average standard deviation of split frequencies: 0.002405
195500 -- (-539.563) (-538.597) (-535.012) [-541.960] * (-540.376) (-542.988) (-541.238) [-534.349] -- 0:01:30
196000 -- (-541.258) (-539.059) (-536.539) [-532.056] * (-541.749) [-534.080] (-539.442) (-533.499) -- 0:01:34
196500 -- [-536.384] (-541.138) (-537.046) (-536.604) * (-541.928) (-539.599) [-538.303] (-540.937) -- 0:01:34
197000 -- [-538.239] (-534.981) (-538.173) (-536.953) * [-536.072] (-539.425) (-535.522) (-537.143) -- 0:01:33
197500 -- (-536.123) (-539.939) (-537.448) [-532.383] * (-543.073) [-538.428] (-538.680) (-542.662) -- 0:01:33
198000 -- [-533.444] (-540.175) (-547.620) (-537.922) * [-543.395] (-534.025) (-535.091) (-547.310) -- 0:01:33
198500 -- (-531.801) (-539.563) [-534.246] (-537.419) * (-539.587) [-536.172] (-549.624) (-535.451) -- 0:01:32
199000 -- (-534.738) (-547.384) (-535.862) [-535.008] * (-541.317) [-536.379] (-539.290) (-537.050) -- 0:01:32
199500 -- (-541.893) (-541.209) (-539.115) [-533.048] * (-539.351) (-534.903) (-543.353) [-538.895] -- 0:01:32
200000 -- (-538.582) (-538.329) (-539.574) [-534.203] * (-536.426) [-535.958] (-539.288) (-544.626) -- 0:01:32
Average standard deviation of split frequencies: 0.003524
200500 -- [-533.036] (-535.938) (-548.354) (-535.614) * (-536.491) [-535.541] (-534.958) (-541.926) -- 0:01:31
201000 -- [-533.220] (-543.591) (-541.263) (-539.209) * (-541.404) [-547.848] (-544.818) (-538.478) -- 0:01:31
201500 -- (-536.351) (-537.524) (-543.673) [-538.535] * (-540.855) (-535.917) (-544.891) [-535.857] -- 0:01:31
202000 -- [-534.306] (-548.628) (-547.278) (-534.082) * (-542.003) [-537.067] (-542.280) (-539.917) -- 0:01:30
202500 -- (-535.038) (-539.934) (-540.460) [-536.226] * [-539.088] (-542.535) (-535.969) (-544.058) -- 0:01:30
203000 -- [-534.508] (-539.971) (-542.472) (-535.293) * (-538.683) [-536.264] (-536.918) (-541.423) -- 0:01:30
203500 -- (-535.024) (-535.580) [-543.091] (-532.991) * [-539.997] (-540.791) (-539.851) (-548.449) -- 0:01:30
204000 -- (-534.796) (-537.010) [-542.334] (-539.908) * [-542.684] (-539.659) (-538.142) (-537.767) -- 0:01:29
204500 -- [-535.622] (-535.078) (-536.909) (-540.907) * (-539.428) (-536.701) [-541.437] (-541.315) -- 0:01:33
205000 -- [-536.746] (-544.090) (-532.124) (-539.215) * (-543.262) (-538.937) (-533.922) [-538.408] -- 0:01:33
Average standard deviation of split frequencies: 0.004577
205500 -- (-537.647) [-534.923] (-534.986) (-544.497) * (-538.431) (-539.601) [-535.696] (-540.545) -- 0:01:32
206000 -- (-538.957) [-539.767] (-539.766) (-540.325) * (-544.647) (-541.107) [-533.035] (-537.874) -- 0:01:32
206500 -- [-534.289] (-534.377) (-534.797) (-543.012) * (-537.722) [-535.035] (-544.463) (-535.201) -- 0:01:32
207000 -- (-538.264) [-537.798] (-542.161) (-542.239) * (-543.148) [-537.806] (-539.233) (-535.665) -- 0:01:31
207500 -- (-545.404) (-534.663) (-537.082) [-535.661] * (-538.534) (-545.322) (-541.567) [-534.817] -- 0:01:31
208000 -- (-534.973) [-535.492] (-540.295) (-534.566) * (-535.062) (-540.252) (-532.061) [-537.266] -- 0:01:31
208500 -- [-538.618] (-536.768) (-534.944) (-531.651) * (-537.980) (-546.516) (-532.021) [-535.160] -- 0:01:31
209000 -- (-539.646) (-535.639) (-544.515) [-532.810] * [-540.730] (-540.892) (-531.599) (-532.992) -- 0:01:30
209500 -- (-535.151) (-531.681) (-542.600) [-533.149] * (-542.906) (-544.760) (-536.905) [-540.158] -- 0:01:30
210000 -- (-535.091) (-543.047) [-540.045] (-531.278) * [-535.774] (-538.326) (-534.715) (-535.824) -- 0:01:30
Average standard deviation of split frequencies: 0.002238
210500 -- [-533.553] (-538.368) (-538.642) (-537.482) * (-541.834) (-539.177) [-538.265] (-540.879) -- 0:01:30
211000 -- (-535.103) (-533.886) [-535.711] (-536.905) * (-540.648) (-540.068) (-533.471) [-537.039] -- 0:01:29
211500 -- (-536.826) (-540.825) [-533.230] (-529.470) * [-537.476] (-544.627) (-535.687) (-536.261) -- 0:01:29
212000 -- (-537.533) [-534.593] (-537.912) (-539.494) * (-538.657) (-546.555) [-536.100] (-538.151) -- 0:01:29
212500 -- [-533.910] (-537.144) (-537.103) (-535.705) * (-536.314) (-536.756) [-534.068] (-538.549) -- 0:01:28
213000 -- (-534.383) (-534.297) (-541.656) [-534.399] * [-536.627] (-541.100) (-531.417) (-540.906) -- 0:01:28
213500 -- (-539.832) (-543.390) (-533.406) [-532.533] * (-539.277) (-542.675) (-535.130) [-536.892] -- 0:01:32
214000 -- (-534.199) [-539.234] (-534.193) (-547.114) * (-543.298) [-540.315] (-538.923) (-543.478) -- 0:01:31
214500 -- (-535.844) (-536.382) (-543.100) [-536.244] * (-536.817) (-550.076) [-531.348] (-539.513) -- 0:01:31
215000 -- [-532.313] (-536.469) (-538.074) (-535.914) * (-541.368) (-539.595) [-538.195] (-541.626) -- 0:01:31
Average standard deviation of split frequencies: 0.002182
215500 -- (-532.250) [-536.309] (-533.916) (-537.284) * [-535.620] (-544.266) (-535.800) (-535.748) -- 0:01:31
216000 -- (-532.194) [-534.168] (-537.410) (-544.748) * (-534.147) (-542.362) (-535.433) [-536.235] -- 0:01:30
216500 -- (-535.750) (-534.704) (-541.601) [-541.128] * [-537.070] (-545.350) (-543.644) (-538.747) -- 0:01:30
217000 -- (-535.510) (-537.603) [-534.738] (-537.412) * [-541.381] (-543.130) (-531.542) (-544.644) -- 0:01:30
217500 -- (-534.372) (-544.699) (-536.418) [-540.617] * (-538.982) (-541.065) (-538.168) [-545.294] -- 0:01:29
218000 -- (-544.888) (-532.744) (-541.917) [-541.751] * (-539.750) (-540.857) [-537.751] (-537.951) -- 0:01:29
218500 -- (-539.030) [-534.459] (-539.457) (-539.322) * (-538.406) [-534.594] (-537.480) (-535.723) -- 0:01:29
219000 -- [-534.304] (-532.085) (-535.158) (-550.863) * (-539.511) (-539.215) (-540.712) [-535.833] -- 0:01:29
219500 -- (-532.804) (-533.065) [-536.603] (-542.501) * (-539.268) (-538.677) (-537.596) [-532.740] -- 0:01:28
220000 -- (-538.811) [-538.577] (-538.081) (-543.455) * [-537.134] (-541.705) (-538.881) (-535.457) -- 0:01:28
Average standard deviation of split frequencies: 0.003204
220500 -- (-540.760) (-534.263) (-544.473) [-538.509] * (-541.792) (-536.144) [-535.437] (-537.676) -- 0:01:28
221000 -- [-537.755] (-540.391) (-537.462) (-535.038) * (-540.194) (-542.177) (-536.241) [-533.986] -- 0:01:28
221500 -- (-532.383) (-535.679) [-539.575] (-534.557) * (-539.838) (-547.555) (-539.544) [-530.120] -- 0:01:27
222000 -- (-536.198) (-537.767) (-541.197) [-536.238] * (-536.024) (-539.697) (-538.751) [-533.445] -- 0:01:31
222500 -- (-534.935) (-535.909) (-538.643) [-537.445] * (-543.141) [-535.897] (-538.161) (-543.408) -- 0:01:30
223000 -- (-545.430) (-538.309) (-539.457) [-536.880] * (-542.803) [-540.246] (-539.940) (-535.114) -- 0:01:30
223500 -- [-533.252] (-532.334) (-541.953) (-535.011) * (-536.342) (-541.154) (-540.228) [-534.718] -- 0:01:30
224000 -- [-533.494] (-532.926) (-549.193) (-533.625) * (-537.634) (-549.202) [-543.285] (-546.751) -- 0:01:30
224500 -- (-543.591) [-535.789] (-539.310) (-533.518) * (-542.992) (-538.056) [-537.286] (-540.721) -- 0:01:29
225000 -- (-543.238) (-533.690) [-537.014] (-537.054) * (-540.600) (-544.273) (-535.925) [-536.428] -- 0:01:29
Average standard deviation of split frequencies: 0.001043
225500 -- [-535.972] (-541.807) (-542.852) (-537.157) * [-537.998] (-537.966) (-535.886) (-552.080) -- 0:01:29
226000 -- (-544.371) [-538.092] (-557.560) (-535.744) * [-539.956] (-537.690) (-534.816) (-536.477) -- 0:01:29
226500 -- [-540.146] (-538.498) (-541.497) (-538.763) * (-549.341) (-534.251) [-538.415] (-533.013) -- 0:01:28
227000 -- (-532.482) (-543.372) (-538.407) [-531.913] * (-542.120) (-542.685) (-541.980) [-535.655] -- 0:01:28
227500 -- (-540.095) (-544.490) (-536.448) [-538.363] * (-539.951) (-545.755) (-536.660) [-536.345] -- 0:01:28
228000 -- (-539.184) [-533.820] (-540.757) (-535.937) * (-543.300) (-538.732) [-535.332] (-535.425) -- 0:01:28
228500 -- (-535.660) [-537.416] (-543.063) (-536.850) * (-533.313) (-541.983) [-534.841] (-537.951) -- 0:01:27
229000 -- [-536.267] (-535.762) (-546.321) (-536.124) * (-536.088) (-543.872) (-532.512) [-531.487] -- 0:01:27
229500 -- (-536.559) (-533.358) [-538.272] (-538.236) * (-543.423) (-544.989) (-535.957) [-535.060] -- 0:01:27
230000 -- (-535.366) (-534.026) (-543.415) [-537.610] * (-540.914) (-541.444) [-534.783] (-534.902) -- 0:01:27
Average standard deviation of split frequencies: 0.002044
230500 -- (-536.339) (-543.243) (-541.519) [-535.324] * (-541.210) (-536.954) [-540.445] (-540.208) -- 0:01:26
231000 -- (-537.857) [-536.196] (-540.025) (-534.910) * (-543.741) (-536.073) (-539.575) [-532.858] -- 0:01:29
231500 -- (-539.005) (-540.659) (-540.083) [-533.452] * (-540.614) (-537.769) [-539.025] (-534.937) -- 0:01:29
232000 -- (-538.669) (-540.657) (-538.047) [-536.582] * [-536.688] (-537.158) (-534.998) (-535.776) -- 0:01:29
232500 -- (-536.549) (-537.377) (-547.149) [-539.666] * (-533.578) (-539.442) (-537.256) [-532.077] -- 0:01:29
233000 -- (-534.115) (-539.159) (-537.707) [-537.929] * (-538.993) [-537.174] (-534.187) (-534.950) -- 0:01:28
233500 -- (-542.076) [-540.998] (-541.896) (-539.161) * (-540.813) (-537.646) (-538.137) [-533.704] -- 0:01:28
234000 -- [-533.579] (-544.334) (-536.355) (-540.754) * (-541.300) (-542.664) (-539.287) [-531.273] -- 0:01:28
234500 -- (-539.717) (-539.525) [-539.989] (-534.679) * (-538.724) (-540.757) [-535.856] (-539.441) -- 0:01:28
235000 -- (-538.019) [-533.623] (-545.225) (-542.035) * (-537.613) (-534.027) [-537.620] (-543.762) -- 0:01:27
Average standard deviation of split frequencies: 0.002996
235500 -- [-534.424] (-537.728) (-545.911) (-542.451) * [-536.841] (-537.063) (-537.079) (-534.455) -- 0:01:27
236000 -- (-538.003) (-540.717) (-539.405) [-540.477] * (-539.603) [-539.678] (-540.422) (-534.273) -- 0:01:27
236500 -- [-533.843] (-534.790) (-548.984) (-545.472) * (-535.964) (-538.583) (-540.743) [-534.314] -- 0:01:27
237000 -- [-537.924] (-537.284) (-542.855) (-538.354) * [-541.751] (-549.603) (-544.395) (-534.642) -- 0:01:26
237500 -- [-532.860] (-541.017) (-539.959) (-543.589) * (-540.114) (-542.032) [-538.485] (-536.678) -- 0:01:26
238000 -- (-540.906) [-536.264] (-548.507) (-544.172) * (-534.615) [-540.399] (-536.101) (-538.919) -- 0:01:26
238500 -- [-533.377] (-533.654) (-538.679) (-534.741) * (-534.917) (-536.919) (-534.310) [-538.973] -- 0:01:26
239000 -- (-541.074) (-541.746) (-537.903) [-534.206] * (-535.086) [-534.858] (-536.615) (-537.909) -- 0:01:25
239500 -- (-534.136) (-543.852) [-549.913] (-539.498) * (-535.174) [-536.398] (-539.025) (-533.452) -- 0:01:25
240000 -- [-538.492] (-542.109) (-541.331) (-535.723) * [-537.677] (-542.798) (-540.232) (-538.378) -- 0:01:28
Average standard deviation of split frequencies: 0.002938
240500 -- [-535.851] (-543.149) (-540.787) (-536.617) * (-545.642) (-544.012) (-540.951) [-530.947] -- 0:01:28
241000 -- (-539.100) (-540.209) [-531.783] (-535.634) * (-534.706) [-538.504] (-540.125) (-536.700) -- 0:01:28
241500 -- (-536.476) (-539.295) (-532.722) [-535.990] * (-532.849) (-537.904) (-546.496) [-542.051] -- 0:01:27
242000 -- (-542.811) [-539.008] (-545.394) (-536.725) * [-536.864] (-543.439) (-541.771) (-537.358) -- 0:01:27
242500 -- (-539.663) (-540.274) (-535.258) [-533.176] * (-541.501) (-543.663) (-542.316) [-534.245] -- 0:01:27
243000 -- [-533.651] (-542.638) (-537.078) (-537.937) * [-544.836] (-539.401) (-540.342) (-531.144) -- 0:01:27
243500 -- (-541.644) (-536.346) (-534.508) [-536.380] * (-530.392) [-538.055] (-537.610) (-538.888) -- 0:01:26
244000 -- (-533.312) [-538.337] (-541.000) (-538.121) * [-538.242] (-538.522) (-539.418) (-537.148) -- 0:01:26
244500 -- (-541.269) (-541.546) (-536.822) [-537.394] * (-533.829) (-539.054) (-550.701) [-539.001] -- 0:01:26
245000 -- (-536.340) (-538.153) (-543.155) [-534.430] * (-544.963) (-536.938) (-538.730) [-538.003] -- 0:01:26
Average standard deviation of split frequencies: 0.003833
245500 -- (-541.887) (-534.199) (-541.261) [-535.887] * (-540.024) [-538.426] (-540.655) (-537.555) -- 0:01:26
246000 -- (-535.830) (-538.461) [-535.515] (-537.027) * [-536.056] (-536.439) (-541.760) (-536.858) -- 0:01:25
246500 -- (-536.449) (-540.316) [-536.151] (-538.341) * (-539.924) (-534.700) (-543.109) [-532.845] -- 0:01:25
247000 -- (-539.730) (-532.166) [-536.464] (-538.916) * [-539.583] (-538.322) (-539.565) (-536.394) -- 0:01:25
247500 -- (-534.389) [-537.603] (-535.609) (-537.385) * [-533.201] (-542.089) (-540.950) (-535.140) -- 0:01:25
248000 -- (-533.456) [-534.768] (-537.915) (-546.968) * (-534.831) [-537.880] (-540.217) (-535.381) -- 0:01:24
248500 -- (-540.148) [-534.822] (-533.005) (-538.702) * (-536.751) (-538.046) (-536.524) [-536.751] -- 0:01:27
249000 -- (-537.789) (-541.222) [-532.335] (-538.412) * (-536.583) (-533.120) (-542.291) [-531.347] -- 0:01:27
249500 -- (-540.408) [-532.251] (-542.001) (-541.187) * (-538.184) (-532.985) (-540.244) [-535.194] -- 0:01:27
250000 -- [-533.995] (-537.027) (-540.619) (-541.273) * (-541.440) (-534.161) (-539.338) [-536.976] -- 0:01:27
Average standard deviation of split frequencies: 0.003761
250500 -- (-537.905) [-536.628] (-540.465) (-542.278) * [-537.311] (-532.133) (-535.932) (-547.030) -- 0:01:26
251000 -- (-535.327) [-531.447] (-535.691) (-538.552) * [-539.499] (-551.024) (-535.226) (-538.300) -- 0:01:26
251500 -- [-535.200] (-537.636) (-535.116) (-535.070) * (-541.612) (-537.742) [-536.431] (-538.307) -- 0:01:26
252000 -- (-536.490) (-535.308) [-534.554] (-543.464) * (-539.530) [-540.256] (-535.133) (-539.485) -- 0:01:26
252500 -- [-535.590] (-535.089) (-539.947) (-539.509) * [-537.376] (-539.518) (-544.182) (-537.534) -- 0:01:25
253000 -- (-537.058) [-537.885] (-544.265) (-541.080) * (-541.542) (-540.482) (-540.545) [-536.254] -- 0:01:25
253500 -- (-542.660) (-531.799) [-535.753] (-541.305) * [-541.541] (-537.263) (-539.809) (-543.896) -- 0:01:25
254000 -- (-535.164) [-536.604] (-536.593) (-536.901) * (-535.786) (-542.133) [-536.792] (-538.837) -- 0:01:25
254500 -- (-544.119) (-540.220) [-539.135] (-537.004) * (-536.449) [-539.169] (-538.268) (-533.302) -- 0:01:24
255000 -- (-542.395) (-537.012) (-540.898) [-532.001] * (-535.511) (-536.568) [-540.801] (-534.653) -- 0:01:24
Average standard deviation of split frequencies: 0.004604
255500 -- [-532.683] (-539.929) (-534.418) (-540.942) * (-541.536) (-539.836) (-539.895) [-536.097] -- 0:01:24
256000 -- (-534.484) (-537.000) [-531.113] (-534.829) * [-538.623] (-544.201) (-536.143) (-536.881) -- 0:01:24
256500 -- [-540.087] (-543.764) (-535.266) (-543.053) * (-540.619) [-537.017] (-544.062) (-540.148) -- 0:01:24
257000 -- (-534.909) [-534.965] (-539.057) (-538.945) * (-546.430) (-536.363) (-540.672) [-536.413] -- 0:01:26
257500 -- (-538.221) [-533.046] (-533.385) (-540.492) * (-539.586) [-538.141] (-536.042) (-536.647) -- 0:01:26
258000 -- (-534.768) (-534.535) (-532.640) [-534.336] * (-537.515) [-534.716] (-540.893) (-542.231) -- 0:01:26
258500 -- [-534.046] (-534.587) (-538.243) (-535.976) * (-548.202) (-535.060) (-535.223) [-537.428] -- 0:01:26
259000 -- [-532.419] (-546.196) (-540.126) (-540.870) * (-546.820) (-537.092) (-535.591) [-537.567] -- 0:01:25
259500 -- [-538.487] (-537.087) (-538.497) (-545.485) * (-542.981) (-537.502) [-539.513] (-541.803) -- 0:01:25
260000 -- [-534.295] (-535.687) (-537.809) (-544.392) * (-544.462) [-536.897] (-535.714) (-541.259) -- 0:01:25
Average standard deviation of split frequencies: 0.005425
260500 -- (-536.723) (-533.795) (-544.825) [-536.361] * (-548.293) (-537.805) [-535.741] (-537.208) -- 0:01:25
261000 -- [-541.588] (-538.353) (-540.170) (-533.888) * (-541.417) (-538.884) (-538.122) [-538.271] -- 0:01:24
261500 -- [-543.986] (-539.234) (-537.003) (-538.825) * (-540.690) (-541.071) [-536.393] (-537.689) -- 0:01:24
262000 -- (-536.649) (-535.917) [-536.989] (-541.188) * (-543.656) (-536.801) (-531.545) [-539.171] -- 0:01:24
262500 -- (-540.684) (-532.416) (-537.086) [-546.835] * (-537.843) [-548.536] (-540.457) (-537.534) -- 0:01:24
263000 -- (-534.562) (-535.012) [-533.661] (-543.357) * [-539.789] (-535.358) (-536.545) (-534.340) -- 0:01:24
263500 -- (-541.697) (-537.690) (-534.353) [-536.098] * (-532.925) (-541.271) (-535.865) [-536.491] -- 0:01:23
264000 -- [-535.905] (-538.054) (-540.784) (-539.324) * [-534.501] (-536.488) (-538.268) (-545.860) -- 0:01:23
264500 -- (-538.175) (-534.311) (-539.608) [-538.947] * [-537.143] (-540.917) (-547.244) (-537.257) -- 0:01:23
265000 -- (-541.095) (-540.492) (-533.150) [-540.082] * (-537.708) (-542.185) [-536.887] (-538.412) -- 0:01:23
Average standard deviation of split frequencies: 0.005317
265500 -- [-532.148] (-538.764) (-542.635) (-537.670) * (-534.819) (-545.354) (-534.720) [-535.582] -- 0:01:22
266000 -- (-534.265) [-535.664] (-537.623) (-537.197) * (-536.358) (-544.712) (-534.668) [-535.257] -- 0:01:25
266500 -- (-532.766) (-538.704) (-537.986) [-540.354] * (-535.426) (-537.387) [-533.949] (-538.265) -- 0:01:25
267000 -- (-532.986) (-536.279) [-537.558] (-543.649) * [-541.956] (-537.064) (-534.193) (-537.959) -- 0:01:25
267500 -- (-536.929) (-544.531) [-542.176] (-538.770) * [-539.083] (-544.159) (-538.228) (-542.599) -- 0:01:24
268000 -- (-532.871) (-545.957) (-540.985) [-535.293] * (-542.187) (-541.037) (-539.906) [-548.759] -- 0:01:24
268500 -- (-539.444) (-533.911) [-538.666] (-532.738) * [-536.391] (-537.764) (-537.146) (-538.850) -- 0:01:24
269000 -- (-538.385) (-538.970) (-534.895) [-534.513] * (-542.524) (-535.313) [-534.344] (-537.275) -- 0:01:24
269500 -- (-532.882) [-534.640] (-534.291) (-533.803) * [-544.605] (-540.674) (-540.822) (-539.820) -- 0:01:24
270000 -- (-537.525) [-536.229] (-540.467) (-540.159) * (-540.774) (-543.270) [-545.984] (-539.799) -- 0:01:23
Average standard deviation of split frequencies: 0.006967
270500 -- (-536.169) (-534.308) (-536.546) [-536.838] * (-540.022) [-536.891] (-543.672) (-539.931) -- 0:01:23
271000 -- (-539.741) [-534.537] (-543.510) (-540.861) * (-544.771) [-537.971] (-535.518) (-540.747) -- 0:01:23
271500 -- (-541.486) (-539.497) (-537.118) [-539.822] * (-538.530) [-536.805] (-537.368) (-537.362) -- 0:01:23
272000 -- [-539.684] (-532.351) (-534.752) (-546.013) * [-534.089] (-535.825) (-540.130) (-536.902) -- 0:01:22
272500 -- (-534.581) (-534.276) (-534.433) [-538.063] * (-539.727) (-538.215) [-532.478] (-538.347) -- 0:01:22
273000 -- (-537.778) [-536.523] (-536.709) (-543.975) * (-541.820) [-535.835] (-533.758) (-537.280) -- 0:01:22
273500 -- (-536.140) (-543.951) [-533.910] (-539.631) * [-542.702] (-533.812) (-538.910) (-539.639) -- 0:01:22
274000 -- (-534.250) [-535.646] (-541.137) (-540.372) * (-540.886) (-536.441) [-538.514] (-540.056) -- 0:01:22
274500 -- (-533.986) (-534.236) [-535.415] (-535.522) * (-549.161) (-538.042) [-537.331] (-535.810) -- 0:01:24
275000 -- (-536.289) [-532.791] (-539.205) (-533.835) * [-534.870] (-546.918) (-536.114) (-538.235) -- 0:01:24
Average standard deviation of split frequencies: 0.005978
275500 -- (-539.485) (-533.942) [-534.729] (-540.151) * (-541.016) [-536.616] (-538.871) (-537.258) -- 0:01:24
276000 -- (-533.380) [-535.734] (-538.049) (-533.831) * [-534.511] (-535.490) (-531.627) (-545.047) -- 0:01:23
276500 -- (-545.826) (-546.168) [-537.995] (-544.116) * [-536.003] (-541.770) (-541.113) (-543.764) -- 0:01:23
277000 -- (-534.704) [-540.323] (-535.822) (-540.221) * [-533.510] (-538.951) (-533.366) (-538.230) -- 0:01:23
277500 -- [-537.159] (-535.230) (-541.670) (-537.801) * (-537.325) [-537.529] (-536.657) (-540.391) -- 0:01:23
278000 -- (-532.607) [-541.227] (-536.325) (-545.144) * (-543.794) [-535.358] (-543.121) (-538.826) -- 0:01:23
278500 -- (-535.235) [-532.453] (-533.765) (-539.869) * [-535.354] (-534.910) (-538.891) (-544.951) -- 0:01:22
279000 -- (-543.747) (-535.298) (-533.836) [-535.160] * (-534.557) (-542.373) (-534.715) [-543.344] -- 0:01:22
279500 -- (-546.974) (-536.001) [-534.376] (-533.012) * [-535.887] (-538.013) (-536.173) (-540.881) -- 0:01:22
280000 -- (-554.933) (-536.160) (-535.399) [-533.971] * (-536.241) (-533.978) [-536.569] (-537.169) -- 0:01:22
Average standard deviation of split frequencies: 0.005879
280500 -- (-539.512) [-535.414] (-532.954) (-538.802) * (-537.360) (-535.953) [-533.200] (-542.305) -- 0:01:22
281000 -- [-539.769] (-530.914) (-538.156) (-536.025) * (-535.434) (-536.466) (-534.885) [-537.914] -- 0:01:21
281500 -- (-538.582) (-535.331) (-536.724) [-540.711] * (-535.249) (-532.774) (-536.854) [-538.874] -- 0:01:21
282000 -- (-540.238) [-538.449] (-534.394) (-540.692) * (-540.043) (-533.482) (-533.416) [-534.704] -- 0:01:21
282500 -- [-535.026] (-536.398) (-537.175) (-534.945) * (-547.639) [-543.959] (-535.587) (-536.881) -- 0:01:21
283000 -- (-540.668) (-536.977) (-537.860) [-536.854] * (-539.998) (-539.488) [-539.111] (-537.630) -- 0:01:23
283500 -- (-538.336) (-538.426) (-543.819) [-537.120] * (-540.541) [-539.469] (-547.437) (-534.991) -- 0:01:23
284000 -- [-533.994] (-534.845) (-538.973) (-537.366) * (-544.099) [-537.396] (-544.596) (-539.187) -- 0:01:23
284500 -- (-538.147) (-537.766) [-537.512] (-537.682) * [-535.030] (-531.352) (-542.734) (-540.492) -- 0:01:22
285000 -- [-537.975] (-539.703) (-539.413) (-540.634) * [-539.746] (-536.530) (-545.274) (-538.223) -- 0:01:22
Average standard deviation of split frequencies: 0.006593
285500 -- [-538.004] (-532.320) (-541.451) (-536.547) * (-538.361) [-543.066] (-544.537) (-548.159) -- 0:01:22
286000 -- (-545.285) (-538.764) [-533.467] (-535.117) * [-548.700] (-537.533) (-542.154) (-540.823) -- 0:01:22
286500 -- (-539.150) (-542.259) (-543.652) [-536.187] * (-544.296) [-538.614] (-549.050) (-537.157) -- 0:01:22
287000 -- (-535.502) (-538.380) [-541.231] (-537.360) * (-532.488) [-538.112] (-544.984) (-540.856) -- 0:01:21
287500 -- (-544.606) (-539.274) (-538.505) [-540.421] * (-535.597) (-537.122) (-543.195) [-537.913] -- 0:01:21
288000 -- (-538.145) (-539.188) (-542.506) [-539.501] * [-535.736] (-534.605) (-542.269) (-537.148) -- 0:01:21
288500 -- [-534.429] (-531.831) (-541.279) (-539.516) * (-532.977) [-537.745] (-550.526) (-541.399) -- 0:01:21
289000 -- (-537.525) (-535.809) [-540.320] (-541.299) * (-546.517) [-533.718] (-547.256) (-541.625) -- 0:01:21
289500 -- (-537.044) (-546.089) [-541.315] (-538.297) * (-543.879) (-537.205) (-546.865) [-540.614] -- 0:01:20
290000 -- [-532.053] (-533.537) (-541.551) (-536.914) * (-539.113) [-535.185] (-547.934) (-539.538) -- 0:01:20
Average standard deviation of split frequencies: 0.007298
290500 -- [-539.305] (-533.676) (-542.139) (-541.444) * (-535.520) (-545.133) (-543.696) [-536.509] -- 0:01:20
291000 -- (-535.891) [-533.457] (-539.531) (-529.997) * [-534.902] (-535.531) (-544.999) (-540.957) -- 0:01:20
291500 -- (-533.437) (-532.361) [-539.924] (-535.029) * (-535.047) [-535.698] (-544.766) (-542.270) -- 0:01:20
292000 -- (-535.877) [-532.248] (-543.558) (-539.558) * (-532.542) (-536.268) [-543.336] (-537.331) -- 0:01:22
292500 -- [-535.907] (-532.656) (-538.707) (-540.002) * (-535.985) (-537.115) (-543.334) [-538.484] -- 0:01:22
293000 -- [-534.243] (-539.816) (-540.443) (-537.297) * [-536.611] (-536.959) (-541.455) (-536.126) -- 0:01:22
293500 -- (-534.617) [-535.437] (-542.473) (-537.917) * (-538.469) [-535.584] (-538.488) (-535.508) -- 0:01:21
294000 -- (-533.858) (-541.903) (-542.612) [-540.582] * [-541.964] (-541.223) (-539.343) (-535.976) -- 0:01:21
294500 -- [-535.397] (-534.627) (-544.330) (-540.862) * [-535.430] (-538.721) (-534.915) (-537.069) -- 0:01:21
295000 -- [-534.521] (-538.103) (-536.502) (-535.868) * (-537.761) (-540.746) (-541.737) [-540.950] -- 0:01:21
Average standard deviation of split frequencies: 0.007167
295500 -- [-535.881] (-534.427) (-542.761) (-537.974) * (-539.755) [-535.159] (-539.865) (-541.098) -- 0:01:21
296000 -- [-542.801] (-537.861) (-539.942) (-538.464) * [-541.559] (-541.841) (-538.195) (-537.332) -- 0:01:20
296500 -- (-540.246) (-540.347) [-538.130] (-537.722) * (-537.868) [-534.780] (-538.634) (-536.749) -- 0:01:20
297000 -- [-536.638] (-538.647) (-536.873) (-539.714) * (-538.259) (-548.173) [-539.690] (-536.423) -- 0:01:20
297500 -- [-537.355] (-533.609) (-539.301) (-535.645) * (-539.708) (-545.839) (-547.942) [-536.644] -- 0:01:20
298000 -- (-534.147) (-536.348) (-538.376) [-532.901] * [-539.553] (-544.142) (-539.890) (-535.059) -- 0:01:20
298500 -- [-533.520] (-535.983) (-536.967) (-539.000) * (-539.805) (-541.704) (-545.578) [-533.341] -- 0:01:19
299000 -- (-537.222) (-534.791) (-539.151) [-534.597] * (-544.925) [-539.712] (-540.796) (-534.148) -- 0:01:19
299500 -- (-535.499) (-539.904) [-538.276] (-539.216) * (-540.196) (-538.646) (-543.097) [-538.417] -- 0:01:19
300000 -- (-538.830) (-542.393) [-548.116] (-532.305) * [-538.654] (-541.631) (-536.834) (-535.943) -- 0:01:19
Average standard deviation of split frequencies: 0.006271
300500 -- (-539.735) (-541.602) [-532.941] (-532.225) * (-551.116) [-542.582] (-540.891) (-538.705) -- 0:01:21
301000 -- (-534.129) [-532.089] (-535.363) (-535.283) * (-539.047) (-543.369) (-536.807) [-539.838] -- 0:01:21
301500 -- (-546.879) (-540.509) [-544.090] (-539.578) * [-546.028] (-543.081) (-535.688) (-535.628) -- 0:01:21
302000 -- [-540.227] (-537.395) (-541.351) (-538.609) * [-542.427] (-539.087) (-535.925) (-538.433) -- 0:01:20
302500 -- [-532.316] (-533.075) (-538.737) (-538.679) * [-543.804] (-536.057) (-535.495) (-543.366) -- 0:01:20
303000 -- (-532.113) (-538.047) [-541.689] (-534.327) * (-537.294) [-540.493] (-541.364) (-538.466) -- 0:01:20
303500 -- [-534.473] (-545.274) (-545.557) (-537.480) * (-540.488) (-543.915) [-536.512] (-541.092) -- 0:01:20
304000 -- (-541.416) (-533.357) [-542.281] (-533.944) * (-542.319) (-546.201) [-534.325] (-538.083) -- 0:01:20
304500 -- (-535.733) [-534.273] (-539.756) (-532.944) * (-538.487) (-543.928) (-533.720) [-537.959] -- 0:01:19
305000 -- (-543.588) (-538.844) [-537.874] (-540.356) * [-536.450] (-541.390) (-541.364) (-548.200) -- 0:01:19
Average standard deviation of split frequencies: 0.006162
305500 -- (-536.512) (-538.269) (-540.130) [-535.584] * (-536.837) (-541.112) (-547.942) [-535.569] -- 0:01:19
306000 -- [-536.471] (-533.789) (-537.606) (-532.832) * (-539.972) [-538.937] (-535.834) (-541.782) -- 0:01:19
306500 -- (-536.837) [-537.756] (-535.278) (-535.371) * [-539.730] (-537.499) (-541.445) (-535.068) -- 0:01:19
307000 -- (-540.519) (-534.891) (-538.848) [-529.774] * [-541.353] (-539.877) (-539.436) (-538.621) -- 0:01:19
307500 -- (-536.521) (-538.332) [-538.803] (-544.272) * [-539.200] (-545.969) (-535.993) (-536.120) -- 0:01:18
308000 -- (-538.673) (-537.862) (-536.297) [-532.870] * [-538.197] (-544.624) (-533.581) (-541.211) -- 0:01:18
308500 -- [-529.801] (-535.665) (-538.339) (-534.739) * [-540.467] (-541.620) (-535.083) (-549.509) -- 0:01:18
309000 -- (-536.189) (-536.186) (-536.770) [-539.629] * (-535.276) [-540.738] (-535.712) (-539.899) -- 0:01:18
309500 -- (-535.558) (-538.724) [-533.416] (-535.352) * (-541.133) (-540.894) (-538.080) [-541.240] -- 0:01:20
310000 -- (-533.037) [-537.411] (-538.288) (-541.654) * [-542.011] (-534.549) (-538.959) (-540.220) -- 0:01:20
Average standard deviation of split frequencies: 0.005311
310500 -- (-542.223) (-544.859) [-533.554] (-543.064) * (-540.237) (-541.978) (-537.785) [-536.568] -- 0:01:19
311000 -- [-536.469] (-540.267) (-539.313) (-539.703) * [-539.030] (-540.143) (-533.913) (-553.851) -- 0:01:19
311500 -- (-531.400) (-539.744) (-534.811) [-541.855] * [-538.492] (-553.257) (-538.972) (-545.576) -- 0:01:19
312000 -- (-539.038) (-532.981) [-539.713] (-536.244) * (-538.135) [-541.514] (-539.208) (-547.101) -- 0:01:19
312500 -- (-534.551) (-533.897) [-533.581] (-532.959) * (-541.027) [-538.063] (-541.953) (-543.903) -- 0:01:19
313000 -- (-538.444) (-543.320) (-536.618) [-535.230] * [-538.225] (-536.987) (-538.598) (-553.222) -- 0:01:19
313500 -- (-537.924) (-544.141) (-537.954) [-535.171] * (-536.737) (-545.653) [-538.153] (-541.777) -- 0:01:18
314000 -- (-539.578) [-537.944] (-536.018) (-533.140) * (-536.336) (-538.351) [-535.310] (-539.316) -- 0:01:18
314500 -- [-537.414] (-535.927) (-538.260) (-540.148) * [-535.927] (-539.620) (-541.698) (-544.621) -- 0:01:18
315000 -- [-536.180] (-542.685) (-538.706) (-544.087) * (-539.042) (-538.403) (-542.154) [-541.249] -- 0:01:18
Average standard deviation of split frequencies: 0.005967
315500 -- (-534.942) (-532.365) [-540.458] (-541.830) * [-537.663] (-534.948) (-538.189) (-538.692) -- 0:01:18
316000 -- [-534.098] (-532.804) (-535.706) (-536.746) * (-541.893) (-539.088) [-540.598] (-538.143) -- 0:01:17
316500 -- (-537.351) [-542.161] (-539.331) (-543.260) * (-539.131) (-543.360) [-539.036] (-534.869) -- 0:01:17
317000 -- (-535.066) (-536.782) (-538.983) [-537.728] * (-543.682) (-543.694) [-539.548] (-544.471) -- 0:01:17
317500 -- (-543.457) (-544.423) [-534.806] (-540.380) * (-534.086) (-537.861) (-539.385) [-541.856] -- 0:01:17
318000 -- [-536.741] (-536.122) (-537.860) (-535.767) * (-541.882) (-537.854) (-536.077) [-539.649] -- 0:01:19
318500 -- (-538.959) (-536.097) [-532.821] (-539.898) * (-529.854) [-537.454] (-540.759) (-536.939) -- 0:01:19
319000 -- [-534.872] (-536.275) (-542.052) (-535.935) * (-536.939) [-534.198] (-552.606) (-533.740) -- 0:01:18
319500 -- (-535.588) (-539.224) (-534.970) [-533.656] * (-536.741) (-537.097) (-540.647) [-537.473] -- 0:01:18
320000 -- (-533.473) (-547.408) (-537.407) [-536.040] * (-535.853) (-533.965) (-543.955) [-535.925] -- 0:01:18
Average standard deviation of split frequencies: 0.005880
320500 -- (-535.958) (-540.691) (-533.884) [-540.324] * (-533.039) (-545.859) (-540.175) [-538.596] -- 0:01:18
321000 -- [-535.329] (-536.696) (-538.591) (-536.365) * (-534.924) (-539.288) (-541.887) [-537.966] -- 0:01:18
321500 -- (-534.181) (-541.788) [-533.974] (-535.954) * [-536.678] (-537.980) (-543.450) (-532.188) -- 0:01:18
322000 -- (-535.872) [-536.113] (-542.622) (-544.349) * [-534.872] (-539.975) (-545.170) (-541.785) -- 0:01:17
322500 -- [-534.949] (-536.741) (-538.738) (-537.415) * (-541.392) (-532.866) [-537.665] (-536.458) -- 0:01:17
323000 -- [-537.310] (-539.453) (-538.825) (-540.625) * (-544.158) (-536.022) [-537.386] (-540.230) -- 0:01:17
323500 -- [-539.813] (-537.576) (-538.783) (-536.566) * (-542.628) (-538.049) (-537.671) [-533.203] -- 0:01:17
324000 -- [-533.545] (-541.245) (-540.503) (-535.952) * (-538.315) (-544.577) (-537.804) [-537.306] -- 0:01:17
324500 -- [-537.974] (-542.308) (-533.141) (-535.929) * (-539.399) (-540.241) [-537.200] (-541.088) -- 0:01:17
325000 -- (-536.481) [-536.098] (-534.661) (-539.234) * (-539.522) (-537.270) (-533.303) [-532.857] -- 0:01:16
Average standard deviation of split frequencies: 0.006507
325500 -- (-536.180) (-539.722) (-538.859) [-532.869] * (-542.228) [-534.575] (-538.104) (-542.025) -- 0:01:16
326000 -- [-536.271] (-533.527) (-535.472) (-539.743) * (-542.229) (-536.555) (-532.250) [-539.754] -- 0:01:16
326500 -- (-538.556) [-532.989] (-536.550) (-536.994) * (-537.298) [-536.475] (-540.280) (-543.498) -- 0:01:16
327000 -- (-539.688) [-543.693] (-535.139) (-532.483) * [-546.810] (-547.326) (-540.064) (-539.424) -- 0:01:18
327500 -- [-537.306] (-546.586) (-541.260) (-539.345) * (-535.106) [-536.472] (-542.280) (-536.678) -- 0:01:18
328000 -- (-541.548) [-534.306] (-538.887) (-535.734) * (-544.283) (-539.788) [-541.516] (-534.032) -- 0:01:17
328500 -- (-541.077) [-536.962] (-539.801) (-533.743) * (-535.205) (-535.861) [-539.046] (-537.347) -- 0:01:17
329000 -- (-538.124) [-537.348] (-540.159) (-537.033) * (-540.416) [-533.631] (-537.412) (-535.359) -- 0:01:17
329500 -- (-542.990) (-539.735) [-535.557] (-541.731) * (-544.542) (-534.993) (-541.143) [-535.716] -- 0:01:17
330000 -- (-543.107) (-540.195) (-540.826) [-530.901] * (-534.857) (-547.758) (-537.192) [-535.408] -- 0:01:17
Average standard deviation of split frequencies: 0.006415
330500 -- (-537.958) [-535.034] (-537.080) (-537.442) * [-535.119] (-535.529) (-550.985) (-535.820) -- 0:01:16
331000 -- (-540.248) [-534.180] (-536.256) (-537.169) * [-535.627] (-539.793) (-535.037) (-541.425) -- 0:01:16
331500 -- (-540.961) [-534.615] (-532.947) (-540.532) * (-539.052) [-539.299] (-540.724) (-541.877) -- 0:01:16
332000 -- (-544.655) [-535.909] (-534.695) (-535.109) * (-537.862) (-534.237) (-537.936) [-542.924] -- 0:01:16
332500 -- (-545.773) (-536.779) [-541.838] (-543.528) * (-546.785) (-535.172) (-545.323) [-535.714] -- 0:01:16
333000 -- (-545.591) [-536.988] (-542.391) (-534.230) * (-542.103) [-537.291] (-546.769) (-536.205) -- 0:01:16
333500 -- (-542.734) (-537.015) (-542.597) [-537.830] * (-537.557) (-533.314) [-534.711] (-539.862) -- 0:01:15
334000 -- (-542.103) (-533.246) [-539.342] (-537.627) * [-534.457] (-539.634) (-540.236) (-547.980) -- 0:01:15
334500 -- (-539.431) [-536.737] (-539.539) (-537.785) * [-538.265] (-537.834) (-547.861) (-538.387) -- 0:01:15
335000 -- (-544.705) [-537.632] (-533.681) (-540.680) * (-536.440) (-539.112) [-537.095] (-535.489) -- 0:01:15
Average standard deviation of split frequencies: 0.007716
335500 -- (-538.513) (-532.615) [-540.941] (-537.097) * (-534.805) (-540.394) [-535.984] (-540.504) -- 0:01:17
336000 -- [-540.905] (-538.535) (-533.303) (-539.918) * [-534.844] (-535.397) (-544.509) (-536.085) -- 0:01:17
336500 -- (-539.756) (-530.789) (-541.022) [-532.608] * [-534.978] (-538.702) (-546.279) (-538.440) -- 0:01:16
337000 -- (-542.357) (-535.576) [-538.453] (-534.561) * (-537.991) (-536.761) (-547.010) [-534.698] -- 0:01:16
337500 -- (-538.291) (-544.307) [-538.646] (-547.695) * (-537.942) [-537.689] (-535.693) (-537.981) -- 0:01:16
338000 -- (-534.203) (-537.874) (-539.986) [-539.754] * [-537.422] (-546.572) (-540.421) (-538.312) -- 0:01:16
338500 -- (-535.145) [-536.279] (-539.348) (-537.341) * (-543.705) (-536.031) [-541.105] (-535.417) -- 0:01:16
339000 -- (-537.254) (-535.858) [-537.836] (-536.784) * (-546.882) [-540.442] (-537.129) (-542.217) -- 0:01:16
339500 -- (-535.847) (-535.505) [-538.806] (-541.029) * (-542.139) (-537.552) [-534.742] (-541.322) -- 0:01:15
340000 -- (-539.829) (-541.286) [-533.049] (-535.827) * (-537.878) (-531.834) (-540.464) [-540.058] -- 0:01:15
Average standard deviation of split frequencies: 0.006919
340500 -- (-541.466) (-536.874) [-537.157] (-537.729) * (-538.332) (-538.815) [-533.977] (-540.698) -- 0:01:15
341000 -- (-542.558) (-538.991) (-536.044) [-535.617] * (-540.917) (-538.109) (-539.438) [-542.520] -- 0:01:15
341500 -- (-538.322) (-540.919) (-535.410) [-537.071] * (-544.242) [-533.572] (-537.457) (-546.862) -- 0:01:15
342000 -- (-535.904) (-540.476) (-538.746) [-533.983] * (-544.390) [-531.263] (-537.427) (-541.196) -- 0:01:15
342500 -- (-538.047) (-538.398) [-530.438] (-534.474) * (-540.221) (-533.864) [-540.454] (-537.837) -- 0:01:14
343000 -- [-548.450] (-541.340) (-534.803) (-537.833) * (-537.123) [-532.551] (-540.466) (-540.130) -- 0:01:14
343500 -- (-538.364) [-534.137] (-536.060) (-534.792) * (-533.862) [-532.610] (-544.772) (-535.786) -- 0:01:14
344000 -- (-539.846) (-547.637) [-544.317] (-536.160) * (-535.522) [-533.940] (-538.957) (-542.089) -- 0:01:14
344500 -- (-537.882) [-532.227] (-538.690) (-538.348) * [-537.741] (-547.605) (-536.991) (-543.412) -- 0:01:16
345000 -- (-545.431) (-536.725) (-537.957) [-539.509] * (-535.873) [-540.484] (-531.463) (-534.829) -- 0:01:15
Average standard deviation of split frequencies: 0.008175
345500 -- (-538.252) (-536.001) (-535.222) [-532.206] * (-536.479) (-538.402) (-532.655) [-536.533] -- 0:01:15
346000 -- [-538.698] (-535.354) (-539.512) (-537.218) * [-534.652] (-536.993) (-537.211) (-533.966) -- 0:01:15
346500 -- (-532.655) (-541.251) (-541.301) [-538.306] * (-533.825) (-545.307) (-536.602) [-532.818] -- 0:01:15
347000 -- (-538.032) [-534.762] (-550.630) (-538.722) * (-542.703) [-541.010] (-536.602) (-534.713) -- 0:01:15
347500 -- (-537.681) [-536.973] (-534.061) (-537.945) * (-535.961) (-540.820) [-538.409] (-532.938) -- 0:01:15
348000 -- (-540.633) [-535.291] (-536.359) (-539.413) * (-533.352) (-546.685) (-538.782) [-537.044] -- 0:01:14
348500 -- (-535.408) [-534.859] (-543.253) (-536.877) * (-536.492) (-547.329) (-542.807) [-534.489] -- 0:01:14
349000 -- (-537.227) [-536.959] (-539.390) (-538.198) * (-537.896) (-546.349) (-538.452) [-532.294] -- 0:01:14
349500 -- (-532.818) (-547.530) [-542.420] (-538.972) * (-545.470) (-540.991) (-543.248) [-535.352] -- 0:01:14
350000 -- [-534.192] (-543.532) (-535.142) (-536.351) * (-541.324) [-538.129] (-541.763) (-536.527) -- 0:01:14
Average standard deviation of split frequencies: 0.007394
350500 -- [-536.794] (-540.026) (-546.012) (-538.069) * [-535.480] (-542.348) (-537.836) (-539.096) -- 0:01:14
351000 -- (-540.288) [-534.522] (-537.798) (-534.588) * (-537.181) (-540.435) (-535.678) [-536.394] -- 0:01:13
351500 -- (-538.941) [-535.169] (-535.428) (-532.576) * (-549.305) [-533.297] (-536.188) (-543.143) -- 0:01:13
352000 -- [-531.227] (-543.609) (-535.999) (-532.171) * [-537.327] (-541.574) (-551.715) (-536.022) -- 0:01:13
352500 -- [-535.944] (-538.814) (-541.396) (-543.747) * (-535.749) (-537.992) (-539.595) [-532.531] -- 0:01:13
353000 -- [-537.144] (-539.052) (-539.027) (-533.943) * [-537.391] (-534.257) (-542.934) (-536.117) -- 0:01:15
353500 -- [-533.635] (-536.910) (-535.404) (-537.224) * [-533.116] (-534.455) (-532.536) (-539.334) -- 0:01:14
354000 -- (-535.379) (-537.323) [-535.531] (-534.794) * (-539.882) (-539.914) [-533.294] (-542.857) -- 0:01:14
354500 -- (-537.524) [-536.466] (-536.335) (-532.564) * (-538.118) [-535.510] (-533.131) (-539.566) -- 0:01:14
355000 -- (-540.656) [-537.761] (-531.393) (-537.647) * (-534.613) (-533.605) (-537.833) [-535.043] -- 0:01:14
Average standard deviation of split frequencies: 0.007283
355500 -- (-536.542) (-536.959) (-535.219) [-535.205] * (-542.289) (-539.823) [-534.786] (-541.319) -- 0:01:14
356000 -- (-535.235) [-531.942] (-536.018) (-546.886) * (-543.348) (-532.706) (-533.653) [-536.666] -- 0:01:14
356500 -- (-532.955) (-535.338) [-535.781] (-541.690) * [-536.650] (-535.464) (-537.084) (-539.408) -- 0:01:14
357000 -- [-536.179] (-535.714) (-536.124) (-535.594) * (-533.269) (-539.295) (-541.408) [-535.050] -- 0:01:13
357500 -- (-537.597) [-533.954] (-538.758) (-535.992) * [-539.044] (-540.780) (-534.745) (-541.524) -- 0:01:13
358000 -- (-536.363) (-534.642) (-535.120) [-541.198] * (-538.103) (-537.423) (-533.609) [-536.982] -- 0:01:13
358500 -- (-537.493) (-535.135) [-535.577] (-539.539) * (-538.707) [-535.347] (-538.050) (-539.140) -- 0:01:13
359000 -- (-532.179) [-534.330] (-535.925) (-539.134) * (-537.057) (-536.597) [-533.181] (-544.345) -- 0:01:13
359500 -- (-542.403) [-534.392] (-538.304) (-548.342) * (-544.165) (-536.101) [-533.047] (-535.740) -- 0:01:13
360000 -- (-534.079) [-531.712] (-538.189) (-539.743) * (-538.520) (-538.929) (-535.477) [-536.827] -- 0:01:12
Average standard deviation of split frequencies: 0.006535
360500 -- (-538.153) [-538.209] (-538.030) (-534.995) * (-537.782) [-535.059] (-549.790) (-543.813) -- 0:01:12
361000 -- (-536.711) (-541.267) [-532.503] (-541.892) * (-542.412) (-540.893) (-538.557) [-535.633] -- 0:01:12
361500 -- (-537.936) (-531.841) (-538.234) [-538.847] * (-545.159) (-537.236) [-541.268] (-537.150) -- 0:01:12
362000 -- (-535.811) (-533.806) (-541.711) [-537.120] * (-536.868) (-535.737) (-539.964) [-536.390] -- 0:01:14
362500 -- (-534.159) (-536.914) [-538.055] (-538.369) * (-539.007) [-540.986] (-537.139) (-531.492) -- 0:01:13
363000 -- [-538.672] (-536.603) (-535.625) (-539.566) * (-538.977) (-542.790) (-541.662) [-536.380] -- 0:01:13
363500 -- (-536.883) (-544.583) [-534.356] (-535.710) * (-538.630) (-539.139) (-541.369) [-537.286] -- 0:01:13
364000 -- (-535.507) (-544.422) [-535.832] (-535.556) * [-539.463] (-537.316) (-538.608) (-537.080) -- 0:01:13
364500 -- (-535.839) [-538.454] (-540.204) (-535.780) * [-535.640] (-533.549) (-544.829) (-533.482) -- 0:01:13
365000 -- (-534.853) (-535.493) (-536.204) [-537.513] * (-540.563) (-538.574) [-534.343] (-535.644) -- 0:01:13
Average standard deviation of split frequencies: 0.007084
365500 -- (-539.251) (-540.854) (-533.350) [-534.375] * (-536.188) [-535.154] (-541.486) (-540.516) -- 0:01:12
366000 -- [-540.815] (-541.179) (-544.463) (-535.189) * [-535.449] (-543.788) (-535.367) (-537.587) -- 0:01:12
366500 -- [-535.653] (-538.853) (-538.638) (-536.447) * (-538.890) (-544.360) [-540.209] (-545.149) -- 0:01:12
367000 -- [-538.257] (-540.721) (-543.087) (-537.628) * (-536.343) (-535.236) [-538.551] (-540.781) -- 0:01:12
367500 -- (-547.231) (-537.591) [-536.206] (-541.966) * (-539.082) [-535.571] (-537.425) (-533.266) -- 0:01:12
368000 -- (-537.713) (-537.526) [-534.495] (-539.185) * (-536.596) [-534.406] (-544.661) (-536.628) -- 0:01:12
368500 -- [-536.757] (-535.878) (-540.395) (-543.574) * [-538.448] (-535.111) (-535.225) (-541.808) -- 0:01:11
369000 -- (-545.145) (-531.356) [-535.503] (-536.797) * [-541.463] (-538.694) (-532.839) (-541.696) -- 0:01:11
369500 -- (-532.931) (-540.519) [-534.049] (-546.420) * (-537.508) (-537.787) [-534.368] (-539.805) -- 0:01:11
370000 -- (-538.595) (-535.617) [-532.265] (-536.836) * (-545.162) (-536.624) (-540.082) [-536.573] -- 0:01:11
Average standard deviation of split frequencies: 0.006995
370500 -- (-536.238) (-537.838) [-534.943] (-537.602) * [-533.893] (-539.697) (-540.664) (-538.707) -- 0:01:13
371000 -- (-535.998) (-541.767) (-539.368) [-537.350] * (-545.321) [-532.746] (-545.309) (-537.343) -- 0:01:12
371500 -- (-538.081) (-541.050) [-541.122] (-540.201) * [-538.716] (-540.463) (-534.249) (-534.438) -- 0:01:12
372000 -- [-543.071] (-536.466) (-536.929) (-538.327) * [-533.230] (-538.215) (-535.719) (-536.551) -- 0:01:12
372500 -- (-540.360) [-536.019] (-536.707) (-539.640) * [-534.632] (-538.112) (-540.351) (-535.247) -- 0:01:12
373000 -- (-537.428) [-532.976] (-538.587) (-541.573) * (-535.884) (-535.266) [-537.282] (-536.184) -- 0:01:12
373500 -- (-540.343) (-536.941) (-538.228) [-538.491] * (-542.121) (-536.277) (-540.254) [-533.144] -- 0:01:12
374000 -- (-542.047) (-537.011) (-542.348) [-539.873] * (-535.873) (-547.036) (-543.251) [-542.403] -- 0:01:11
374500 -- (-540.218) (-536.527) [-537.693] (-536.589) * (-538.439) (-532.928) [-536.996] (-534.951) -- 0:01:11
375000 -- (-542.083) [-536.618] (-539.888) (-535.691) * (-534.605) (-530.759) (-543.273) [-535.899] -- 0:01:11
Average standard deviation of split frequencies: 0.006896
375500 -- (-536.705) (-532.386) [-536.296] (-536.133) * (-538.394) [-531.683] (-541.735) (-538.160) -- 0:01:11
376000 -- (-543.524) (-534.831) [-536.043] (-544.563) * (-537.478) [-532.398] (-548.080) (-535.848) -- 0:01:11
376500 -- [-540.180] (-532.651) (-540.239) (-536.589) * (-541.500) (-536.840) (-540.078) [-544.314] -- 0:01:11
377000 -- (-544.171) (-538.970) (-537.747) [-535.257] * [-538.482] (-546.498) (-545.157) (-538.047) -- 0:01:11
377500 -- (-535.678) (-541.611) [-535.402] (-533.437) * [-539.671] (-536.157) (-538.646) (-535.045) -- 0:01:10
378000 -- (-542.967) (-535.901) [-534.469] (-537.245) * [-534.184] (-541.563) (-539.571) (-534.773) -- 0:01:10
378500 -- (-533.913) (-543.223) (-534.613) [-533.806] * (-534.208) (-533.467) (-541.147) [-537.611] -- 0:01:10
379000 -- (-539.337) (-540.288) (-540.177) [-535.923] * (-537.373) [-539.311] (-543.480) (-541.339) -- 0:01:12
379500 -- (-541.101) (-544.592) [-538.035] (-538.100) * (-532.034) (-535.949) (-541.541) [-536.665] -- 0:01:11
380000 -- (-534.849) (-538.598) (-539.005) [-534.853] * (-539.549) (-532.033) [-535.304] (-537.640) -- 0:01:11
Average standard deviation of split frequencies: 0.006811
380500 -- (-543.014) [-535.984] (-533.693) (-529.886) * (-536.817) [-538.712] (-538.695) (-540.224) -- 0:01:11
381000 -- (-539.363) [-539.042] (-533.841) (-537.955) * (-532.527) (-541.436) [-538.812] (-539.891) -- 0:01:11
381500 -- (-536.344) (-538.903) (-536.271) [-539.194] * (-541.952) [-533.780] (-535.473) (-539.479) -- 0:01:11
382000 -- (-540.483) (-540.505) (-537.058) [-538.427] * (-531.707) (-536.292) [-535.704] (-541.453) -- 0:01:11
382500 -- (-539.687) [-533.260] (-534.252) (-539.309) * (-533.041) [-533.223] (-542.909) (-540.206) -- 0:01:11
383000 -- (-533.854) (-539.609) (-533.228) [-537.392] * (-542.564) [-531.633] (-536.961) (-542.427) -- 0:01:10
383500 -- (-537.060) [-537.923] (-535.081) (-538.075) * [-541.838] (-534.085) (-537.033) (-541.766) -- 0:01:10
384000 -- (-542.261) [-535.959] (-538.852) (-531.780) * (-538.714) (-537.451) [-536.332] (-538.556) -- 0:01:10
384500 -- (-545.784) (-538.113) [-535.257] (-533.764) * (-540.255) (-536.619) (-537.291) [-538.710] -- 0:01:10
385000 -- [-540.462] (-539.224) (-532.453) (-542.157) * (-535.588) [-535.397] (-539.701) (-535.215) -- 0:01:10
Average standard deviation of split frequencies: 0.005496
385500 -- (-541.966) [-536.898] (-533.265) (-533.893) * (-544.664) [-531.247] (-545.414) (-536.805) -- 0:01:10
386000 -- (-538.197) [-535.573] (-536.657) (-533.813) * (-543.826) (-536.607) [-541.241] (-540.042) -- 0:01:09
386500 -- (-543.751) (-536.559) (-537.595) [-539.639] * [-535.304] (-538.807) (-544.548) (-540.809) -- 0:01:09
387000 -- (-542.008) (-539.715) [-534.569] (-543.706) * (-539.127) [-533.609] (-536.132) (-538.394) -- 0:01:09
387500 -- (-545.580) (-549.741) [-531.890] (-540.215) * (-539.014) [-534.448] (-541.350) (-548.695) -- 0:01:09
388000 -- (-545.789) [-534.613] (-537.073) (-537.710) * [-535.178] (-539.571) (-542.020) (-541.877) -- 0:01:10
388500 -- (-546.343) (-547.151) (-537.765) [-538.410] * (-537.128) [-536.340] (-534.620) (-531.575) -- 0:01:10
389000 -- (-542.039) [-538.651] (-533.285) (-539.482) * [-536.077] (-540.906) (-542.998) (-539.805) -- 0:01:10
389500 -- (-536.860) [-532.182] (-539.851) (-543.292) * (-536.831) (-535.573) [-532.696] (-536.022) -- 0:01:10
390000 -- [-539.119] (-534.921) (-533.323) (-539.526) * (-537.643) (-532.065) (-539.887) [-535.433] -- 0:01:10
Average standard deviation of split frequencies: 0.004827
390500 -- (-539.990) (-544.194) [-534.159] (-538.284) * (-536.516) (-538.794) [-536.347] (-537.392) -- 0:01:10
391000 -- (-535.062) (-539.585) [-534.397] (-532.610) * (-534.748) (-544.325) [-539.037] (-543.904) -- 0:01:10
391500 -- (-535.707) (-540.649) [-531.046] (-535.589) * (-541.376) (-550.127) (-547.268) [-536.775] -- 0:01:09
392000 -- (-535.230) [-539.082] (-535.160) (-534.420) * [-533.711] (-536.422) (-538.792) (-533.557) -- 0:01:09
392500 -- (-535.859) (-542.830) [-533.441] (-537.533) * (-542.708) (-536.805) (-543.584) [-537.723] -- 0:01:09
393000 -- (-534.242) (-538.871) [-534.250] (-536.604) * (-532.224) [-541.117] (-542.412) (-541.666) -- 0:01:09
393500 -- [-537.462] (-534.707) (-551.353) (-534.736) * (-540.099) [-534.860] (-544.357) (-538.049) -- 0:01:09
394000 -- (-541.135) [-539.611] (-537.599) (-534.399) * [-533.177] (-537.006) (-543.900) (-541.353) -- 0:01:09
394500 -- (-544.892) [-532.709] (-532.541) (-535.600) * [-537.942] (-532.593) (-541.354) (-544.962) -- 0:01:09
395000 -- (-538.857) (-534.098) [-536.406] (-535.337) * (-541.318) (-537.562) (-538.690) [-542.550] -- 0:01:08
Average standard deviation of split frequencies: 0.004166
395500 -- [-536.340] (-533.661) (-543.370) (-541.985) * (-546.194) (-533.392) (-542.111) [-534.084] -- 0:01:08
396000 -- [-534.087] (-533.369) (-535.142) (-539.899) * (-537.553) (-540.290) [-536.632] (-535.285) -- 0:01:08
396500 -- (-535.867) [-534.061] (-535.414) (-543.175) * (-541.884) (-539.413) (-536.467) [-534.772] -- 0:01:10
397000 -- [-537.359] (-534.349) (-533.132) (-534.432) * [-534.916] (-534.080) (-536.660) (-535.695) -- 0:01:09
397500 -- [-534.194] (-537.536) (-537.144) (-541.585) * (-540.400) (-537.355) [-537.617] (-541.946) -- 0:01:09
398000 -- (-535.334) [-534.073] (-549.376) (-541.004) * (-537.162) (-535.704) (-543.760) [-537.816] -- 0:01:09
398500 -- [-535.808] (-540.841) (-539.530) (-539.786) * (-534.481) [-536.661] (-536.836) (-544.924) -- 0:01:09
399000 -- (-534.048) (-534.565) [-533.170] (-535.578) * (-547.832) [-533.593] (-538.916) (-539.222) -- 0:01:09
399500 -- (-530.910) [-534.922] (-538.038) (-534.907) * (-536.843) (-543.259) [-534.620] (-534.000) -- 0:01:09
400000 -- [-534.126] (-533.949) (-537.179) (-535.011) * (-540.685) [-538.766] (-539.137) (-537.734) -- 0:01:09
Average standard deviation of split frequencies: 0.004706
400500 -- (-541.253) (-539.081) (-534.880) [-534.383] * (-533.861) [-539.032] (-540.847) (-545.089) -- 0:01:08
401000 -- (-538.419) [-537.631] (-535.505) (-536.507) * (-533.063) [-534.388] (-545.347) (-539.023) -- 0:01:08
401500 -- (-533.218) [-537.815] (-532.263) (-537.791) * (-539.172) [-534.134] (-537.543) (-544.718) -- 0:01:08
402000 -- [-539.088] (-542.179) (-535.803) (-533.812) * [-542.477] (-535.385) (-550.481) (-536.900) -- 0:01:08
402500 -- [-534.770] (-540.632) (-534.874) (-544.848) * (-537.984) (-544.068) [-540.762] (-535.535) -- 0:01:08
403000 -- (-539.576) (-535.635) [-533.703] (-538.686) * (-537.656) [-540.110] (-541.379) (-541.148) -- 0:01:08
403500 -- (-539.447) (-536.979) (-539.207) [-535.245] * (-538.591) [-532.750] (-538.706) (-535.819) -- 0:01:08
404000 -- (-545.280) [-534.693] (-537.279) (-541.861) * (-537.189) [-532.026] (-537.173) (-531.505) -- 0:01:07
404500 -- (-539.000) (-532.300) [-536.490] (-538.048) * (-540.024) [-536.867] (-535.607) (-538.691) -- 0:01:07
405000 -- (-544.307) [-533.138] (-541.851) (-539.941) * (-542.598) [-536.420] (-542.923) (-535.143) -- 0:01:09
Average standard deviation of split frequencies: 0.005225
405500 -- (-540.885) (-539.146) [-536.134] (-536.876) * (-540.775) (-535.747) (-539.007) [-538.012] -- 0:01:08
406000 -- [-535.234] (-541.587) (-535.979) (-545.608) * (-541.994) [-537.552] (-540.417) (-540.866) -- 0:01:08
406500 -- [-536.486] (-541.328) (-533.452) (-537.028) * [-538.276] (-532.124) (-538.259) (-534.000) -- 0:01:08
407000 -- [-540.446] (-538.975) (-534.823) (-544.955) * (-535.894) [-535.907] (-541.035) (-533.534) -- 0:01:08
407500 -- (-535.573) (-539.505) [-539.313] (-539.294) * (-537.632) (-540.200) (-542.428) [-532.503] -- 0:01:08
408000 -- [-538.299] (-541.073) (-542.946) (-543.005) * [-536.682] (-539.567) (-532.917) (-538.021) -- 0:01:08
408500 -- (-541.243) (-539.275) [-540.382] (-539.956) * (-533.853) [-535.783] (-538.131) (-550.751) -- 0:01:08
409000 -- (-538.252) (-537.313) (-539.996) [-533.560] * (-538.084) (-535.701) [-535.420] (-537.426) -- 0:01:07
409500 -- (-539.947) (-538.187) [-533.500] (-536.211) * (-539.469) [-534.716] (-540.892) (-535.014) -- 0:01:07
410000 -- (-542.317) [-542.382] (-538.551) (-542.968) * (-536.304) [-536.989] (-532.142) (-545.387) -- 0:01:07
Average standard deviation of split frequencies: 0.005740
410500 -- [-540.431] (-537.850) (-534.805) (-545.462) * (-532.048) [-543.158] (-538.780) (-540.363) -- 0:01:07
411000 -- (-538.713) (-545.166) (-539.333) [-541.515] * (-533.587) [-538.619] (-544.780) (-532.835) -- 0:01:07
411500 -- (-539.437) (-548.984) [-533.847] (-546.429) * (-534.843) [-536.885] (-539.590) (-536.781) -- 0:01:07
412000 -- (-540.935) [-537.594] (-533.856) (-545.434) * (-533.890) (-543.010) (-541.640) [-538.813] -- 0:01:07
412500 -- (-537.253) (-538.831) [-535.175] (-545.512) * (-536.782) (-535.439) (-543.461) [-535.117] -- 0:01:06
413000 -- (-538.166) (-536.408) (-535.755) [-538.422] * [-536.293] (-544.421) (-540.607) (-540.226) -- 0:01:06
413500 -- (-534.122) [-542.680] (-535.321) (-554.397) * (-539.889) [-540.330] (-539.619) (-536.639) -- 0:01:06
414000 -- (-542.980) (-540.401) [-532.460] (-549.967) * [-541.218] (-542.023) (-536.349) (-534.761) -- 0:01:07
414500 -- [-536.217] (-539.818) (-534.064) (-543.427) * (-543.664) [-537.264] (-534.259) (-538.188) -- 0:01:07
415000 -- (-546.026) (-547.021) [-533.765] (-535.722) * (-539.808) [-540.521] (-534.134) (-539.529) -- 0:01:07
Average standard deviation of split frequencies: 0.005099
415500 -- (-541.295) (-546.619) (-537.031) [-536.939] * (-537.939) (-540.599) [-536.401] (-546.003) -- 0:01:07
416000 -- (-536.630) (-541.388) (-538.278) [-540.725] * (-537.983) (-535.619) [-539.730] (-536.844) -- 0:01:07
416500 -- (-535.097) (-554.393) (-541.432) [-535.731] * [-534.436] (-543.806) (-539.879) (-534.690) -- 0:01:07
417000 -- [-536.738] (-543.635) (-544.177) (-539.509) * (-541.798) [-536.975] (-538.618) (-535.718) -- 0:01:07
417500 -- (-538.691) (-538.504) [-539.103] (-544.854) * [-534.662] (-538.223) (-536.208) (-540.687) -- 0:01:06
418000 -- (-537.919) [-540.190] (-534.986) (-542.108) * [-536.095] (-532.869) (-536.255) (-546.253) -- 0:01:06
418500 -- [-539.435] (-538.387) (-537.628) (-538.384) * [-537.273] (-543.673) (-551.151) (-533.237) -- 0:01:06
419000 -- (-536.265) (-541.627) [-540.974] (-543.491) * [-540.547] (-534.794) (-540.964) (-537.055) -- 0:01:06
419500 -- (-531.607) (-542.325) [-539.932] (-542.458) * (-535.534) (-541.121) (-533.479) [-535.605] -- 0:01:06
420000 -- (-532.845) (-536.489) [-541.811] (-541.045) * [-534.948] (-534.853) (-545.539) (-537.062) -- 0:01:06
Average standard deviation of split frequencies: 0.005043
420500 -- [-537.944] (-542.016) (-536.977) (-539.201) * [-532.415] (-534.272) (-546.516) (-534.078) -- 0:01:06
421000 -- [-538.064] (-542.611) (-537.180) (-534.701) * (-541.361) (-535.086) (-540.764) [-535.654] -- 0:01:06
421500 -- (-535.252) [-545.638] (-537.095) (-536.777) * [-537.262] (-536.776) (-538.932) (-540.337) -- 0:01:05
422000 -- (-535.710) (-540.843) (-540.674) [-533.669] * [-535.689] (-540.943) (-543.842) (-537.579) -- 0:01:05
422500 -- (-536.381) (-537.652) [-536.578] (-535.271) * [-536.850] (-539.587) (-536.886) (-542.310) -- 0:01:06
423000 -- (-534.835) (-540.408) (-541.430) [-541.333] * (-532.290) (-534.655) [-534.458] (-541.099) -- 0:01:06
423500 -- (-535.162) (-539.971) [-541.105] (-538.145) * (-532.406) (-537.299) [-534.620] (-537.791) -- 0:01:06
424000 -- [-531.056] (-537.712) (-534.123) (-537.951) * (-530.539) [-534.803] (-535.615) (-537.367) -- 0:01:06
424500 -- (-539.649) (-543.815) [-532.204] (-541.244) * (-537.187) [-532.335] (-538.003) (-537.808) -- 0:01:06
425000 -- (-548.239) (-536.061) [-540.500] (-541.213) * (-532.802) [-538.738] (-539.077) (-535.448) -- 0:01:06
Average standard deviation of split frequencies: 0.004980
425500 -- [-539.476] (-539.460) (-535.995) (-541.432) * (-533.545) (-534.818) (-539.215) [-536.144] -- 0:01:06
426000 -- [-534.607] (-535.185) (-534.307) (-544.121) * (-541.414) (-534.657) [-540.569] (-538.442) -- 0:01:06
426500 -- [-535.594] (-541.173) (-538.037) (-543.828) * [-535.360] (-534.815) (-545.032) (-540.610) -- 0:01:05
427000 -- (-535.113) (-536.330) [-542.906] (-546.620) * [-537.255] (-539.435) (-540.741) (-538.940) -- 0:01:05
427500 -- [-533.105] (-537.892) (-536.855) (-540.183) * (-535.791) (-537.525) [-540.855] (-546.043) -- 0:01:05
428000 -- (-538.324) (-532.361) (-532.811) [-543.041] * [-537.583] (-537.769) (-533.061) (-536.433) -- 0:01:05
428500 -- [-535.419] (-534.967) (-536.830) (-544.601) * (-538.647) (-539.771) (-539.339) [-542.841] -- 0:01:05
429000 -- [-534.645] (-539.659) (-537.772) (-545.181) * (-538.173) [-532.624] (-536.043) (-540.719) -- 0:01:05
429500 -- (-538.023) (-547.076) (-536.375) [-539.432] * (-543.295) (-538.665) [-534.468] (-537.297) -- 0:01:05
430000 -- (-535.704) (-544.369) [-537.856] (-538.265) * [-534.316] (-537.674) (-540.070) (-544.509) -- 0:01:04
Average standard deviation of split frequencies: 0.004926
430500 -- [-535.716] (-533.385) (-538.245) (-542.790) * (-534.267) (-534.949) (-539.262) [-538.324] -- 0:01:04
431000 -- (-536.832) [-533.510] (-538.248) (-541.063) * (-537.719) (-537.200) (-538.558) [-540.612] -- 0:01:04
431500 -- [-539.487] (-532.224) (-541.085) (-543.810) * (-536.301) [-536.289] (-538.299) (-541.606) -- 0:01:05
432000 -- [-543.028] (-539.043) (-537.101) (-535.995) * (-535.415) [-533.175] (-531.800) (-539.402) -- 0:01:05
432500 -- (-540.878) (-534.801) (-541.291) [-535.847] * (-543.896) (-543.974) [-535.533] (-536.675) -- 0:01:05
433000 -- (-543.943) (-539.138) (-539.625) [-539.539] * (-536.215) (-542.362) [-534.635] (-544.784) -- 0:01:05
433500 -- [-534.456] (-535.442) (-533.709) (-541.942) * (-537.914) (-537.525) [-534.249] (-536.104) -- 0:01:05
434000 -- (-541.257) (-537.207) (-545.701) [-538.435] * (-541.489) (-535.942) [-537.079] (-550.442) -- 0:01:05
434500 -- (-540.344) (-532.658) [-537.799] (-542.255) * (-532.629) (-541.030) [-535.850] (-550.356) -- 0:01:05
435000 -- (-536.773) [-530.967] (-539.789) (-539.890) * (-538.664) (-536.474) [-535.833] (-540.228) -- 0:01:04
Average standard deviation of split frequencies: 0.003244
435500 -- (-547.583) (-534.998) [-535.700] (-538.488) * (-539.228) [-538.644] (-539.879) (-536.339) -- 0:01:04
436000 -- (-539.585) [-536.823] (-537.179) (-541.724) * (-545.135) (-534.298) (-539.598) [-535.056] -- 0:01:04
436500 -- (-544.859) (-533.999) (-533.088) [-534.553] * (-544.492) (-535.639) [-537.251] (-538.433) -- 0:01:04
437000 -- (-544.680) [-540.576] (-539.504) (-535.777) * [-535.482] (-542.526) (-536.403) (-544.540) -- 0:01:04
437500 -- (-541.164) [-533.864] (-543.177) (-540.560) * [-539.183] (-540.421) (-535.964) (-544.538) -- 0:01:04
438000 -- (-546.418) (-539.185) (-537.100) [-537.344] * (-537.791) (-538.834) [-541.902] (-548.802) -- 0:01:04
438500 -- (-542.196) (-534.728) (-538.755) [-533.344] * (-541.421) (-536.700) (-547.886) [-544.491] -- 0:01:04
439000 -- (-535.487) [-538.248] (-540.305) (-536.433) * (-536.838) (-538.337) (-536.415) [-542.491] -- 0:01:03
439500 -- (-538.918) (-535.362) (-545.205) [-544.012] * (-542.114) (-541.256) [-535.282] (-541.800) -- 0:01:03
440000 -- (-534.027) (-533.342) [-532.156] (-534.257) * (-543.980) (-544.504) [-537.419] (-548.722) -- 0:01:04
Average standard deviation of split frequencies: 0.002674
440500 -- (-547.441) [-534.374] (-538.046) (-538.133) * (-534.626) [-538.709] (-538.143) (-539.724) -- 0:01:04
441000 -- (-542.875) [-534.587] (-542.554) (-532.092) * (-538.587) (-541.840) [-537.053] (-539.927) -- 0:01:04
441500 -- (-535.817) (-535.565) [-532.376] (-536.669) * [-538.574] (-537.986) (-534.766) (-538.828) -- 0:01:04
442000 -- [-537.119] (-536.453) (-537.561) (-536.065) * (-537.325) [-532.212] (-540.700) (-536.573) -- 0:01:04
442500 -- (-539.961) (-537.580) (-535.420) [-542.482] * (-533.815) (-537.883) [-536.487] (-536.917) -- 0:01:04
443000 -- (-539.563) (-535.529) [-531.456] (-536.899) * (-539.272) [-533.923] (-534.660) (-539.157) -- 0:01:04
443500 -- (-540.514) [-531.743] (-534.659) (-539.325) * (-532.015) (-534.062) (-550.049) [-533.529] -- 0:01:03
444000 -- (-543.069) [-536.686] (-535.771) (-535.989) * (-536.277) [-537.933] (-533.206) (-539.335) -- 0:01:03
444500 -- (-538.129) (-533.792) [-531.342] (-542.015) * (-536.397) (-536.377) [-537.183] (-538.947) -- 0:01:03
445000 -- (-534.587) (-539.885) [-532.657] (-536.651) * (-538.631) (-537.609) (-538.502) [-537.131] -- 0:01:03
Average standard deviation of split frequencies: 0.002642
445500 -- (-539.300) (-536.262) [-535.202] (-537.041) * (-543.495) (-536.632) [-528.984] (-542.669) -- 0:01:03
446000 -- (-540.532) (-534.717) [-536.100] (-537.594) * (-538.493) (-538.847) (-538.424) [-535.785] -- 0:01:03
446500 -- (-546.560) [-534.409] (-531.208) (-540.456) * (-541.682) (-538.517) [-531.383] (-540.042) -- 0:01:03
447000 -- (-539.268) [-535.294] (-549.089) (-543.418) * (-546.120) (-530.887) (-541.022) [-537.678] -- 0:01:03
447500 -- (-538.676) (-537.738) (-542.768) [-540.763] * (-534.020) (-534.612) (-545.009) [-542.341] -- 0:01:02
448000 -- [-539.526] (-546.204) (-533.394) (-547.416) * (-536.040) (-535.076) (-539.024) [-539.002] -- 0:01:02
448500 -- (-536.118) (-542.574) (-534.903) [-534.852] * (-537.891) [-531.242] (-543.976) (-536.862) -- 0:01:03
449000 -- (-541.220) (-539.707) (-541.831) [-535.637] * [-534.235] (-534.997) (-533.486) (-537.010) -- 0:01:03
449500 -- (-538.494) (-535.662) [-536.610] (-539.384) * (-541.937) [-540.287] (-535.636) (-536.666) -- 0:01:03
450000 -- [-538.071] (-543.711) (-539.058) (-537.679) * [-537.074] (-538.861) (-537.955) (-549.636) -- 0:01:03
Average standard deviation of split frequencies: 0.003138
450500 -- (-535.193) (-543.885) (-542.532) [-534.815] * (-532.819) [-532.768] (-536.511) (-540.072) -- 0:01:03
451000 -- [-533.347] (-545.575) (-535.006) (-535.233) * [-535.973] (-542.549) (-533.277) (-536.100) -- 0:01:03
451500 -- (-535.724) (-541.438) (-539.072) [-532.861] * [-538.561] (-545.385) (-534.635) (-538.190) -- 0:01:03
452000 -- (-537.408) (-532.924) [-534.787] (-535.415) * [-535.493] (-538.141) (-534.129) (-537.798) -- 0:01:03
452500 -- (-547.375) (-541.584) [-537.602] (-535.101) * [-534.693] (-541.014) (-533.778) (-539.375) -- 0:01:02
453000 -- [-531.549] (-536.021) (-530.701) (-536.670) * (-542.198) (-545.361) (-543.732) [-540.633] -- 0:01:02
453500 -- (-534.926) (-540.766) (-537.123) [-538.962] * (-540.946) (-552.918) (-540.896) [-535.268] -- 0:01:02
454000 -- (-536.288) (-540.158) [-532.957] (-539.297) * (-538.580) (-542.873) [-533.212] (-538.864) -- 0:01:02
454500 -- (-537.251) (-536.207) [-535.981] (-531.633) * [-543.786] (-536.419) (-535.072) (-538.836) -- 0:01:02
455000 -- (-539.804) [-538.122] (-534.885) (-535.790) * (-544.223) (-538.429) (-532.673) [-532.472] -- 0:01:02
Average standard deviation of split frequencies: 0.003101
455500 -- (-536.794) (-536.371) [-541.061] (-539.740) * (-544.266) (-539.232) [-533.932] (-534.252) -- 0:01:02
456000 -- (-533.394) [-537.255] (-535.784) (-541.047) * (-539.426) (-538.441) (-538.852) [-538.345] -- 0:01:02
456500 -- (-536.887) (-540.161) [-532.703] (-538.048) * (-536.026) (-544.989) [-538.771] (-538.015) -- 0:01:01
457000 -- [-537.245] (-539.697) (-531.665) (-541.385) * [-536.909] (-543.526) (-537.178) (-540.696) -- 0:01:01
457500 -- [-530.858] (-544.804) (-538.422) (-541.802) * [-541.252] (-538.631) (-539.321) (-534.651) -- 0:01:02
458000 -- [-535.400] (-537.553) (-539.611) (-534.903) * (-535.435) (-540.615) (-540.062) [-536.516] -- 0:01:02
458500 -- [-537.217] (-538.995) (-539.536) (-549.463) * (-537.509) (-544.050) (-537.305) [-537.746] -- 0:01:02
459000 -- (-540.291) (-545.871) (-536.190) [-533.842] * [-540.980] (-536.707) (-536.510) (-541.391) -- 0:01:02
459500 -- (-542.013) (-537.675) [-532.628] (-540.351) * (-543.753) (-538.464) (-542.223) [-539.850] -- 0:01:02
460000 -- (-544.355) (-539.065) [-532.160] (-540.199) * [-535.888] (-538.211) (-535.536) (-539.266) -- 0:01:02
Average standard deviation of split frequencies: 0.003582
460500 -- (-533.247) (-538.666) [-534.046] (-544.489) * (-537.339) (-537.334) (-540.313) [-534.352] -- 0:01:02
461000 -- [-535.314] (-538.176) (-539.422) (-538.405) * [-537.357] (-538.998) (-535.662) (-545.887) -- 0:01:01
461500 -- (-534.172) (-539.069) [-539.439] (-546.675) * [-538.421] (-536.642) (-542.284) (-538.526) -- 0:01:01
462000 -- (-536.827) (-542.566) [-531.521] (-540.619) * (-541.105) [-537.441] (-547.270) (-543.801) -- 0:01:01
462500 -- (-536.704) [-535.936] (-536.797) (-538.205) * (-537.576) [-539.791] (-543.469) (-538.155) -- 0:01:01
463000 -- (-532.785) (-533.458) [-533.820] (-547.950) * (-533.483) (-544.595) (-539.268) [-539.125] -- 0:01:01
463500 -- [-530.607] (-532.881) (-545.717) (-539.502) * (-534.480) (-543.407) (-539.908) [-540.165] -- 0:01:01
464000 -- [-534.006] (-536.530) (-537.514) (-542.991) * (-536.031) (-544.724) (-538.542) [-540.682] -- 0:01:01
464500 -- (-535.290) (-538.424) [-535.210] (-542.628) * (-540.497) (-538.063) (-535.831) [-536.909] -- 0:01:01
465000 -- (-540.829) (-541.012) [-533.993] (-538.753) * (-538.213) [-536.198] (-539.218) (-534.933) -- 0:01:00
Average standard deviation of split frequencies: 0.003035
465500 -- [-533.159] (-534.381) (-537.193) (-534.983) * (-547.096) (-546.115) (-535.741) [-540.236] -- 0:01:00
466000 -- (-541.960) (-536.283) (-542.996) [-537.925] * (-543.378) (-544.916) [-536.773] (-538.293) -- 0:01:01
466500 -- (-533.763) [-538.331] (-540.028) (-536.061) * (-541.984) (-536.810) [-535.698] (-536.612) -- 0:01:01
467000 -- (-535.647) (-537.760) (-538.642) [-539.270] * (-545.151) (-534.866) (-539.564) [-533.507] -- 0:01:01
467500 -- (-535.724) (-547.406) [-536.669] (-540.646) * (-543.698) [-536.751] (-538.723) (-534.148) -- 0:01:01
468000 -- [-536.185] (-547.618) (-539.652) (-537.449) * (-548.268) (-537.669) (-542.825) [-538.088] -- 0:01:01
468500 -- [-530.461] (-539.733) (-538.962) (-540.076) * (-545.856) (-543.438) [-535.879] (-542.719) -- 0:01:01
469000 -- (-535.143) (-540.367) (-538.135) [-532.500] * (-541.688) (-542.195) [-531.975] (-530.679) -- 0:01:01
469500 -- [-537.607] (-538.417) (-541.359) (-537.149) * (-546.775) (-545.576) (-534.761) [-531.963] -- 0:01:01
470000 -- (-537.975) [-536.180] (-538.513) (-537.868) * (-554.886) (-535.456) [-537.600] (-542.276) -- 0:01:00
Average standard deviation of split frequencies: 0.004006
470500 -- (-533.720) [-543.467] (-542.796) (-535.492) * (-550.969) (-535.818) (-536.260) [-536.680] -- 0:01:00
471000 -- (-532.840) (-540.089) [-534.734] (-531.455) * (-545.409) [-536.070] (-542.397) (-535.715) -- 0:01:00
471500 -- (-540.014) [-538.138] (-535.105) (-538.207) * [-539.056] (-537.780) (-542.918) (-547.908) -- 0:01:00
472000 -- (-543.166) (-543.426) [-531.494] (-534.118) * (-540.938) [-534.204] (-535.633) (-545.659) -- 0:01:00
472500 -- [-537.608] (-536.689) (-537.890) (-538.220) * (-546.593) [-541.439] (-538.939) (-543.494) -- 0:01:00
473000 -- (-539.194) [-535.679] (-535.600) (-534.806) * [-545.592] (-541.609) (-538.343) (-540.259) -- 0:01:00
473500 -- [-535.737] (-543.815) (-536.948) (-543.943) * (-541.362) [-538.962] (-547.963) (-535.784) -- 0:01:00
474000 -- (-537.797) [-537.935] (-532.605) (-535.724) * (-536.128) (-537.897) [-533.056] (-541.870) -- 0:00:59
474500 -- (-544.899) (-546.096) (-539.343) [-535.532] * [-535.404] (-539.128) (-542.193) (-538.713) -- 0:00:59
475000 -- (-543.502) [-548.197] (-541.064) (-534.100) * (-540.985) (-539.712) [-537.801] (-541.083) -- 0:01:00
Average standard deviation of split frequencies: 0.002971
475500 -- (-542.172) (-538.923) [-537.892] (-541.360) * (-546.140) (-542.599) (-537.126) [-535.785] -- 0:01:00
476000 -- (-535.494) (-530.851) [-537.593] (-540.666) * (-541.035) (-537.707) [-534.098] (-537.817) -- 0:01:00
476500 -- (-538.873) [-539.784] (-537.475) (-541.662) * (-537.897) (-535.779) [-538.490] (-533.623) -- 0:01:00
477000 -- (-531.252) [-531.903] (-540.995) (-538.634) * (-534.255) [-535.282] (-538.524) (-537.393) -- 0:01:00
477500 -- (-538.278) (-537.380) [-537.167] (-542.442) * (-541.330) (-544.859) [-536.361] (-536.646) -- 0:01:00
478000 -- (-542.767) (-539.583) [-536.749] (-538.001) * (-540.515) (-541.191) [-537.118] (-541.478) -- 0:01:00
478500 -- (-540.924) [-539.464] (-538.516) (-540.653) * (-540.806) (-542.344) (-538.881) [-536.557] -- 0:00:59
479000 -- (-533.339) [-536.377] (-533.988) (-538.265) * (-532.495) [-533.163] (-545.122) (-531.933) -- 0:00:59
479500 -- (-541.670) (-534.888) [-541.173] (-536.460) * (-537.872) (-539.491) [-534.522] (-535.422) -- 0:00:59
480000 -- (-549.345) [-535.407] (-545.346) (-537.348) * (-532.569) (-537.716) (-536.730) [-533.176] -- 0:00:59
Average standard deviation of split frequencies: 0.002452
480500 -- (-535.624) [-538.015] (-536.060) (-537.850) * [-534.776] (-537.043) (-538.081) (-534.181) -- 0:00:59
481000 -- (-540.179) (-541.594) (-541.362) [-532.900] * (-533.366) [-538.650] (-540.521) (-538.268) -- 0:00:59
481500 -- (-538.551) (-535.668) (-539.841) [-534.434] * (-534.651) (-538.681) [-535.022] (-534.391) -- 0:00:59
482000 -- [-539.799] (-537.490) (-538.227) (-535.687) * [-533.697] (-532.681) (-538.964) (-535.473) -- 0:00:59
482500 -- (-544.746) [-536.845] (-536.956) (-533.492) * (-535.809) [-537.711] (-539.229) (-542.778) -- 0:00:58
483000 -- [-540.020] (-540.537) (-538.690) (-538.799) * (-541.003) (-537.369) (-535.688) [-534.838] -- 0:00:58
483500 -- (-535.926) (-537.349) (-539.620) [-539.738] * (-538.515) (-542.583) (-532.912) [-538.226] -- 0:00:59
484000 -- (-532.203) (-536.619) [-534.859] (-539.203) * (-536.799) [-540.290] (-538.476) (-541.388) -- 0:00:59
484500 -- [-538.973] (-542.921) (-540.587) (-530.817) * (-536.369) (-543.281) [-545.262] (-536.450) -- 0:00:59
485000 -- [-536.678] (-539.394) (-539.071) (-534.203) * (-536.259) [-536.133] (-534.635) (-537.298) -- 0:00:59
Average standard deviation of split frequencies: 0.002425
485500 -- (-545.248) (-537.633) (-533.882) [-532.424] * (-547.607) [-546.021] (-534.595) (-534.441) -- 0:00:59
486000 -- (-534.731) [-543.871] (-537.357) (-538.188) * (-535.897) (-541.292) (-535.687) [-537.278] -- 0:00:59
486500 -- (-546.140) (-544.082) [-532.964] (-533.047) * (-546.296) [-535.691] (-544.115) (-534.663) -- 0:00:59
487000 -- (-534.662) (-538.825) [-536.890] (-538.287) * (-538.393) (-534.381) [-534.755] (-535.981) -- 0:00:58
487500 -- (-543.271) (-539.671) (-534.352) [-535.062] * (-546.146) [-532.757] (-537.910) (-538.705) -- 0:00:58
488000 -- (-540.971) (-534.218) [-539.022] (-536.236) * (-536.948) [-537.877] (-536.538) (-545.806) -- 0:00:58
488500 -- (-542.257) (-537.406) [-535.943] (-537.607) * (-544.828) [-532.847] (-538.133) (-535.263) -- 0:00:58
489000 -- (-541.041) (-532.654) [-537.197] (-535.602) * (-542.673) (-538.755) [-536.458] (-536.668) -- 0:00:58
489500 -- (-538.010) (-539.702) [-530.069] (-531.985) * (-540.920) (-537.749) [-538.931] (-540.357) -- 0:00:58
490000 -- (-539.210) (-541.850) [-538.028] (-536.554) * (-538.566) [-533.912] (-550.903) (-535.160) -- 0:00:58
Average standard deviation of split frequencies: 0.002402
490500 -- (-543.447) [-539.799] (-534.644) (-536.497) * (-540.165) (-536.003) [-536.319] (-534.866) -- 0:00:58
491000 -- [-535.813] (-539.686) (-548.495) (-541.044) * (-537.299) (-534.008) (-538.047) [-534.707] -- 0:00:58
491500 -- (-538.915) (-538.915) [-532.650] (-533.147) * (-540.299) (-534.326) [-538.504] (-535.804) -- 0:00:57
492000 -- (-539.202) (-539.243) (-537.961) [-540.970] * [-539.163] (-538.796) (-545.581) (-538.722) -- 0:00:58
492500 -- (-541.277) (-538.986) (-536.626) [-534.825] * (-541.641) (-536.249) (-539.641) [-538.977] -- 0:00:58
493000 -- (-535.878) (-537.835) (-537.373) [-531.868] * (-539.625) (-532.372) [-535.923] (-534.511) -- 0:00:58
493500 -- (-533.808) (-539.020) [-535.952] (-532.942) * [-537.048] (-533.754) (-541.937) (-539.612) -- 0:00:58
494000 -- [-536.628] (-541.678) (-534.593) (-537.245) * (-537.832) [-534.649] (-540.245) (-539.358) -- 0:00:58
494500 -- (-536.557) [-541.283] (-539.248) (-535.072) * (-533.840) (-535.312) (-544.119) [-534.153] -- 0:00:58
495000 -- (-542.028) [-537.204] (-544.857) (-535.061) * [-536.722] (-542.137) (-535.969) (-536.175) -- 0:00:58
Average standard deviation of split frequencies: 0.002376
495500 -- (-532.162) (-541.483) [-534.816] (-533.422) * (-538.426) (-537.598) (-537.577) [-535.047] -- 0:00:58
496000 -- (-535.727) (-532.934) (-542.519) [-534.958] * (-536.631) [-541.654] (-544.050) (-535.090) -- 0:00:57
496500 -- (-536.320) (-552.135) (-540.405) [-539.189] * [-536.310] (-537.886) (-536.198) (-534.262) -- 0:00:57
497000 -- (-538.185) (-536.610) [-534.261] (-548.188) * [-537.528] (-531.524) (-541.916) (-534.433) -- 0:00:57
497500 -- (-538.311) [-539.358] (-539.999) (-539.210) * (-541.391) (-537.641) [-545.511] (-534.334) -- 0:00:57
498000 -- (-545.895) (-536.067) [-536.915] (-549.298) * (-539.664) (-537.927) [-534.805] (-548.511) -- 0:00:57
498500 -- [-534.340] (-532.179) (-535.864) (-544.706) * (-533.663) [-533.658] (-539.133) (-538.167) -- 0:00:57
499000 -- (-537.204) (-533.388) [-535.294] (-545.473) * (-533.527) (-544.217) (-538.952) [-538.893] -- 0:00:57
499500 -- (-538.624) [-537.988] (-540.730) (-540.265) * (-532.924) [-538.469] (-537.606) (-536.324) -- 0:00:57
500000 -- [-537.329] (-535.751) (-543.556) (-539.268) * (-537.625) (-536.788) (-538.313) [-537.316] -- 0:00:57
Average standard deviation of split frequencies: 0.002354
500500 -- (-536.779) [-536.118] (-534.574) (-533.418) * (-539.795) (-537.440) (-538.193) [-536.324] -- 0:00:56
501000 -- (-537.647) [-539.632] (-543.619) (-538.732) * (-537.878) (-543.503) [-537.018] (-537.532) -- 0:00:57
501500 -- (-545.179) [-536.921] (-540.521) (-537.027) * [-532.177] (-539.409) (-538.217) (-538.541) -- 0:00:57
502000 -- [-537.321] (-537.222) (-534.724) (-545.370) * (-535.795) (-534.148) [-534.811] (-536.303) -- 0:00:57
502500 -- (-542.786) [-536.540] (-539.300) (-542.265) * (-538.848) (-537.182) (-532.412) [-535.570] -- 0:00:57
503000 -- (-540.842) (-538.019) (-536.828) [-538.690] * (-535.671) (-535.430) (-537.652) [-537.164] -- 0:00:57
503500 -- [-533.437] (-543.012) (-536.220) (-530.317) * (-541.087) (-533.619) [-533.790] (-537.897) -- 0:00:57
504000 -- [-532.375] (-541.967) (-533.433) (-548.901) * (-535.860) (-535.401) (-535.477) [-535.711] -- 0:00:57
504500 -- (-541.565) (-533.320) (-542.598) [-540.639] * (-534.243) (-536.567) [-532.983] (-534.877) -- 0:00:56
505000 -- (-538.168) (-531.447) [-540.474] (-537.116) * (-534.570) (-539.493) (-535.994) [-529.469] -- 0:00:56
Average standard deviation of split frequencies: 0.002795
505500 -- [-536.613] (-537.197) (-538.681) (-535.604) * (-535.925) [-540.114] (-532.511) (-540.649) -- 0:00:56
506000 -- (-535.182) (-534.274) (-530.580) [-536.667] * [-539.979] (-541.180) (-538.615) (-538.374) -- 0:00:56
506500 -- (-532.307) (-534.402) [-533.253] (-531.250) * (-537.923) [-539.194] (-532.656) (-533.540) -- 0:00:56
507000 -- (-533.212) (-536.510) (-538.677) [-536.626] * (-538.548) [-540.550] (-537.958) (-534.332) -- 0:00:56
507500 -- (-536.156) (-532.696) (-539.071) [-540.805] * [-535.562] (-546.534) (-537.942) (-539.076) -- 0:00:56
508000 -- [-533.811] (-541.538) (-542.611) (-537.007) * (-535.340) [-540.265] (-539.644) (-543.944) -- 0:00:56
508500 -- [-539.915] (-537.513) (-541.172) (-536.030) * (-540.056) (-544.490) (-540.473) [-535.693] -- 0:00:56
509000 -- (-537.023) [-535.089] (-542.122) (-539.575) * (-538.188) (-539.971) [-541.367] (-541.468) -- 0:00:55
509500 -- (-536.268) (-543.584) (-544.046) [-538.436] * (-536.572) [-541.083] (-536.422) (-537.332) -- 0:00:56
510000 -- [-535.724] (-534.850) (-540.360) (-535.386) * [-534.049] (-537.773) (-538.456) (-542.029) -- 0:00:56
Average standard deviation of split frequencies: 0.002769
510500 -- (-545.223) [-536.194] (-539.622) (-542.213) * (-538.849) (-540.205) (-534.707) [-537.823] -- 0:00:56
511000 -- (-536.511) (-539.885) (-543.226) [-540.801] * (-539.189) (-540.581) (-546.337) [-536.576] -- 0:00:56
511500 -- [-538.242] (-533.114) (-536.000) (-538.277) * (-547.520) (-542.856) (-543.632) [-532.171] -- 0:00:56
512000 -- (-539.702) [-537.065] (-539.329) (-541.839) * (-538.807) (-539.021) (-541.828) [-536.978] -- 0:00:56
512500 -- (-532.519) (-537.908) [-540.485] (-538.297) * (-537.067) (-544.985) (-544.318) [-533.390] -- 0:00:56
513000 -- (-540.645) [-537.729] (-539.751) (-540.141) * (-540.214) (-541.368) [-539.032] (-542.409) -- 0:00:56
513500 -- (-549.427) [-533.524] (-539.778) (-538.565) * (-540.314) (-538.834) (-542.411) [-540.163] -- 0:00:55
514000 -- (-536.712) [-537.698] (-555.616) (-538.276) * [-541.352] (-538.939) (-539.551) (-541.121) -- 0:00:55
514500 -- (-539.629) [-539.252] (-545.658) (-537.292) * [-541.418] (-539.077) (-537.208) (-533.570) -- 0:00:55
515000 -- (-536.771) (-534.589) (-539.443) [-533.086] * [-537.258] (-542.594) (-544.949) (-537.187) -- 0:00:55
Average standard deviation of split frequencies: 0.002741
515500 -- (-541.479) (-534.960) (-535.896) [-538.782] * (-538.936) (-537.396) (-542.850) [-540.478] -- 0:00:55
516000 -- (-543.770) (-536.343) [-541.011] (-541.809) * (-544.637) (-535.550) (-548.065) [-534.349] -- 0:00:55
516500 -- (-535.357) (-534.300) [-537.925] (-551.482) * (-540.735) [-535.024] (-538.153) (-534.626) -- 0:00:55
517000 -- (-542.215) [-536.580] (-539.490) (-547.233) * (-536.635) (-539.005) (-543.732) [-533.973] -- 0:00:55
517500 -- (-540.273) (-540.760) [-536.798] (-538.872) * (-541.955) (-536.009) (-538.150) [-531.995] -- 0:00:55
518000 -- [-536.958] (-540.823) (-537.538) (-544.984) * (-534.216) (-541.545) (-544.360) [-532.845] -- 0:00:54
518500 -- (-539.942) (-542.891) [-540.546] (-542.018) * (-536.023) (-539.729) (-544.723) [-537.621] -- 0:00:55
519000 -- (-533.826) (-536.227) (-540.922) [-543.058] * (-537.482) (-544.196) [-537.199] (-539.649) -- 0:00:55
519500 -- (-540.096) (-547.921) (-535.263) [-536.981] * (-539.941) (-540.170) [-537.725] (-544.960) -- 0:00:55
520000 -- [-533.244] (-537.544) (-539.122) (-539.885) * (-541.045) (-536.683) [-534.903] (-536.534) -- 0:00:55
Average standard deviation of split frequencies: 0.002716
520500 -- (-536.137) [-540.681] (-539.787) (-543.464) * (-534.853) (-540.351) (-531.339) [-537.823] -- 0:00:55
521000 -- (-546.727) (-536.646) [-542.232] (-544.104) * (-539.957) (-541.345) [-536.065] (-533.920) -- 0:00:55
521500 -- (-544.002) (-537.233) (-540.583) [-540.855] * (-538.480) (-536.751) [-540.714] (-537.985) -- 0:00:55
522000 -- [-540.423] (-537.731) (-540.915) (-537.442) * (-542.871) (-543.659) [-537.875] (-532.911) -- 0:00:54
522500 -- [-534.724] (-543.244) (-546.964) (-543.221) * [-533.059] (-541.753) (-540.573) (-537.092) -- 0:00:54
523000 -- (-537.025) (-540.277) (-545.811) [-537.792] * (-532.937) (-542.841) [-536.795] (-536.319) -- 0:00:54
523500 -- (-537.180) [-542.727] (-544.948) (-538.895) * [-545.897] (-540.395) (-539.136) (-536.100) -- 0:00:54
524000 -- [-538.488] (-547.787) (-544.829) (-536.135) * (-539.065) [-538.016] (-534.938) (-547.060) -- 0:00:54
524500 -- [-540.364] (-539.111) (-539.831) (-538.750) * (-536.751) (-542.800) [-541.386] (-536.409) -- 0:00:54
525000 -- (-546.565) (-539.854) (-538.174) [-541.618] * (-542.632) (-539.488) (-537.545) [-535.275] -- 0:00:54
Average standard deviation of split frequencies: 0.002689
525500 -- (-536.036) [-534.671] (-542.861) (-544.600) * (-536.081) (-539.161) [-536.077] (-533.614) -- 0:00:54
526000 -- (-545.866) [-537.262] (-539.003) (-545.427) * (-532.848) (-536.907) [-541.245] (-538.998) -- 0:00:54
526500 -- (-538.739) (-538.266) [-539.112] (-542.592) * (-535.816) (-538.973) [-535.978] (-544.239) -- 0:00:53
527000 -- (-535.897) (-541.913) [-539.227] (-539.881) * (-543.420) [-536.844] (-537.864) (-544.560) -- 0:00:54
527500 -- (-532.352) (-544.546) [-538.633] (-538.817) * (-536.385) (-536.625) (-535.004) [-543.487] -- 0:00:54
528000 -- (-538.890) (-538.564) (-538.039) [-538.586] * (-533.916) (-544.071) (-535.338) [-536.882] -- 0:00:54
528500 -- (-542.823) (-546.222) (-549.916) [-533.995] * (-540.955) [-534.526] (-533.356) (-534.985) -- 0:00:54
529000 -- [-540.916] (-541.663) (-536.316) (-541.306) * (-535.612) [-540.119] (-536.284) (-538.526) -- 0:00:54
529500 -- (-541.478) (-537.167) (-548.575) [-545.693] * (-538.539) (-540.927) (-539.435) [-537.913] -- 0:00:54
530000 -- (-542.318) (-537.223) (-541.433) [-544.191] * (-535.871) (-538.468) [-543.586] (-535.968) -- 0:00:54
Average standard deviation of split frequencies: 0.003553
530500 -- [-536.243] (-535.831) (-537.683) (-542.045) * (-540.083) (-543.429) [-542.559] (-544.671) -- 0:00:53
531000 -- (-538.003) [-537.035] (-541.879) (-541.716) * (-536.684) (-543.389) [-534.003] (-536.058) -- 0:00:53
531500 -- [-531.535] (-540.404) (-540.672) (-534.113) * (-538.321) (-535.637) (-533.951) [-536.161] -- 0:00:53
532000 -- (-537.892) (-539.824) [-538.538] (-535.407) * [-538.086] (-538.640) (-537.461) (-536.200) -- 0:00:53
532500 -- [-537.931] (-543.579) (-533.498) (-536.583) * (-534.116) (-546.203) [-532.361] (-532.161) -- 0:00:53
533000 -- [-533.948] (-534.731) (-537.164) (-541.658) * [-536.437] (-546.897) (-536.422) (-534.367) -- 0:00:53
533500 -- (-538.087) (-536.227) (-535.890) [-537.925] * (-541.409) (-543.342) (-535.796) [-535.699] -- 0:00:53
534000 -- (-534.118) [-540.717] (-538.070) (-538.618) * (-543.511) (-540.324) (-534.466) [-539.154] -- 0:00:53
534500 -- (-537.345) [-535.730] (-534.642) (-543.256) * (-547.974) (-540.998) (-540.766) [-537.353] -- 0:00:53
535000 -- (-543.352) (-545.813) [-538.340] (-542.860) * (-542.307) (-541.180) [-543.146] (-539.357) -- 0:00:53
Average standard deviation of split frequencies: 0.002638
535500 -- (-540.846) (-538.040) (-544.253) [-533.470] * (-551.476) (-539.280) (-541.376) [-536.032] -- 0:00:53
536000 -- (-538.954) (-536.945) [-531.876] (-537.175) * [-538.055] (-538.619) (-535.960) (-537.412) -- 0:00:53
536500 -- (-538.364) [-535.689] (-533.917) (-536.330) * (-544.837) (-541.957) [-539.252] (-545.547) -- 0:00:53
537000 -- [-535.285] (-544.434) (-539.302) (-538.531) * (-542.578) (-541.838) [-536.679] (-541.193) -- 0:00:53
537500 -- (-538.874) (-539.369) [-536.946] (-536.663) * (-539.874) (-543.387) [-536.438] (-547.673) -- 0:00:53
538000 -- (-542.564) (-540.834) (-539.920) [-539.143] * (-540.859) (-540.521) [-538.213] (-545.094) -- 0:00:53
538500 -- (-545.372) (-544.955) (-538.623) [-538.307] * (-542.154) [-534.347] (-535.946) (-547.889) -- 0:00:53
539000 -- (-545.700) (-547.000) [-536.838] (-535.549) * (-539.948) [-540.074] (-545.253) (-544.766) -- 0:00:53
539500 -- (-540.992) (-537.819) [-541.113] (-535.891) * (-541.529) (-538.252) (-537.780) [-536.767] -- 0:00:52
540000 -- (-540.415) (-539.602) (-537.164) [-551.697] * (-545.630) (-542.700) [-534.615] (-536.061) -- 0:00:52
Average standard deviation of split frequencies: 0.003052
540500 -- (-539.561) (-539.734) (-543.225) [-543.678] * [-547.528] (-536.191) (-537.893) (-543.090) -- 0:00:52
541000 -- (-538.815) (-536.386) [-532.425] (-539.360) * [-540.926] (-544.899) (-540.852) (-536.233) -- 0:00:52
541500 -- (-537.664) (-542.409) [-538.654] (-538.607) * (-548.812) (-540.886) [-535.769] (-542.182) -- 0:00:52
542000 -- (-537.288) [-537.105] (-542.739) (-539.694) * (-540.492) (-537.995) [-534.806] (-540.527) -- 0:00:52
542500 -- (-536.559) (-547.262) [-535.837] (-537.039) * (-537.351) [-539.692] (-534.494) (-536.560) -- 0:00:52
543000 -- [-540.118] (-537.297) (-537.812) (-538.890) * [-548.480] (-542.424) (-536.252) (-539.314) -- 0:00:52
543500 -- (-539.639) [-536.689] (-542.224) (-538.098) * [-541.218] (-534.619) (-535.531) (-542.293) -- 0:00:52
544000 -- (-538.040) (-544.845) (-537.856) [-538.460] * (-538.326) [-533.191] (-537.785) (-539.281) -- 0:00:51
544500 -- [-538.109] (-535.198) (-542.911) (-536.530) * (-539.233) (-542.086) [-534.002] (-544.505) -- 0:00:52
545000 -- (-532.145) [-538.817] (-537.828) (-541.024) * (-539.971) (-540.441) [-538.768] (-544.570) -- 0:00:52
Average standard deviation of split frequencies: 0.002158
545500 -- [-531.953] (-537.528) (-542.035) (-531.000) * [-544.271] (-550.515) (-533.222) (-539.975) -- 0:00:52
546000 -- [-535.053] (-537.186) (-535.446) (-539.664) * (-544.115) (-544.509) [-535.404] (-536.509) -- 0:00:52
546500 -- (-534.624) (-540.730) (-534.100) [-536.472] * (-540.367) (-540.678) (-539.547) [-534.260] -- 0:00:52
547000 -- (-535.400) (-542.459) (-538.430) [-538.753] * (-535.588) (-538.658) (-537.807) [-540.721] -- 0:00:52
547500 -- (-542.369) [-533.767] (-543.264) (-535.142) * (-537.316) [-535.704] (-532.082) (-544.989) -- 0:00:52
548000 -- (-536.927) (-539.002) (-544.762) [-531.499] * (-537.298) (-535.082) [-533.622] (-533.814) -- 0:00:51
548500 -- [-539.241] (-535.005) (-541.672) (-537.763) * (-536.075) (-544.739) [-536.593] (-534.407) -- 0:00:51
549000 -- [-540.755] (-536.232) (-542.327) (-535.771) * [-533.890] (-540.854) (-539.279) (-533.795) -- 0:00:51
549500 -- (-533.968) (-539.986) [-536.465] (-534.912) * (-536.591) (-545.548) (-537.666) [-534.820] -- 0:00:51
550000 -- (-539.131) [-535.673] (-538.609) (-536.587) * (-538.323) (-540.829) [-536.997] (-537.567) -- 0:00:51
Average standard deviation of split frequencies: 0.002568
550500 -- [-534.392] (-534.645) (-545.443) (-533.893) * [-537.570] (-534.238) (-537.795) (-543.927) -- 0:00:51
551000 -- (-545.694) (-539.447) (-535.940) [-539.477] * [-537.668] (-535.013) (-536.901) (-534.969) -- 0:00:51
551500 -- (-539.245) (-537.979) (-534.413) [-542.040] * [-534.222] (-537.132) (-532.418) (-535.407) -- 0:00:51
552000 -- (-540.910) (-538.952) [-534.734] (-541.283) * (-531.028) (-542.846) (-534.178) [-536.859] -- 0:00:51
552500 -- (-543.862) [-539.985] (-535.402) (-545.228) * (-537.788) (-536.183) (-535.646) [-538.177] -- 0:00:51
553000 -- (-539.035) (-544.256) [-540.021] (-535.933) * (-535.986) [-536.589] (-537.962) (-541.263) -- 0:00:51
553500 -- (-539.256) (-536.265) [-535.047] (-538.545) * [-531.674] (-534.095) (-536.650) (-541.597) -- 0:00:51
554000 -- (-540.122) [-532.467] (-538.436) (-538.508) * (-544.544) [-536.816] (-537.907) (-538.916) -- 0:00:51
554500 -- (-541.709) (-536.998) [-541.604] (-538.350) * (-537.364) (-537.843) (-538.946) [-543.410] -- 0:00:51
555000 -- (-540.695) (-537.938) [-536.062] (-542.347) * [-539.875] (-541.556) (-541.174) (-538.260) -- 0:00:51
Average standard deviation of split frequencies: 0.002120
555500 -- (-539.943) (-534.278) [-540.648] (-548.005) * (-538.743) (-535.988) [-532.697] (-536.364) -- 0:00:51
556000 -- (-540.792) (-541.048) (-536.028) [-535.276] * (-533.233) (-538.422) [-532.836] (-541.511) -- 0:00:51
556500 -- (-541.928) [-534.544] (-543.294) (-541.940) * (-548.357) [-535.530] (-535.740) (-536.898) -- 0:00:51
557000 -- [-535.265] (-535.745) (-536.315) (-536.342) * (-537.300) [-540.878] (-534.016) (-535.294) -- 0:00:50
557500 -- (-534.485) [-539.018] (-534.858) (-549.247) * [-537.150] (-536.198) (-535.830) (-543.339) -- 0:00:50
558000 -- (-530.013) [-532.698] (-535.301) (-538.852) * [-536.117] (-539.055) (-535.913) (-540.108) -- 0:00:50
558500 -- (-542.658) [-531.710] (-533.358) (-535.513) * [-531.983] (-551.409) (-537.392) (-545.133) -- 0:00:50
559000 -- (-540.963) (-537.972) (-533.633) [-545.349] * (-538.617) [-538.943] (-534.431) (-540.303) -- 0:00:50
559500 -- [-532.715] (-531.252) (-532.634) (-540.397) * (-535.659) [-537.221] (-532.788) (-536.270) -- 0:00:50
560000 -- (-539.760) [-535.273] (-536.780) (-538.863) * (-533.083) (-540.904) (-542.453) [-531.838] -- 0:00:50
Average standard deviation of split frequencies: 0.002522
560500 -- (-536.292) (-537.981) [-533.880] (-541.866) * (-532.918) (-540.354) (-535.768) [-533.957] -- 0:00:50
561000 -- (-536.232) [-533.901] (-535.789) (-540.719) * (-535.200) [-543.660] (-534.138) (-542.545) -- 0:00:50
561500 -- (-534.729) [-539.347] (-533.516) (-539.890) * (-535.244) (-537.206) (-534.559) [-535.685] -- 0:00:50
562000 -- [-536.144] (-529.355) (-539.098) (-548.068) * (-534.825) (-537.835) (-538.314) [-538.522] -- 0:00:50
562500 -- (-539.266) (-537.857) (-536.179) [-538.296] * (-534.691) [-535.612] (-536.941) (-542.848) -- 0:00:50
563000 -- (-540.630) [-532.898] (-537.263) (-535.049) * [-535.875] (-550.128) (-543.230) (-543.393) -- 0:00:50
563500 -- (-539.025) (-535.630) (-539.721) [-533.384] * (-536.778) (-534.107) [-535.906] (-545.790) -- 0:00:50
564000 -- (-537.283) (-537.625) (-534.813) [-541.622] * (-538.310) [-534.066] (-539.167) (-536.446) -- 0:00:50
564500 -- (-537.189) [-536.586] (-539.837) (-540.613) * [-535.387] (-536.134) (-540.069) (-538.417) -- 0:00:50
565000 -- (-531.874) (-535.893) [-534.952] (-537.688) * (-535.600) [-537.188] (-539.328) (-533.619) -- 0:00:50
Average standard deviation of split frequencies: 0.002915
565500 -- (-540.463) (-534.314) [-538.917] (-540.234) * [-532.378] (-531.805) (-543.888) (-542.684) -- 0:00:49
566000 -- (-538.260) (-531.970) [-540.279] (-543.034) * (-537.672) [-531.818] (-541.607) (-536.179) -- 0:00:49
566500 -- [-534.370] (-536.575) (-543.246) (-537.152) * (-538.036) [-535.205] (-551.162) (-548.120) -- 0:00:49
567000 -- (-532.238) [-536.508] (-537.688) (-545.175) * [-539.096] (-537.824) (-549.941) (-542.531) -- 0:00:49
567500 -- (-533.025) (-542.248) (-539.883) [-544.276] * (-535.478) (-540.048) [-539.672] (-540.326) -- 0:00:49
568000 -- [-533.929] (-539.578) (-541.612) (-540.760) * (-537.328) [-538.531] (-542.621) (-545.462) -- 0:00:49
568500 -- (-534.634) (-537.297) [-535.994] (-544.419) * [-532.706] (-539.015) (-542.081) (-539.989) -- 0:00:49
569000 -- [-539.331] (-540.913) (-541.952) (-540.654) * (-534.823) (-542.729) [-537.590] (-540.279) -- 0:00:49
569500 -- (-539.399) (-532.132) [-542.259] (-544.605) * [-535.317] (-538.559) (-538.413) (-538.832) -- 0:00:49
570000 -- (-539.362) (-538.140) [-534.594] (-543.276) * [-535.709] (-539.257) (-530.585) (-539.370) -- 0:00:49
Average standard deviation of split frequencies: 0.002478
570500 -- (-539.855) (-535.355) [-533.587] (-539.976) * [-531.140] (-540.148) (-536.935) (-535.038) -- 0:00:49
571000 -- (-541.771) (-531.512) (-535.847) [-540.362] * (-532.112) [-540.816] (-538.157) (-538.290) -- 0:00:49
571500 -- [-533.952] (-542.866) (-537.735) (-543.710) * (-536.250) (-535.783) [-534.191] (-538.446) -- 0:00:49
572000 -- (-537.517) (-539.639) [-540.603] (-538.860) * (-537.240) (-536.058) [-533.333] (-541.261) -- 0:00:49
572500 -- (-547.782) (-535.828) (-541.447) [-539.277] * (-538.047) (-537.298) (-539.131) [-546.544] -- 0:00:49
573000 -- [-533.797] (-539.427) (-536.785) (-541.193) * (-544.094) (-532.709) (-540.701) [-534.204] -- 0:00:49
573500 -- [-532.377] (-536.042) (-545.152) (-538.910) * (-545.641) (-539.952) (-539.764) [-539.499] -- 0:00:49
574000 -- (-542.400) [-535.267] (-540.985) (-542.900) * (-549.282) (-544.408) [-532.875] (-532.773) -- 0:00:48
574500 -- (-538.224) (-535.544) [-540.496] (-540.624) * [-538.597] (-535.264) (-534.952) (-539.966) -- 0:00:48
575000 -- (-536.674) (-542.383) [-532.167] (-536.701) * (-548.241) (-531.573) [-532.074] (-540.883) -- 0:00:48
Average standard deviation of split frequencies: 0.002455
575500 -- [-545.604] (-540.184) (-534.991) (-537.583) * (-554.296) [-532.778] (-535.611) (-537.622) -- 0:00:48
576000 -- (-533.001) (-537.505) (-538.825) [-544.931] * (-542.925) (-538.448) [-534.443] (-539.493) -- 0:00:48
576500 -- (-532.751) [-534.103] (-543.255) (-539.869) * (-546.674) (-537.962) (-534.555) [-534.611] -- 0:00:48
577000 -- (-540.731) (-539.467) [-536.563] (-542.469) * (-547.450) [-536.405] (-543.916) (-535.976) -- 0:00:48
577500 -- (-534.756) [-538.383] (-536.600) (-546.428) * (-540.169) [-538.527] (-539.290) (-537.818) -- 0:00:48
578000 -- (-535.143) (-540.120) [-538.250] (-547.857) * (-540.856) [-540.009] (-536.251) (-541.145) -- 0:00:48
578500 -- (-534.507) (-534.941) [-536.422] (-547.090) * (-550.598) [-533.346] (-537.956) (-535.880) -- 0:00:48
579000 -- (-541.041) (-539.973) (-537.935) [-535.205] * (-542.603) (-537.354) [-537.358] (-536.441) -- 0:00:48
579500 -- (-536.540) (-547.913) (-537.084) [-537.408] * (-536.361) (-540.350) (-538.873) [-535.307] -- 0:00:48
580000 -- [-537.114] (-540.850) (-531.844) (-539.730) * (-535.720) (-538.693) (-544.792) [-537.967] -- 0:00:48
Average standard deviation of split frequencies: 0.002435
580500 -- (-539.956) [-537.929] (-542.978) (-535.837) * (-547.840) (-543.222) (-537.487) [-534.562] -- 0:00:48
581000 -- [-538.294] (-547.234) (-537.666) (-539.542) * (-541.734) (-541.901) [-531.982] (-535.741) -- 0:00:48
581500 -- (-546.134) (-544.354) (-540.745) [-537.575] * (-544.442) (-543.728) [-535.640] (-537.292) -- 0:00:48
582000 -- (-537.894) (-541.164) (-534.757) [-534.184] * (-539.559) (-536.639) [-532.393] (-538.992) -- 0:00:48
582500 -- [-531.240] (-543.304) (-538.904) (-537.909) * (-540.782) (-537.559) [-531.208] (-540.543) -- 0:00:48
583000 -- (-536.912) [-540.665] (-545.649) (-546.679) * (-541.714) [-536.952] (-551.342) (-539.633) -- 0:00:47
583500 -- (-533.239) (-548.245) [-536.030] (-534.999) * (-538.269) (-543.299) (-539.187) [-542.874] -- 0:00:47
584000 -- (-536.171) [-540.219] (-534.166) (-539.680) * (-533.514) (-535.543) [-532.914] (-539.109) -- 0:00:47
584500 -- [-531.781] (-542.023) (-539.508) (-539.160) * (-542.300) [-532.388] (-535.317) (-542.443) -- 0:00:47
585000 -- (-536.088) [-540.673] (-539.351) (-541.877) * [-540.996] (-540.125) (-535.191) (-539.778) -- 0:00:47
Average standard deviation of split frequencies: 0.002413
585500 -- [-531.626] (-536.048) (-537.357) (-546.609) * (-544.299) (-543.021) [-537.463] (-552.897) -- 0:00:47
586000 -- (-538.348) [-535.125] (-534.656) (-546.502) * (-536.974) [-536.598] (-534.405) (-548.882) -- 0:00:47
586500 -- (-536.267) [-539.559] (-531.830) (-548.045) * (-540.359) (-537.512) [-538.583] (-536.941) -- 0:00:47
587000 -- (-534.309) (-546.740) [-536.449] (-546.424) * (-536.531) (-537.084) (-540.989) [-541.249] -- 0:00:47
587500 -- (-554.035) [-538.434] (-538.059) (-542.362) * (-533.299) [-537.636] (-544.085) (-542.741) -- 0:00:47
588000 -- [-537.143] (-532.396) (-536.540) (-534.407) * [-536.918] (-547.319) (-544.707) (-537.434) -- 0:00:47
588500 -- (-542.842) (-533.771) [-534.848] (-541.307) * (-539.070) [-540.020] (-546.778) (-541.590) -- 0:00:47
589000 -- (-532.133) (-535.711) [-536.443] (-546.528) * (-535.000) (-537.889) (-540.482) [-540.280] -- 0:00:47
589500 -- (-539.896) [-534.651] (-538.988) (-539.798) * [-538.676] (-538.039) (-538.207) (-539.511) -- 0:00:47
590000 -- [-536.395] (-536.965) (-541.142) (-535.089) * (-539.915) [-536.279] (-544.625) (-544.333) -- 0:00:47
Average standard deviation of split frequencies: 0.002394
590500 -- [-535.826] (-531.074) (-544.786) (-538.324) * [-535.390] (-540.848) (-546.816) (-544.461) -- 0:00:47
591000 -- (-537.684) [-534.027] (-534.373) (-533.951) * (-538.535) (-538.105) [-543.447] (-540.215) -- 0:00:47
591500 -- (-541.101) (-537.822) (-535.221) [-542.129] * [-536.851] (-542.165) (-542.074) (-541.082) -- 0:00:46
592000 -- (-544.227) (-537.984) (-533.397) [-536.915] * [-542.799] (-537.324) (-537.416) (-541.784) -- 0:00:46
592500 -- (-541.705) [-537.116] (-531.133) (-541.508) * (-538.087) (-539.142) [-546.711] (-536.977) -- 0:00:46
593000 -- (-543.551) (-533.235) (-536.583) [-536.105] * [-537.627] (-534.220) (-541.133) (-536.400) -- 0:00:46
593500 -- (-543.125) (-534.388) (-539.633) [-534.464] * (-535.147) (-538.123) (-546.569) [-539.220] -- 0:00:46
594000 -- (-545.111) [-536.136] (-536.197) (-538.596) * (-536.320) [-535.058] (-536.663) (-549.838) -- 0:00:46
594500 -- (-533.819) (-533.688) (-536.100) [-537.543] * (-535.834) (-537.270) (-542.473) [-540.152] -- 0:00:46
595000 -- (-538.109) [-538.949] (-536.266) (-538.297) * (-535.029) [-540.053] (-534.429) (-548.847) -- 0:00:46
Average standard deviation of split frequencies: 0.001977
595500 -- (-535.974) [-533.486] (-535.705) (-545.598) * [-536.621] (-538.768) (-533.090) (-537.442) -- 0:00:46
596000 -- (-537.321) [-537.068] (-537.882) (-538.702) * (-539.892) [-534.025] (-539.351) (-540.923) -- 0:00:46
596500 -- [-532.880] (-536.631) (-535.430) (-544.336) * (-542.327) (-541.138) [-536.926] (-540.426) -- 0:00:46
597000 -- (-536.254) (-540.797) (-531.617) [-539.740] * (-536.000) (-537.032) (-535.449) [-537.099] -- 0:00:46
597500 -- (-548.584) (-538.411) [-535.492] (-538.246) * (-539.966) [-542.967] (-536.443) (-537.684) -- 0:00:46
598000 -- (-542.249) (-544.103) [-542.188] (-540.702) * (-538.305) (-541.733) [-536.962] (-542.378) -- 0:00:46
598500 -- [-538.036] (-539.203) (-547.776) (-542.713) * (-543.177) [-534.571] (-534.419) (-540.599) -- 0:00:46
599000 -- [-532.439] (-541.157) (-542.463) (-535.853) * (-539.269) (-537.533) (-537.036) [-536.800] -- 0:00:46
599500 -- (-536.807) (-536.901) (-543.654) [-535.651] * (-535.668) (-536.677) [-535.516] (-543.042) -- 0:00:46
600000 -- (-541.622) [-535.331] (-541.129) (-540.731) * (-536.867) (-537.647) (-532.726) [-533.652] -- 0:00:46
Average standard deviation of split frequencies: 0.001962
600500 -- (-531.181) [-535.613] (-538.231) (-540.245) * (-540.161) [-536.670] (-533.940) (-534.785) -- 0:00:45
601000 -- (-537.297) (-538.665) [-540.845] (-534.147) * (-534.982) [-534.331] (-537.854) (-534.416) -- 0:00:45
601500 -- (-532.892) (-532.027) (-540.864) [-539.308] * (-534.636) (-538.532) [-531.874] (-534.554) -- 0:00:45
602000 -- (-536.452) [-535.398] (-535.085) (-540.959) * (-537.665) [-533.113] (-535.314) (-537.981) -- 0:00:45
602500 -- (-538.289) [-533.974] (-539.700) (-538.624) * (-534.699) (-537.746) [-536.138] (-540.066) -- 0:00:45
603000 -- (-535.976) [-536.967] (-534.027) (-544.743) * (-538.470) [-534.743] (-537.605) (-543.241) -- 0:00:45
603500 -- (-537.376) (-536.092) [-535.903] (-543.328) * [-532.029] (-534.005) (-535.511) (-542.081) -- 0:00:45
604000 -- (-540.354) [-536.811] (-540.203) (-553.520) * [-537.144] (-541.934) (-540.580) (-538.168) -- 0:00:45
604500 -- (-535.895) [-536.688] (-536.797) (-536.826) * (-541.529) (-535.845) (-538.809) [-537.048] -- 0:00:45
605000 -- (-537.876) (-532.661) [-540.690] (-542.154) * (-539.604) [-534.571] (-535.845) (-535.775) -- 0:00:45
Average standard deviation of split frequencies: 0.001167
605500 -- [-534.267] (-538.416) (-537.152) (-546.013) * (-541.715) (-541.909) (-539.356) [-537.557] -- 0:00:45
606000 -- (-535.324) [-536.273] (-537.596) (-546.728) * (-539.560) [-538.472] (-536.024) (-541.230) -- 0:00:45
606500 -- (-537.778) (-537.736) [-538.623] (-547.198) * (-532.541) (-538.915) (-543.137) [-540.045] -- 0:00:45
607000 -- [-533.648] (-543.151) (-543.162) (-548.021) * (-536.271) [-544.757] (-536.953) (-541.196) -- 0:00:45
607500 -- (-539.660) [-539.341] (-540.736) (-539.906) * (-536.581) [-532.569] (-535.301) (-536.209) -- 0:00:45
608000 -- [-534.549] (-542.322) (-538.729) (-534.925) * [-533.711] (-535.652) (-545.145) (-538.069) -- 0:00:45
608500 -- (-533.624) [-537.078] (-541.101) (-537.263) * (-534.404) [-537.479] (-538.054) (-534.745) -- 0:00:45
609000 -- [-536.311] (-536.767) (-542.078) (-534.948) * (-539.622) (-541.263) (-537.514) [-535.249] -- 0:00:44
609500 -- (-535.073) (-535.124) [-532.528] (-546.323) * [-541.304] (-539.658) (-538.256) (-539.512) -- 0:00:44
610000 -- (-540.352) [-537.653] (-544.553) (-537.265) * (-539.228) (-532.392) (-544.300) [-536.278] -- 0:00:44
Average standard deviation of split frequencies: 0.001158
610500 -- (-536.851) (-536.020) [-535.272] (-535.232) * [-535.849] (-533.588) (-535.398) (-542.674) -- 0:00:44
611000 -- (-541.827) (-532.630) (-534.488) [-532.969] * [-536.496] (-537.429) (-539.926) (-533.750) -- 0:00:44
611500 -- (-544.054) (-538.978) [-532.014] (-534.423) * (-545.195) (-532.596) [-535.851] (-532.437) -- 0:00:44
612000 -- (-547.192) [-540.703] (-535.994) (-536.290) * (-548.146) (-536.971) (-541.927) [-531.710] -- 0:00:44
612500 -- [-540.055] (-537.332) (-535.396) (-533.691) * (-536.689) (-540.204) (-534.775) [-535.951] -- 0:00:44
613000 -- (-536.039) [-538.796] (-535.622) (-531.881) * (-539.871) (-540.401) (-538.895) [-536.566] -- 0:00:44
613500 -- (-541.039) (-539.179) (-536.689) [-534.898] * (-535.941) (-538.714) (-537.921) [-539.249] -- 0:00:44
614000 -- (-544.382) (-539.935) (-538.281) [-534.398] * [-536.710] (-535.714) (-549.654) (-538.935) -- 0:00:44
614500 -- (-547.593) [-535.531] (-542.049) (-533.686) * [-538.295] (-534.421) (-541.486) (-539.582) -- 0:00:44
615000 -- (-537.112) (-540.204) [-540.219] (-547.137) * (-539.867) (-541.675) [-540.494] (-534.735) -- 0:00:44
Average standard deviation of split frequencies: 0.002296
615500 -- (-534.769) (-536.388) (-541.198) [-535.530] * (-535.210) [-540.815] (-534.526) (-534.864) -- 0:00:44
616000 -- [-533.142] (-538.560) (-538.207) (-539.219) * (-533.019) [-539.204] (-540.845) (-535.852) -- 0:00:44
616500 -- (-535.141) (-539.913) [-535.572] (-539.702) * (-538.009) (-538.899) (-538.400) [-537.829] -- 0:00:44
617000 -- [-536.698] (-534.532) (-539.388) (-537.273) * (-547.698) (-539.966) [-534.234] (-535.961) -- 0:00:44
617500 -- (-539.987) (-533.152) [-534.180] (-542.998) * (-538.801) (-537.753) [-542.047] (-540.929) -- 0:00:43
618000 -- (-533.984) (-538.827) [-535.629] (-536.511) * [-535.771] (-532.652) (-550.310) (-538.072) -- 0:00:43
618500 -- (-541.415) (-539.120) [-538.058] (-539.939) * (-537.359) (-535.485) [-543.738] (-538.637) -- 0:00:43
619000 -- [-535.078] (-540.384) (-537.523) (-535.330) * (-540.627) [-540.341] (-542.679) (-536.914) -- 0:00:43
619500 -- (-539.720) (-540.311) [-532.098] (-534.882) * (-542.287) [-531.880] (-543.984) (-537.997) -- 0:00:43
620000 -- (-545.242) (-540.053) (-534.621) [-533.741] * (-541.661) [-537.585] (-543.997) (-542.765) -- 0:00:43
Average standard deviation of split frequencies: 0.001899
620500 -- (-542.068) [-532.577] (-534.093) (-535.405) * (-545.293) [-533.291] (-544.034) (-539.075) -- 0:00:43
621000 -- [-537.210] (-543.139) (-540.134) (-535.406) * (-544.557) [-530.614] (-543.877) (-538.593) -- 0:00:43
621500 -- (-542.639) (-538.080) [-537.991] (-534.363) * (-546.874) (-532.392) (-545.166) [-536.285] -- 0:00:43
622000 -- (-537.385) [-536.096] (-546.537) (-536.575) * (-546.322) [-537.510] (-545.581) (-538.158) -- 0:00:43
622500 -- (-541.919) (-536.147) (-537.757) [-538.599] * (-539.041) [-533.927] (-541.709) (-540.620) -- 0:00:43
623000 -- [-536.305] (-536.306) (-539.779) (-540.293) * [-534.807] (-532.244) (-545.460) (-538.099) -- 0:00:43
623500 -- [-539.909] (-539.561) (-538.232) (-549.047) * (-540.443) [-540.261] (-544.518) (-547.402) -- 0:00:43
624000 -- (-539.928) [-536.707] (-537.784) (-535.797) * (-539.065) [-541.159] (-544.262) (-543.303) -- 0:00:43
624500 -- (-535.255) [-537.783] (-543.794) (-540.997) * (-539.361) (-535.118) (-543.992) [-535.807] -- 0:00:43
625000 -- (-533.133) (-537.360) [-539.960] (-537.846) * (-538.258) [-531.347] (-539.767) (-537.867) -- 0:00:43
Average standard deviation of split frequencies: 0.002259
625500 -- (-535.979) [-538.509] (-537.591) (-537.313) * (-534.248) (-539.589) (-546.411) [-536.640] -- 0:00:43
626000 -- (-538.831) (-538.242) (-546.548) [-536.923] * [-531.578] (-540.140) (-540.174) (-531.822) -- 0:00:43
626500 -- (-538.617) (-538.509) (-537.094) [-535.914] * (-535.366) [-540.005] (-536.953) (-531.414) -- 0:00:42
627000 -- [-541.739] (-542.284) (-538.062) (-539.568) * (-534.076) (-537.855) (-538.118) [-538.122] -- 0:00:42
627500 -- [-540.105] (-541.076) (-543.560) (-533.409) * (-548.664) (-540.020) (-540.180) [-537.086] -- 0:00:42
628000 -- (-542.115) [-542.923] (-539.706) (-533.090) * (-537.108) (-542.070) (-537.707) [-535.881] -- 0:00:42
628500 -- (-533.034) (-540.936) [-539.780] (-534.340) * (-534.730) [-536.835] (-536.608) (-534.497) -- 0:00:42
629000 -- (-533.904) (-542.453) (-541.910) [-534.812] * (-540.108) (-534.935) (-546.327) [-541.422] -- 0:00:42
629500 -- [-535.801] (-542.236) (-538.957) (-536.893) * [-537.444] (-544.371) (-537.336) (-544.269) -- 0:00:42
630000 -- (-539.145) (-534.209) [-539.694] (-536.531) * (-536.715) [-534.561] (-534.877) (-544.181) -- 0:00:42
Average standard deviation of split frequencies: 0.002990
630500 -- (-537.479) [-531.248] (-543.193) (-548.291) * (-534.938) (-536.330) (-536.279) [-540.774] -- 0:00:42
631000 -- [-538.558] (-537.670) (-539.004) (-540.222) * (-538.664) (-537.659) (-537.951) [-536.664] -- 0:00:42
631500 -- (-535.123) (-532.012) [-539.035] (-538.054) * (-538.783) (-538.939) (-533.381) [-534.640] -- 0:00:42
632000 -- (-537.298) (-537.203) (-536.956) [-537.529] * (-535.475) [-531.894] (-540.886) (-538.785) -- 0:00:42
632500 -- (-533.155) [-532.681] (-541.083) (-538.456) * (-535.409) (-537.716) [-540.781] (-536.321) -- 0:00:42
633000 -- [-538.131] (-537.975) (-538.037) (-537.273) * (-542.141) (-535.967) (-539.811) [-536.749] -- 0:00:42
633500 -- (-538.047) [-532.022] (-540.881) (-536.210) * [-533.927] (-540.076) (-534.452) (-535.495) -- 0:00:42
634000 -- [-537.458] (-539.018) (-537.750) (-547.668) * [-541.661] (-539.792) (-537.284) (-538.314) -- 0:00:42
634500 -- [-536.378] (-533.446) (-535.307) (-538.700) * (-543.483) (-544.917) (-540.576) [-534.911] -- 0:00:42
635000 -- (-539.286) [-532.739] (-540.953) (-540.639) * [-537.534] (-537.052) (-538.896) (-534.610) -- 0:00:41
Average standard deviation of split frequencies: 0.002965
635500 -- (-538.459) [-538.845] (-540.655) (-539.624) * (-536.371) (-535.745) (-536.259) [-533.935] -- 0:00:41
636000 -- [-533.797] (-535.458) (-538.231) (-545.631) * (-533.988) (-534.179) [-534.117] (-537.246) -- 0:00:41
636500 -- (-534.483) (-537.459) [-535.021] (-544.020) * [-540.398] (-538.383) (-536.948) (-541.953) -- 0:00:41
637000 -- (-545.124) [-540.442] (-536.893) (-547.694) * [-534.697] (-539.216) (-536.667) (-534.431) -- 0:00:41
637500 -- [-536.856] (-541.665) (-545.361) (-545.511) * (-538.580) (-532.913) (-536.196) [-532.606] -- 0:00:41
638000 -- (-538.486) (-548.974) (-537.945) [-538.345] * [-534.676] (-534.697) (-536.392) (-539.600) -- 0:00:41
638500 -- (-538.380) (-536.809) (-540.674) [-543.361] * (-533.786) [-535.839] (-539.214) (-538.476) -- 0:00:41
639000 -- (-540.709) (-546.813) [-537.697] (-543.631) * (-533.470) [-535.854] (-533.940) (-538.732) -- 0:00:41
639500 -- (-537.790) [-539.288] (-531.220) (-541.891) * [-537.207] (-536.455) (-535.137) (-534.608) -- 0:00:41
640000 -- (-535.904) (-539.231) [-535.041] (-542.574) * (-532.050) (-536.075) (-534.744) [-533.331] -- 0:00:41
Average standard deviation of split frequencies: 0.003311
640500 -- (-538.132) (-538.682) (-535.321) [-548.157] * (-537.889) (-533.425) [-532.645] (-539.469) -- 0:00:41
641000 -- (-536.752) [-538.304] (-539.795) (-542.000) * (-540.741) [-537.506] (-537.721) (-535.378) -- 0:00:41
641500 -- (-535.008) [-540.423] (-534.617) (-547.497) * [-533.798] (-538.000) (-535.721) (-543.100) -- 0:00:41
642000 -- (-535.843) (-543.787) (-538.879) [-540.832] * (-538.579) (-540.394) [-535.521] (-537.731) -- 0:00:41
642500 -- (-540.997) [-545.534] (-538.870) (-541.507) * (-539.014) (-541.045) (-540.653) [-536.293] -- 0:00:41
643000 -- (-541.207) [-539.241] (-531.206) (-545.797) * (-532.668) (-539.885) (-537.863) [-539.490] -- 0:00:41
643500 -- [-543.631] (-534.428) (-537.592) (-550.082) * [-534.631] (-536.624) (-534.867) (-544.277) -- 0:00:40
644000 -- (-541.196) [-538.512] (-540.666) (-540.005) * (-542.398) (-540.349) [-535.927] (-538.181) -- 0:00:40
644500 -- [-535.508] (-537.303) (-536.469) (-553.037) * (-531.568) (-541.628) (-535.298) [-538.313] -- 0:00:40
645000 -- [-537.662] (-538.208) (-539.293) (-543.023) * (-535.994) (-549.606) [-534.410] (-542.045) -- 0:00:40
Average standard deviation of split frequencies: 0.003284
645500 -- (-531.674) (-544.663) [-538.809] (-541.572) * [-537.979] (-546.622) (-532.318) (-549.143) -- 0:00:40
646000 -- (-539.290) [-537.416] (-532.322) (-536.864) * (-536.899) [-538.292] (-537.983) (-536.790) -- 0:00:40
646500 -- (-536.202) (-536.520) [-536.360] (-541.021) * (-539.604) (-541.874) (-534.145) [-539.186] -- 0:00:40
647000 -- (-539.756) [-538.585] (-543.512) (-542.901) * (-532.290) (-543.037) [-536.754] (-548.897) -- 0:00:40
647500 -- (-531.293) [-538.640] (-540.144) (-542.328) * (-537.279) (-541.605) (-537.449) [-535.218] -- 0:00:40
648000 -- (-535.788) [-539.621] (-542.133) (-544.155) * (-534.986) (-541.224) (-534.865) [-538.629] -- 0:00:40
648500 -- (-537.561) [-536.470] (-534.806) (-545.282) * (-537.009) (-540.781) [-532.322] (-538.773) -- 0:00:40
649000 -- [-538.595] (-537.892) (-545.036) (-542.033) * (-543.956) (-542.050) [-539.019] (-538.483) -- 0:00:40
649500 -- [-540.231] (-541.420) (-540.156) (-543.127) * (-532.991) (-544.302) [-542.873] (-536.817) -- 0:00:40
650000 -- (-543.720) [-539.117] (-535.681) (-543.161) * (-539.272) (-539.005) (-539.792) [-541.245] -- 0:00:40
Average standard deviation of split frequencies: 0.003622
650500 -- (-535.350) (-544.633) [-535.628] (-546.083) * (-537.791) [-545.291] (-542.515) (-539.083) -- 0:00:40
651000 -- [-538.010] (-537.562) (-539.429) (-544.639) * [-530.999] (-536.998) (-549.474) (-537.424) -- 0:00:40
651500 -- (-536.028) (-533.511) (-541.156) [-540.477] * (-537.485) [-540.562] (-538.130) (-539.100) -- 0:00:40
652000 -- (-540.368) (-538.005) (-531.024) [-538.630] * (-540.858) (-535.270) (-537.579) [-538.462] -- 0:00:40
652500 -- (-540.135) (-539.004) (-536.566) [-534.329] * (-534.321) (-542.452) [-534.194] (-545.102) -- 0:00:39
653000 -- (-539.779) (-539.789) (-537.137) [-532.841] * [-539.551] (-538.627) (-538.043) (-537.369) -- 0:00:39
653500 -- (-536.895) (-536.373) (-543.394) [-534.402] * (-537.813) (-547.085) [-536.128] (-535.075) -- 0:00:39
654000 -- (-539.141) [-536.074] (-544.118) (-534.115) * (-543.319) (-536.101) [-532.914] (-532.421) -- 0:00:39
654500 -- (-539.684) [-541.728] (-533.644) (-535.731) * (-537.112) (-539.418) [-531.519] (-532.099) -- 0:00:39
655000 -- (-543.571) [-537.864] (-542.943) (-532.520) * (-536.483) [-539.762] (-536.420) (-542.668) -- 0:00:39
Average standard deviation of split frequencies: 0.003952
655500 -- (-537.499) (-542.157) [-536.929] (-549.117) * (-539.164) [-538.585] (-537.957) (-539.433) -- 0:00:39
656000 -- (-539.951) (-538.000) (-536.400) [-538.879] * (-535.624) (-540.115) (-535.009) [-536.801] -- 0:00:39
656500 -- (-533.548) (-532.996) (-537.327) [-535.330] * (-537.602) (-541.484) [-537.625] (-538.352) -- 0:00:39
657000 -- (-539.506) (-533.734) [-539.704] (-537.097) * (-537.762) (-542.271) [-534.030] (-538.438) -- 0:00:39
657500 -- (-540.218) (-533.483) [-538.078] (-537.476) * (-539.172) [-544.242] (-533.997) (-543.456) -- 0:00:39
658000 -- (-543.469) (-541.630) (-543.692) [-536.971] * [-534.238] (-534.557) (-533.302) (-534.978) -- 0:00:39
658500 -- (-540.444) (-536.090) (-548.057) [-537.871] * (-533.477) (-541.447) [-532.746] (-537.901) -- 0:00:39
659000 -- (-539.990) [-538.643] (-542.339) (-537.501) * (-533.181) [-539.381] (-535.447) (-539.451) -- 0:00:39
659500 -- (-543.833) (-531.724) (-541.232) [-537.552] * (-539.957) (-543.619) [-530.713] (-537.807) -- 0:00:39
660000 -- [-540.150] (-543.968) (-536.965) (-549.901) * (-539.699) (-545.835) (-538.329) [-538.678] -- 0:00:39
Average standard deviation of split frequencies: 0.003924
660500 -- (-536.077) [-532.559] (-537.935) (-538.358) * (-540.814) (-539.405) (-532.975) [-535.049] -- 0:00:39
661000 -- [-537.394] (-534.711) (-540.191) (-540.429) * (-544.162) (-542.067) [-535.333] (-542.320) -- 0:00:38
661500 -- [-533.153] (-532.572) (-539.557) (-540.030) * (-544.284) [-539.198] (-543.602) (-553.997) -- 0:00:38
662000 -- [-533.871] (-539.701) (-540.224) (-542.180) * [-535.773] (-540.927) (-533.926) (-547.007) -- 0:00:38
662500 -- (-535.963) (-540.536) (-537.065) [-534.391] * (-536.572) (-546.739) [-535.349] (-537.654) -- 0:00:38
663000 -- (-534.549) (-537.108) [-535.325] (-540.170) * (-544.106) (-535.371) [-532.852] (-538.531) -- 0:00:38
663500 -- (-538.720) (-543.042) (-543.214) [-537.501] * (-536.964) [-543.905] (-538.297) (-544.001) -- 0:00:38
664000 -- (-539.506) (-534.576) (-541.051) [-538.484] * (-548.957) (-538.824) (-543.583) [-538.088] -- 0:00:38
664500 -- (-545.417) [-537.891] (-545.487) (-539.895) * (-544.960) (-542.459) (-537.315) [-534.216] -- 0:00:38
665000 -- (-542.193) [-533.551] (-542.990) (-535.237) * (-545.014) (-540.450) [-540.263] (-541.938) -- 0:00:38
Average standard deviation of split frequencies: 0.003893
665500 -- (-543.452) (-536.388) [-539.686] (-533.536) * (-541.349) (-541.220) (-534.403) [-540.925] -- 0:00:38
666000 -- (-536.914) [-535.511] (-534.822) (-549.166) * (-538.479) (-537.578) (-532.891) [-538.443] -- 0:00:38
666500 -- (-538.864) (-539.514) (-544.353) [-533.123] * (-535.290) (-534.001) (-536.838) [-534.610] -- 0:00:38
667000 -- (-538.279) [-534.960] (-545.379) (-539.639) * (-538.910) (-533.903) [-536.432] (-537.401) -- 0:00:38
667500 -- (-537.430) [-531.788] (-544.626) (-548.031) * (-535.756) (-538.765) (-540.497) [-535.002] -- 0:00:38
668000 -- (-539.360) (-536.443) [-540.147] (-535.088) * (-545.594) (-545.012) (-538.345) [-534.292] -- 0:00:38
668500 -- [-532.691] (-530.779) (-538.358) (-540.330) * (-538.709) [-542.105] (-542.573) (-534.772) -- 0:00:38
669000 -- (-539.494) [-535.573] (-536.325) (-545.004) * (-538.778) [-538.720] (-538.801) (-537.192) -- 0:00:38
669500 -- (-535.602) (-540.471) (-536.792) [-541.810] * (-539.753) (-540.012) [-542.510] (-537.493) -- 0:00:38
670000 -- [-535.319] (-539.013) (-542.983) (-547.489) * (-537.431) (-543.465) [-541.110] (-538.771) -- 0:00:37
Average standard deviation of split frequencies: 0.003866
670500 -- [-535.467] (-532.612) (-538.657) (-540.493) * (-544.111) [-533.649] (-546.428) (-539.276) -- 0:00:37
671000 -- [-531.029] (-533.841) (-541.039) (-537.875) * (-541.691) [-535.482] (-540.514) (-540.572) -- 0:00:37
671500 -- (-536.678) [-536.643] (-540.516) (-537.490) * (-541.244) [-538.458] (-540.466) (-535.101) -- 0:00:37
672000 -- (-540.760) (-537.593) [-538.408] (-541.878) * [-536.473] (-540.696) (-540.182) (-535.223) -- 0:00:37
672500 -- [-537.597] (-534.133) (-542.031) (-540.114) * (-536.234) (-537.644) (-544.115) [-536.707] -- 0:00:37
673000 -- (-541.671) [-535.145] (-543.285) (-540.369) * (-544.149) (-534.103) [-541.969] (-541.548) -- 0:00:37
673500 -- (-533.971) [-544.465] (-542.285) (-541.535) * (-543.349) [-535.281] (-537.564) (-540.106) -- 0:00:37
674000 -- (-541.162) (-538.168) [-540.322] (-542.105) * [-541.652] (-538.808) (-541.777) (-537.064) -- 0:00:37
674500 -- (-540.484) [-535.894] (-541.340) (-537.697) * (-552.319) [-537.366] (-546.080) (-537.301) -- 0:00:37
675000 -- [-545.496] (-534.084) (-546.646) (-541.179) * (-533.327) [-532.943] (-547.457) (-536.757) -- 0:00:37
Average standard deviation of split frequencies: 0.004184
675500 -- (-545.432) [-538.498] (-539.818) (-549.566) * (-533.739) (-535.884) [-541.814] (-538.625) -- 0:00:37
676000 -- (-535.403) [-534.137] (-539.995) (-538.846) * (-536.601) [-537.722] (-535.865) (-542.723) -- 0:00:37
676500 -- (-537.223) (-535.072) (-537.698) [-535.478] * (-535.273) (-533.140) [-538.656] (-539.827) -- 0:00:37
677000 -- [-536.367] (-536.849) (-542.458) (-536.183) * (-538.188) [-531.183] (-533.385) (-545.770) -- 0:00:37
677500 -- (-537.834) (-541.932) [-538.262] (-543.913) * [-532.721] (-531.116) (-536.221) (-541.771) -- 0:00:37
678000 -- [-534.232] (-538.487) (-542.648) (-549.891) * (-539.089) (-535.987) (-537.087) [-544.779] -- 0:00:37
678500 -- (-539.539) [-534.412] (-541.105) (-535.868) * (-539.245) [-533.265] (-541.677) (-549.011) -- 0:00:36
679000 -- (-539.908) (-535.232) (-543.905) [-537.594] * (-532.712) (-537.044) [-533.232] (-544.203) -- 0:00:36
679500 -- (-534.481) [-539.477] (-540.949) (-546.092) * [-535.736] (-533.823) (-533.314) (-542.926) -- 0:00:36
680000 -- (-542.077) (-536.526) (-537.922) [-536.025] * (-540.492) (-536.783) (-539.941) [-538.861] -- 0:00:36
Average standard deviation of split frequencies: 0.005887
680500 -- [-533.074] (-541.483) (-540.136) (-536.657) * (-539.825) (-534.898) [-539.159] (-538.096) -- 0:00:36
681000 -- (-538.040) (-538.872) [-538.201] (-541.437) * [-536.791] (-537.297) (-544.139) (-535.205) -- 0:00:36
681500 -- (-534.208) (-532.550) [-535.121] (-535.407) * (-537.756) (-537.133) [-536.917] (-531.520) -- 0:00:36
682000 -- (-534.557) (-533.234) [-534.828] (-531.489) * [-531.374] (-531.400) (-543.811) (-531.010) -- 0:00:36
682500 -- (-544.203) (-539.070) (-537.403) [-534.285] * (-539.141) [-536.773] (-537.311) (-536.074) -- 0:00:36
683000 -- (-535.460) (-535.109) [-539.954] (-532.348) * [-535.342] (-536.835) (-541.633) (-540.001) -- 0:00:36
683500 -- (-539.306) (-535.749) [-539.109] (-536.213) * [-536.888] (-541.083) (-542.530) (-535.109) -- 0:00:36
684000 -- (-535.724) [-537.480] (-542.909) (-543.922) * (-533.978) (-539.332) (-547.178) [-538.779] -- 0:00:36
684500 -- (-533.999) [-535.922] (-547.195) (-536.527) * (-532.758) (-532.120) [-538.678] (-538.149) -- 0:00:36
685000 -- (-541.086) (-539.566) [-541.486] (-542.459) * [-532.662] (-541.976) (-544.104) (-535.793) -- 0:00:36
Average standard deviation of split frequencies: 0.006528
685500 -- (-536.491) (-539.482) [-541.656] (-542.919) * [-535.812] (-540.264) (-540.280) (-531.627) -- 0:00:36
686000 -- (-536.287) (-538.855) (-538.795) [-536.067] * (-539.177) (-542.087) (-539.755) [-535.214] -- 0:00:36
686500 -- (-537.716) (-537.891) [-539.754] (-539.917) * (-537.225) (-538.362) [-540.322] (-544.823) -- 0:00:36
687000 -- (-538.066) (-540.356) [-542.116] (-539.177) * (-536.616) (-538.154) (-544.376) [-540.758] -- 0:00:35
687500 -- (-539.862) (-544.965) (-535.668) [-539.249] * (-546.889) (-533.257) (-545.125) [-535.925] -- 0:00:35
688000 -- [-544.742] (-539.372) (-535.400) (-542.679) * (-534.136) (-533.941) (-544.330) [-537.741] -- 0:00:35
688500 -- (-536.139) (-544.217) [-538.959] (-542.057) * (-540.191) [-538.597] (-546.816) (-540.204) -- 0:00:35
689000 -- (-538.468) [-535.223] (-534.775) (-543.322) * (-536.547) [-538.371] (-546.859) (-534.997) -- 0:00:35
689500 -- [-535.926] (-537.251) (-536.164) (-537.812) * [-537.747] (-541.656) (-543.721) (-539.257) -- 0:00:35
690000 -- (-543.378) [-539.868] (-543.549) (-543.093) * (-541.493) (-543.621) [-536.531] (-532.963) -- 0:00:35
Average standard deviation of split frequencies: 0.006143
690500 -- (-549.028) [-535.814] (-536.981) (-546.345) * (-540.317) (-536.657) [-540.742] (-537.964) -- 0:00:35
691000 -- (-544.624) [-533.798] (-539.111) (-539.269) * (-537.893) (-540.580) (-542.489) [-536.861] -- 0:00:35
691500 -- (-540.640) [-543.273] (-533.246) (-536.436) * (-547.872) (-542.571) (-541.292) [-539.180] -- 0:00:35
692000 -- (-549.991) (-536.051) [-536.581] (-538.656) * [-545.499] (-542.182) (-535.291) (-533.741) -- 0:00:35
692500 -- (-538.296) (-540.485) (-536.051) [-539.996] * [-534.763] (-538.899) (-543.383) (-536.096) -- 0:00:35
693000 -- (-536.919) (-542.804) [-539.737] (-532.274) * (-536.831) (-535.347) (-539.347) [-533.966] -- 0:00:35
693500 -- (-537.878) [-538.075] (-538.344) (-540.207) * (-538.006) [-534.742] (-544.094) (-540.503) -- 0:00:35
694000 -- (-536.081) [-540.122] (-535.383) (-531.536) * (-532.770) (-535.464) [-542.190] (-538.340) -- 0:00:35
694500 -- (-531.129) [-535.626] (-533.427) (-542.782) * [-543.714] (-537.888) (-542.075) (-536.004) -- 0:00:35
695000 -- (-539.482) [-538.165] (-543.882) (-535.161) * (-543.548) (-531.321) (-546.993) [-535.261] -- 0:00:35
Average standard deviation of split frequencies: 0.006096
695500 -- (-542.404) [-541.004] (-539.959) (-541.137) * [-536.248] (-532.930) (-533.932) (-540.170) -- 0:00:35
696000 -- [-537.287] (-541.373) (-540.601) (-541.805) * (-539.357) [-540.454] (-540.721) (-534.999) -- 0:00:34
696500 -- (-533.464) [-539.240] (-534.226) (-543.544) * [-534.169] (-533.401) (-543.603) (-537.373) -- 0:00:34
697000 -- (-537.951) (-535.416) (-538.895) [-537.954] * (-534.803) (-538.421) (-535.425) [-531.534] -- 0:00:34
697500 -- (-543.910) [-540.774] (-538.799) (-545.945) * (-536.987) (-534.960) (-532.036) [-540.192] -- 0:00:34
698000 -- [-539.314] (-535.626) (-536.993) (-544.660) * (-542.501) (-535.106) [-539.193] (-534.242) -- 0:00:34
698500 -- (-539.790) (-539.277) (-536.177) [-538.714] * (-534.977) (-538.532) [-538.870] (-539.863) -- 0:00:34
699000 -- (-539.706) (-540.127) (-535.295) [-539.313] * [-534.669] (-538.009) (-545.706) (-541.370) -- 0:00:34
699500 -- (-537.449) [-533.086] (-538.382) (-537.807) * (-537.754) (-542.886) [-534.727] (-538.334) -- 0:00:34
700000 -- [-534.594] (-538.646) (-535.242) (-537.907) * [-536.694] (-542.057) (-539.190) (-537.776) -- 0:00:34
Average standard deviation of split frequencies: 0.006055
700500 -- [-534.075] (-539.318) (-534.768) (-540.792) * (-546.625) [-534.192] (-535.921) (-538.364) -- 0:00:34
701000 -- [-534.095] (-535.204) (-541.101) (-542.575) * (-537.916) [-533.961] (-541.914) (-538.436) -- 0:00:34
701500 -- (-535.229) (-532.144) [-537.545] (-534.560) * (-535.832) (-534.307) (-532.834) [-535.719] -- 0:00:34
702000 -- (-544.970) [-534.155] (-543.790) (-533.576) * (-541.398) [-533.147] (-533.891) (-540.178) -- 0:00:34
702500 -- (-543.337) (-532.698) (-545.965) [-537.960] * (-541.006) (-536.567) (-536.083) [-536.976] -- 0:00:34
703000 -- (-540.055) (-537.013) [-541.623] (-540.803) * (-539.642) (-539.838) (-533.592) [-538.146] -- 0:00:34
703500 -- (-534.600) [-536.019] (-549.602) (-537.826) * [-534.770] (-537.400) (-535.142) (-539.970) -- 0:00:34
704000 -- (-533.899) (-536.088) (-541.048) [-546.948] * [-536.598] (-541.557) (-538.514) (-535.970) -- 0:00:34
704500 -- (-532.764) (-539.425) (-540.753) [-545.834] * (-543.763) (-536.624) (-531.738) [-539.205] -- 0:00:33
705000 -- (-541.339) [-537.378] (-535.507) (-535.297) * [-535.076] (-540.112) (-541.781) (-543.293) -- 0:00:33
Average standard deviation of split frequencies: 0.006343
705500 -- (-538.745) [-538.088] (-530.040) (-546.386) * (-536.655) (-542.005) (-536.180) [-536.379] -- 0:00:33
706000 -- [-534.102] (-539.040) (-534.669) (-545.225) * (-537.194) (-541.331) [-533.265] (-538.494) -- 0:00:33
706500 -- (-533.295) (-541.348) (-536.652) [-543.227] * (-540.711) (-540.080) [-539.777] (-541.274) -- 0:00:33
707000 -- (-538.788) [-532.344] (-546.166) (-544.029) * [-534.253] (-540.322) (-540.724) (-537.407) -- 0:00:33
707500 -- (-540.100) [-538.408] (-535.556) (-534.737) * (-539.022) (-536.915) [-540.370] (-540.146) -- 0:00:33
708000 -- (-539.549) (-544.242) (-537.105) [-539.043] * (-535.824) (-548.544) [-534.607] (-543.466) -- 0:00:33
708500 -- (-532.124) [-539.151] (-536.738) (-536.981) * (-537.542) (-536.202) [-540.440] (-534.679) -- 0:00:33
709000 -- (-548.983) [-533.900] (-535.352) (-540.629) * (-538.415) (-542.684) [-536.345] (-534.929) -- 0:00:33
709500 -- [-537.362] (-530.792) (-535.121) (-534.764) * [-534.018] (-541.579) (-538.829) (-540.524) -- 0:00:33
710000 -- (-535.733) (-534.832) [-538.502] (-536.741) * (-533.576) [-538.633] (-546.159) (-537.406) -- 0:00:33
Average standard deviation of split frequencies: 0.006302
710500 -- (-536.524) (-536.041) (-539.629) [-539.089] * (-537.024) (-536.363) [-539.129] (-534.105) -- 0:00:33
711000 -- (-538.298) (-544.874) (-531.608) [-534.962] * (-538.586) (-533.254) [-537.524] (-548.332) -- 0:00:33
711500 -- (-538.871) [-530.875] (-542.720) (-544.555) * (-537.122) (-537.350) [-542.471] (-541.873) -- 0:00:33
712000 -- [-533.720] (-535.601) (-538.601) (-544.135) * [-538.517] (-534.619) (-547.799) (-536.212) -- 0:00:33
712500 -- [-539.153] (-538.931) (-538.196) (-540.280) * (-534.315) [-537.575] (-542.899) (-536.099) -- 0:00:33
713000 -- [-542.616] (-538.004) (-539.261) (-540.688) * (-544.602) (-534.483) [-541.819] (-536.345) -- 0:00:33
713500 -- [-541.616] (-541.927) (-539.998) (-538.344) * [-533.677] (-532.287) (-538.020) (-532.858) -- 0:00:32
714000 -- (-538.063) (-540.220) [-535.151] (-546.347) * [-536.969] (-535.010) (-539.798) (-532.260) -- 0:00:32
714500 -- [-537.650] (-537.250) (-537.650) (-537.422) * (-540.984) (-540.724) (-544.217) [-535.608] -- 0:00:32
715000 -- (-536.415) (-542.408) (-536.082) [-542.253] * (-535.890) (-540.541) [-541.963] (-534.988) -- 0:00:32
Average standard deviation of split frequencies: 0.006255
715500 -- (-544.109) (-536.681) [-540.722] (-538.107) * (-537.131) (-532.198) [-537.244] (-539.180) -- 0:00:32
716000 -- (-546.156) (-534.119) [-535.086] (-543.145) * (-542.665) (-532.694) [-542.378] (-536.780) -- 0:00:32
716500 -- (-539.393) [-534.144] (-537.084) (-536.628) * [-537.221] (-533.522) (-546.686) (-544.675) -- 0:00:32
717000 -- (-532.810) (-541.275) [-535.484] (-536.074) * (-542.812) (-534.610) [-540.307] (-538.909) -- 0:00:32
717500 -- (-537.673) (-537.653) [-534.938] (-538.274) * (-535.448) [-541.887] (-534.391) (-536.379) -- 0:00:32
718000 -- (-542.102) (-541.809) [-536.017] (-541.984) * [-530.967] (-532.701) (-536.469) (-538.711) -- 0:00:32
718500 -- (-538.776) (-538.805) [-541.205] (-535.491) * (-539.610) (-537.102) [-536.985] (-537.359) -- 0:00:32
719000 -- (-540.457) [-541.920] (-536.142) (-540.214) * [-532.827] (-534.344) (-536.833) (-540.740) -- 0:00:32
719500 -- (-537.376) [-540.982] (-533.424) (-539.408) * (-535.639) [-533.862] (-534.421) (-540.716) -- 0:00:32
720000 -- (-538.655) (-540.979) [-534.445] (-539.156) * (-540.022) (-538.204) [-535.265] (-536.296) -- 0:00:32
Average standard deviation of split frequencies: 0.005887
720500 -- (-539.349) (-534.913) (-543.025) [-536.015] * (-537.272) (-535.042) [-535.537] (-535.546) -- 0:00:32
721000 -- (-534.913) (-539.424) [-536.649] (-546.814) * (-537.645) (-544.029) [-530.926] (-534.115) -- 0:00:32
721500 -- (-535.530) (-539.480) [-537.073] (-539.237) * (-531.525) (-541.921) [-534.149] (-536.462) -- 0:00:32
722000 -- [-532.984] (-544.954) (-549.651) (-538.114) * (-538.604) (-534.491) (-534.629) [-538.335] -- 0:00:31
722500 -- (-539.439) (-545.423) (-539.198) [-532.311] * [-540.802] (-540.196) (-538.433) (-533.207) -- 0:00:31
723000 -- [-536.419] (-543.564) (-539.735) (-536.124) * (-540.060) [-542.963] (-542.493) (-535.339) -- 0:00:31
723500 -- (-537.396) [-540.800] (-535.088) (-535.127) * (-536.909) (-546.288) (-538.502) [-542.959] -- 0:00:31
724000 -- (-542.607) (-544.429) (-536.165) [-531.655] * (-538.827) (-538.349) [-534.259] (-539.286) -- 0:00:31
724500 -- [-549.147] (-544.797) (-531.635) (-534.406) * (-541.675) [-536.556] (-541.886) (-533.762) -- 0:00:31
725000 -- (-537.480) (-548.183) [-538.954] (-534.655) * (-539.984) [-537.720] (-537.164) (-536.843) -- 0:00:31
Average standard deviation of split frequencies: 0.005844
725500 -- (-549.756) (-541.731) [-534.488] (-535.983) * (-532.872) (-538.047) [-535.373] (-539.691) -- 0:00:31
726000 -- [-534.161] (-540.725) (-540.220) (-538.446) * [-532.284] (-546.986) (-536.140) (-540.702) -- 0:00:31
726500 -- [-537.999] (-536.444) (-540.164) (-545.133) * (-534.949) (-542.607) [-539.679] (-544.964) -- 0:00:31
727000 -- (-538.678) (-539.793) [-533.820] (-543.289) * (-534.529) [-539.096] (-543.649) (-539.496) -- 0:00:31
727500 -- (-540.602) [-538.560] (-535.500) (-535.599) * [-535.972] (-536.742) (-543.919) (-540.026) -- 0:00:31
728000 -- (-540.466) [-537.991] (-541.044) (-543.274) * [-538.568] (-537.195) (-537.552) (-539.594) -- 0:00:31
728500 -- (-546.561) (-540.312) (-541.029) [-539.948] * [-532.217] (-535.747) (-540.755) (-539.455) -- 0:00:31
729000 -- (-534.824) (-539.192) (-533.385) [-535.460] * [-541.004] (-536.828) (-538.581) (-539.445) -- 0:00:31
729500 -- (-545.386) (-534.413) [-534.294] (-532.999) * [-532.851] (-538.777) (-538.724) (-540.153) -- 0:00:31
730000 -- [-538.700] (-539.901) (-537.764) (-536.201) * [-535.491] (-533.008) (-539.594) (-537.444) -- 0:00:31
Average standard deviation of split frequencies: 0.005807
730500 -- (-539.949) (-543.480) [-539.288] (-536.711) * (-542.663) (-535.664) (-545.906) [-541.016] -- 0:00:30
731000 -- (-535.234) [-539.503] (-535.760) (-535.773) * (-544.457) [-532.921] (-547.161) (-541.833) -- 0:00:30
731500 -- [-532.901] (-531.079) (-542.676) (-539.992) * (-540.966) (-536.441) (-535.675) [-536.903] -- 0:00:30
732000 -- (-537.803) (-537.741) (-536.534) [-533.597] * (-540.504) [-534.901] (-543.969) (-539.406) -- 0:00:30
732500 -- [-536.227] (-533.846) (-537.957) (-538.303) * (-532.404) [-539.611] (-534.410) (-542.373) -- 0:00:30
733000 -- [-538.963] (-538.086) (-541.019) (-542.421) * (-534.210) [-533.107] (-546.421) (-539.501) -- 0:00:30
733500 -- (-531.837) [-535.491] (-536.719) (-540.507) * [-533.583] (-534.660) (-547.705) (-537.338) -- 0:00:30
734000 -- (-533.126) [-536.942] (-536.455) (-530.866) * (-533.262) [-530.218] (-554.105) (-535.291) -- 0:00:30
734500 -- (-539.185) (-535.410) (-538.088) [-533.516] * [-533.538] (-536.197) (-533.452) (-538.011) -- 0:00:30
735000 -- [-533.542] (-534.201) (-536.850) (-536.655) * (-535.328) (-535.653) (-536.338) [-534.214] -- 0:00:30
Average standard deviation of split frequencies: 0.005764
735500 -- (-535.172) (-539.043) (-534.310) [-540.688] * (-542.486) [-532.487] (-536.262) (-539.462) -- 0:00:30
736000 -- (-540.002) [-534.074] (-540.699) (-538.697) * (-537.725) (-541.002) [-535.878] (-550.691) -- 0:00:30
736500 -- (-533.605) [-535.016] (-541.863) (-535.278) * (-541.498) [-536.482] (-538.958) (-539.648) -- 0:00:30
737000 -- (-535.248) [-533.121] (-538.739) (-536.748) * [-540.165] (-537.238) (-537.529) (-543.627) -- 0:00:30
737500 -- (-545.063) (-536.092) (-535.549) [-534.802] * (-533.237) (-534.596) [-537.022] (-538.620) -- 0:00:30
738000 -- [-532.790] (-536.050) (-535.367) (-534.146) * [-533.429] (-538.790) (-537.827) (-534.842) -- 0:00:30
738500 -- [-536.128] (-533.528) (-532.523) (-536.808) * (-536.819) (-535.659) (-544.942) [-535.446] -- 0:00:30
739000 -- [-539.334] (-539.496) (-533.114) (-534.311) * (-544.155) [-534.890] (-535.700) (-536.971) -- 0:00:30
739500 -- (-537.208) (-535.626) (-538.835) [-540.501] * [-534.489] (-531.389) (-542.658) (-537.191) -- 0:00:29
740000 -- (-537.228) (-542.346) [-532.196] (-535.115) * (-535.042) [-531.978] (-543.860) (-539.060) -- 0:00:29
Average standard deviation of split frequencies: 0.005728
740500 -- (-540.828) (-537.160) [-537.460] (-538.341) * (-534.475) (-537.364) [-537.700] (-536.480) -- 0:00:29
741000 -- (-536.985) (-542.422) (-539.855) [-545.202] * (-541.841) (-538.266) [-539.497] (-536.118) -- 0:00:29
741500 -- (-541.484) (-533.325) (-534.489) [-536.175] * [-541.006] (-539.193) (-538.451) (-541.409) -- 0:00:29
742000 -- (-539.225) (-535.032) [-541.136] (-536.739) * (-543.823) [-539.240] (-534.467) (-533.577) -- 0:00:29
742500 -- [-534.654] (-537.675) (-543.399) (-541.385) * (-535.530) (-531.705) [-531.093] (-536.318) -- 0:00:29
743000 -- (-536.085) (-540.930) [-536.971] (-538.150) * (-541.247) (-538.841) [-530.567] (-532.835) -- 0:00:29
743500 -- (-537.582) (-534.786) [-539.965] (-541.011) * (-541.222) [-533.563] (-537.248) (-534.164) -- 0:00:29
744000 -- (-543.026) (-543.825) [-538.114] (-542.889) * (-543.640) (-538.093) [-539.203] (-541.622) -- 0:00:29
744500 -- (-537.299) (-539.053) [-533.941] (-539.593) * (-537.815) [-533.906] (-536.187) (-541.391) -- 0:00:29
745000 -- (-539.457) (-533.565) (-537.067) [-539.517] * [-539.679] (-535.304) (-534.890) (-540.152) -- 0:00:29
Average standard deviation of split frequencies: 0.005371
745500 -- (-540.144) [-536.910] (-536.589) (-540.922) * [-535.967] (-536.642) (-538.458) (-537.091) -- 0:00:29
746000 -- (-542.998) (-538.507) [-536.321] (-537.207) * [-539.837] (-544.426) (-535.115) (-534.869) -- 0:00:29
746500 -- (-542.854) (-535.926) (-536.179) [-539.309] * [-534.474] (-534.227) (-538.938) (-535.591) -- 0:00:29
747000 -- (-540.539) [-535.867] (-535.009) (-538.023) * (-536.104) (-535.015) (-545.209) [-533.900] -- 0:00:29
747500 -- (-547.683) [-535.062] (-547.718) (-538.041) * (-539.819) [-539.669] (-544.610) (-538.613) -- 0:00:29
748000 -- (-542.217) (-535.765) (-542.831) [-535.908] * (-537.705) [-536.931] (-542.000) (-537.038) -- 0:00:28
748500 -- [-536.494] (-542.316) (-539.738) (-536.729) * (-543.508) (-539.524) [-537.974] (-537.290) -- 0:00:28
749000 -- (-537.072) (-538.823) (-540.419) [-539.094] * (-542.241) [-533.107] (-539.232) (-538.343) -- 0:00:28
749500 -- (-535.331) (-546.222) (-539.728) [-534.614] * [-535.522] (-533.801) (-544.628) (-537.979) -- 0:00:28
750000 -- (-538.543) [-537.807] (-543.510) (-538.332) * (-543.419) [-536.794] (-538.790) (-537.059) -- 0:00:28
Average standard deviation of split frequencies: 0.005338
750500 -- (-534.773) [-537.236] (-539.616) (-542.431) * [-536.427] (-534.356) (-543.760) (-539.860) -- 0:00:28
751000 -- (-535.601) [-537.232] (-541.695) (-541.668) * (-539.166) [-539.000] (-538.778) (-538.762) -- 0:00:28
751500 -- (-538.563) (-541.031) [-541.293] (-535.233) * (-543.198) (-544.869) [-538.783] (-538.196) -- 0:00:28
752000 -- (-544.457) (-535.531) [-542.665] (-538.691) * (-542.751) (-549.056) [-533.961] (-538.491) -- 0:00:28
752500 -- [-539.426] (-530.740) (-538.597) (-539.433) * [-535.218] (-538.499) (-540.308) (-539.361) -- 0:00:28
753000 -- (-541.058) (-533.860) (-539.905) [-537.747] * [-538.722] (-539.554) (-531.663) (-541.383) -- 0:00:28
753500 -- (-538.682) [-534.044] (-542.003) (-535.528) * (-537.072) (-533.616) [-532.837] (-545.120) -- 0:00:28
754000 -- (-545.459) [-536.805] (-540.284) (-540.442) * (-539.892) (-534.592) [-535.764] (-539.826) -- 0:00:28
754500 -- (-542.347) (-532.613) [-535.508] (-541.278) * [-533.770] (-541.491) (-536.562) (-535.621) -- 0:00:28
755000 -- (-536.892) (-535.409) [-533.310] (-535.792) * [-536.401] (-542.116) (-538.198) (-538.719) -- 0:00:28
Average standard deviation of split frequencies: 0.005300
755500 -- (-544.634) [-535.514] (-538.695) (-542.043) * (-531.954) (-535.326) (-538.825) [-531.552] -- 0:00:28
756000 -- (-542.300) (-539.341) (-536.762) [-539.637] * (-534.039) [-530.476] (-546.198) (-536.752) -- 0:00:28
756500 -- (-538.082) [-535.878] (-544.080) (-536.307) * (-533.613) (-537.215) [-545.182] (-539.346) -- 0:00:28
757000 -- (-540.332) (-535.662) [-544.472] (-533.577) * (-545.588) [-535.797] (-542.283) (-534.856) -- 0:00:27
757500 -- (-545.097) [-535.269] (-538.382) (-533.710) * (-534.059) (-543.031) (-546.028) [-533.671] -- 0:00:27
758000 -- (-538.972) [-541.874] (-540.676) (-535.760) * [-534.072] (-540.018) (-547.520) (-539.917) -- 0:00:27
758500 -- (-540.762) (-535.087) (-544.626) [-532.915] * [-534.161] (-540.873) (-541.793) (-547.479) -- 0:00:27
759000 -- (-538.982) (-537.180) (-551.688) [-534.206] * [-538.636] (-535.635) (-537.824) (-534.970) -- 0:00:27
759500 -- (-537.036) [-542.488] (-537.866) (-541.275) * [-534.887] (-549.037) (-541.744) (-541.473) -- 0:00:27
760000 -- (-534.023) (-533.137) [-536.564] (-545.358) * (-535.725) [-539.463] (-545.701) (-538.111) -- 0:00:27
Average standard deviation of split frequencies: 0.004958
760500 -- [-534.053] (-537.714) (-541.613) (-539.568) * (-531.401) (-535.991) [-544.910] (-544.511) -- 0:00:27
761000 -- (-536.918) [-535.013] (-538.851) (-537.959) * [-537.805] (-533.460) (-547.786) (-538.552) -- 0:00:27
761500 -- [-532.197] (-538.540) (-541.560) (-546.429) * (-535.762) [-542.290] (-536.449) (-548.209) -- 0:00:27
762000 -- (-533.840) [-534.955] (-542.650) (-539.008) * (-543.478) [-537.573] (-538.080) (-533.962) -- 0:00:27
762500 -- (-544.885) (-539.211) [-541.753] (-534.680) * (-541.451) (-532.554) (-538.924) [-537.033] -- 0:00:27
763000 -- (-538.983) (-539.482) [-537.331] (-540.414) * [-539.456] (-542.157) (-541.364) (-538.428) -- 0:00:27
763500 -- (-537.517) (-540.402) (-540.514) [-537.985] * [-531.490] (-533.596) (-544.270) (-543.166) -- 0:00:27
764000 -- (-532.967) (-539.031) [-537.865] (-533.707) * (-540.209) [-543.210] (-553.580) (-538.562) -- 0:00:27
764500 -- (-534.581) (-538.093) (-538.111) [-534.124] * (-537.363) [-543.252] (-541.599) (-539.851) -- 0:00:27
765000 -- (-534.356) [-538.949] (-545.519) (-533.909) * (-538.262) [-538.585] (-544.681) (-542.258) -- 0:00:27
Average standard deviation of split frequencies: 0.004923
765500 -- (-541.337) (-545.079) (-540.393) [-535.135] * (-536.889) (-535.953) [-533.905] (-538.004) -- 0:00:26
766000 -- (-531.679) (-534.065) (-539.925) [-534.871] * [-537.233] (-540.045) (-544.576) (-533.929) -- 0:00:26
766500 -- [-530.403] (-537.771) (-534.329) (-541.812) * [-533.423] (-537.916) (-543.120) (-542.454) -- 0:00:26
767000 -- (-537.214) [-537.509] (-534.661) (-541.400) * [-536.164] (-537.218) (-543.240) (-534.453) -- 0:00:26
767500 -- [-533.275] (-537.046) (-547.965) (-539.633) * [-536.547] (-535.729) (-544.078) (-535.572) -- 0:00:26
768000 -- (-533.970) (-539.692) (-538.546) [-543.927] * (-534.490) (-535.713) (-540.360) [-534.005] -- 0:00:26
768500 -- [-532.386] (-543.662) (-539.794) (-535.486) * (-548.478) (-541.294) (-545.558) [-535.908] -- 0:00:26
769000 -- [-539.191] (-539.833) (-537.429) (-536.120) * [-533.821] (-540.693) (-545.665) (-542.698) -- 0:00:26
769500 -- (-533.963) (-537.308) (-540.688) [-538.050] * (-538.369) (-540.201) (-539.395) [-535.901] -- 0:00:26
770000 -- [-537.991] (-538.066) (-536.859) (-540.759) * (-540.749) (-540.342) [-537.144] (-535.744) -- 0:00:26
Average standard deviation of split frequencies: 0.004893
770500 -- [-535.564] (-532.378) (-544.566) (-536.510) * (-538.297) (-538.219) (-534.181) [-535.144] -- 0:00:26
771000 -- (-532.789) [-534.135] (-539.747) (-548.805) * [-542.911] (-540.183) (-540.132) (-534.276) -- 0:00:26
771500 -- (-536.581) [-538.583] (-539.819) (-537.450) * (-539.821) (-545.850) (-541.024) [-533.758] -- 0:00:26
772000 -- (-533.825) [-541.647] (-538.757) (-537.912) * (-541.774) (-540.770) [-543.901] (-536.153) -- 0:00:26
772500 -- (-534.300) [-536.170] (-539.163) (-535.780) * (-540.229) [-537.950] (-547.273) (-536.382) -- 0:00:26
773000 -- [-536.012] (-542.984) (-544.908) (-536.471) * (-540.294) (-541.756) (-542.125) [-532.775] -- 0:00:26
773500 -- (-535.345) (-537.089) [-536.811] (-538.899) * (-537.029) (-544.880) (-539.316) [-537.018] -- 0:00:26
774000 -- (-544.199) [-537.412] (-539.171) (-540.782) * (-542.115) (-541.505) (-540.197) [-540.087] -- 0:00:25
774500 -- (-541.217) (-543.162) (-536.121) [-531.792] * [-531.415] (-549.961) (-543.550) (-540.580) -- 0:00:25
775000 -- (-540.371) (-537.709) [-535.552] (-535.883) * (-538.833) (-532.950) (-537.827) [-535.694] -- 0:00:25
Average standard deviation of split frequencies: 0.005467
775500 -- (-542.189) [-539.935] (-537.760) (-536.708) * (-542.249) (-546.325) (-547.525) [-541.430] -- 0:00:25
776000 -- (-541.556) [-533.474] (-535.895) (-533.859) * [-534.884] (-547.091) (-542.011) (-541.849) -- 0:00:25
776500 -- (-536.279) (-540.604) [-536.543] (-540.452) * (-536.792) (-536.466) (-538.709) [-540.698] -- 0:00:25
777000 -- (-537.264) [-538.097] (-530.606) (-544.453) * [-537.253] (-538.138) (-538.597) (-540.219) -- 0:00:25
777500 -- [-534.088] (-542.516) (-538.671) (-543.775) * [-534.567] (-537.251) (-548.521) (-544.224) -- 0:00:25
778000 -- (-542.175) (-535.272) (-535.277) [-535.330] * (-536.139) [-537.563] (-541.461) (-549.940) -- 0:00:25
778500 -- (-546.528) (-535.809) (-535.845) [-539.511] * [-535.768] (-535.662) (-547.646) (-537.389) -- 0:00:25
779000 -- (-538.431) (-543.017) (-535.594) [-535.046] * (-536.787) [-538.392] (-538.135) (-542.450) -- 0:00:25
779500 -- (-540.726) [-536.989] (-532.206) (-540.753) * (-535.653) (-540.810) (-536.992) [-539.889] -- 0:00:25
780000 -- (-534.161) (-534.443) (-539.746) [-531.933] * (-538.161) (-539.137) [-539.951] (-539.335) -- 0:00:25
Average standard deviation of split frequencies: 0.005737
780500 -- [-543.063] (-540.137) (-545.746) (-537.291) * (-541.274) (-535.543) (-539.686) [-539.789] -- 0:00:25
781000 -- (-549.072) [-540.377] (-535.020) (-537.062) * [-538.373] (-531.947) (-537.022) (-535.089) -- 0:00:25
781500 -- (-534.437) (-539.900) (-537.209) [-534.396] * (-540.553) (-542.199) (-540.910) [-534.978] -- 0:00:25
782000 -- [-538.832] (-535.505) (-538.212) (-534.424) * (-536.475) (-543.392) [-540.230] (-540.094) -- 0:00:25
782500 -- (-548.687) (-535.097) [-538.569] (-540.004) * (-540.556) (-534.115) (-539.233) [-535.749] -- 0:00:25
783000 -- (-540.125) [-537.242] (-545.128) (-538.965) * (-539.427) (-532.495) (-534.482) [-532.780] -- 0:00:24
783500 -- (-547.617) (-535.696) (-541.256) [-537.438] * (-540.746) (-537.040) (-536.575) [-535.917] -- 0:00:24
784000 -- (-542.405) (-533.335) [-544.713] (-536.753) * (-557.198) (-538.233) (-533.521) [-532.718] -- 0:00:24
784500 -- (-543.693) [-536.251] (-536.034) (-536.763) * [-541.709] (-532.810) (-536.407) (-535.895) -- 0:00:24
785000 -- (-538.067) (-538.580) (-538.222) [-538.250] * (-539.010) (-534.703) [-535.545] (-541.914) -- 0:00:24
Average standard deviation of split frequencies: 0.005998
785500 -- (-541.699) [-533.511] (-539.004) (-546.740) * (-534.524) (-542.438) [-538.221] (-537.127) -- 0:00:24
786000 -- (-539.694) (-540.376) (-539.917) [-535.545] * (-538.392) (-542.948) [-538.404] (-534.890) -- 0:00:24
786500 -- (-533.227) (-541.470) [-535.747] (-540.116) * (-534.647) (-541.751) [-537.455] (-541.411) -- 0:00:24
787000 -- (-535.490) [-538.223] (-535.368) (-538.783) * (-547.933) (-539.307) [-536.904] (-532.876) -- 0:00:24
787500 -- (-535.194) (-534.201) (-545.063) [-538.909] * (-538.508) [-537.220] (-537.000) (-533.155) -- 0:00:24
788000 -- [-540.507] (-535.102) (-535.896) (-535.338) * (-542.211) (-537.460) [-535.853] (-536.364) -- 0:00:24
788500 -- [-535.703] (-538.567) (-537.719) (-542.140) * (-538.766) [-534.735] (-543.868) (-536.274) -- 0:00:24
789000 -- [-533.626] (-542.858) (-535.946) (-540.423) * (-537.230) (-536.451) [-536.414] (-541.635) -- 0:00:24
789500 -- (-543.105) (-535.374) (-534.426) [-535.779] * (-535.557) (-536.464) [-533.874] (-537.195) -- 0:00:24
790000 -- (-539.401) (-538.179) (-540.484) [-539.552] * (-541.384) [-540.433] (-534.015) (-537.853) -- 0:00:24
Average standard deviation of split frequencies: 0.006260
790500 -- (-532.055) (-539.590) (-542.720) [-535.827] * (-543.828) [-533.719] (-536.667) (-540.680) -- 0:00:24
791000 -- (-535.227) (-540.675) (-542.238) [-534.535] * (-545.318) [-537.938] (-537.529) (-535.252) -- 0:00:24
791500 -- (-540.599) (-536.464) (-542.170) [-532.740] * (-538.975) [-539.544] (-537.463) (-540.099) -- 0:00:23
792000 -- (-541.667) (-537.078) (-538.044) [-538.077] * [-539.253] (-533.368) (-535.784) (-545.626) -- 0:00:23
792500 -- (-540.824) [-538.683] (-537.940) (-537.706) * (-540.838) [-534.698] (-532.992) (-535.350) -- 0:00:23
793000 -- (-536.784) [-538.712] (-544.127) (-532.665) * (-537.859) (-538.440) [-540.173] (-540.097) -- 0:00:23
793500 -- (-535.268) (-544.201) (-534.193) [-533.274] * [-542.142] (-536.091) (-536.748) (-543.074) -- 0:00:23
794000 -- (-535.605) [-540.763] (-542.548) (-537.924) * (-542.995) [-540.655] (-542.964) (-541.247) -- 0:00:23
794500 -- [-538.889] (-534.645) (-539.757) (-540.262) * (-536.306) (-532.262) (-537.912) [-540.146] -- 0:00:23
795000 -- [-535.768] (-538.017) (-542.775) (-534.352) * (-538.243) [-534.848] (-539.336) (-546.182) -- 0:00:23
Average standard deviation of split frequencies: 0.006810
795500 -- (-534.634) [-537.159] (-539.231) (-536.994) * (-547.470) [-531.133] (-537.007) (-533.429) -- 0:00:23
796000 -- (-538.305) [-542.491] (-540.127) (-535.420) * (-538.586) (-534.305) [-536.889] (-534.938) -- 0:00:23
796500 -- (-540.557) (-540.054) (-536.859) [-539.024] * (-541.393) [-535.311] (-538.128) (-532.117) -- 0:00:23
797000 -- [-543.859] (-533.709) (-536.429) (-537.069) * [-536.392] (-536.625) (-541.850) (-542.562) -- 0:00:23
797500 -- (-538.874) (-541.410) (-536.183) [-536.136] * [-534.539] (-537.102) (-543.043) (-540.731) -- 0:00:23
798000 -- (-534.410) (-541.133) (-534.686) [-540.869] * (-541.917) (-537.137) [-538.406] (-536.331) -- 0:00:23
798500 -- (-541.446) (-539.696) (-538.339) [-534.452] * (-536.269) (-535.232) [-537.849] (-539.582) -- 0:00:23
799000 -- (-533.834) (-533.459) [-537.617] (-539.866) * (-536.031) (-540.126) (-537.054) [-539.537] -- 0:00:23
799500 -- (-543.427) (-537.271) [-534.737] (-536.172) * (-538.852) (-539.876) (-536.306) [-533.216] -- 0:00:23
800000 -- (-533.447) (-534.004) (-539.463) [-533.287] * [-536.266] (-538.315) (-546.302) (-535.160) -- 0:00:23
Average standard deviation of split frequencies: 0.006771
800500 -- (-535.857) (-535.523) (-539.534) [-538.096] * (-537.322) (-535.318) [-538.794] (-536.177) -- 0:00:22
801000 -- [-533.098] (-538.695) (-546.045) (-537.404) * (-538.589) (-537.508) [-534.412] (-543.112) -- 0:00:22
801500 -- (-532.311) (-548.177) (-547.034) [-539.742] * [-540.919] (-531.788) (-536.912) (-539.001) -- 0:00:22
802000 -- [-536.776] (-542.035) (-539.111) (-541.511) * (-540.843) (-534.062) (-532.152) [-537.308] -- 0:00:22
802500 -- [-538.885] (-537.596) (-544.510) (-538.934) * (-544.588) [-536.855] (-539.829) (-535.606) -- 0:00:22
803000 -- [-538.368] (-543.248) (-537.255) (-535.767) * (-538.999) (-538.249) (-535.768) [-535.030] -- 0:00:22
803500 -- (-544.795) [-538.324] (-534.926) (-540.838) * [-535.376] (-535.690) (-534.831) (-534.933) -- 0:00:22
804000 -- (-542.281) [-537.823] (-534.492) (-538.643) * (-542.414) (-535.952) (-538.474) [-538.004] -- 0:00:22
804500 -- (-540.775) [-537.768] (-539.335) (-543.773) * (-538.650) (-540.122) [-533.192] (-534.335) -- 0:00:22
805000 -- [-540.346] (-538.500) (-540.210) (-534.272) * [-538.478] (-539.854) (-536.097) (-541.273) -- 0:00:22
Average standard deviation of split frequencies: 0.006726
805500 -- [-535.587] (-542.115) (-536.399) (-534.496) * [-537.145] (-540.469) (-534.941) (-541.387) -- 0:00:22
806000 -- (-534.302) (-535.738) (-538.857) [-536.676] * (-542.463) [-532.404] (-536.481) (-540.326) -- 0:00:22
806500 -- (-537.813) (-540.248) (-544.171) [-535.547] * (-538.162) (-537.740) [-538.109] (-536.707) -- 0:00:22
807000 -- [-535.739] (-541.204) (-543.521) (-536.794) * [-536.115] (-542.648) (-538.616) (-539.015) -- 0:00:22
807500 -- (-539.791) (-539.529) (-543.403) [-532.983] * (-541.273) [-536.848] (-537.456) (-536.850) -- 0:00:22
808000 -- (-540.659) (-538.905) (-546.126) [-539.166] * (-543.260) [-533.589] (-538.355) (-534.957) -- 0:00:22
808500 -- (-538.878) [-533.795] (-544.958) (-546.713) * [-544.128] (-531.604) (-535.361) (-538.604) -- 0:00:22
809000 -- (-539.439) (-534.468) (-540.248) [-534.911] * [-539.964] (-538.211) (-541.070) (-535.851) -- 0:00:21
809500 -- (-538.564) (-541.088) (-546.346) [-532.136] * (-538.353) (-533.543) (-538.506) [-533.782] -- 0:00:21
810000 -- (-537.100) [-539.587] (-552.027) (-534.909) * [-537.127] (-543.284) (-538.006) (-535.867) -- 0:00:21
Average standard deviation of split frequencies: 0.006978
810500 -- (-538.510) (-533.313) (-547.425) [-545.796] * (-537.608) [-537.374] (-532.898) (-538.620) -- 0:00:21
811000 -- [-538.845] (-533.440) (-547.835) (-541.174) * (-533.432) (-537.596) (-534.502) [-532.379] -- 0:00:21
811500 -- (-547.845) (-535.423) (-542.015) [-537.967] * (-540.338) (-534.176) [-537.052] (-538.724) -- 0:00:21
812000 -- (-537.880) (-536.655) [-540.080] (-538.074) * (-544.254) [-533.668] (-544.620) (-537.153) -- 0:00:21
812500 -- (-539.950) [-534.281] (-538.640) (-541.856) * (-538.284) (-543.283) (-540.456) [-543.906] -- 0:00:21
813000 -- (-536.045) [-537.224] (-536.496) (-536.949) * (-539.100) [-530.634] (-546.563) (-540.332) -- 0:00:21
813500 -- (-539.070) [-535.237] (-541.353) (-540.808) * (-539.140) (-536.184) (-545.392) [-532.106] -- 0:00:21
814000 -- (-531.848) [-537.231] (-541.748) (-531.960) * [-540.564] (-536.515) (-544.856) (-537.761) -- 0:00:21
814500 -- (-536.041) (-541.005) (-532.300) [-536.750] * (-544.230) (-534.952) [-536.631] (-538.646) -- 0:00:21
815000 -- (-534.620) (-536.586) [-541.029] (-541.257) * (-548.300) (-534.287) (-540.816) [-543.864] -- 0:00:21
Average standard deviation of split frequencies: 0.006932
815500 -- (-532.936) [-534.296] (-538.544) (-541.007) * (-539.787) (-531.742) [-539.369] (-536.900) -- 0:00:21
816000 -- (-541.636) (-540.183) (-546.601) [-539.046] * (-539.706) [-533.945] (-544.593) (-539.515) -- 0:00:21
816500 -- (-541.970) [-537.983] (-546.510) (-534.375) * (-538.442) (-533.655) (-542.230) [-534.876] -- 0:00:21
817000 -- [-535.234] (-534.597) (-541.729) (-531.934) * (-540.975) (-536.820) (-535.052) [-534.962] -- 0:00:21
817500 -- (-537.284) (-535.809) (-535.663) [-534.281] * (-536.348) (-541.894) (-536.772) [-531.530] -- 0:00:20
818000 -- (-540.010) (-541.460) [-538.641] (-537.916) * (-536.121) [-535.064] (-538.715) (-542.335) -- 0:00:20
818500 -- (-535.239) (-535.804) [-533.036] (-533.367) * [-539.265] (-534.790) (-539.826) (-541.887) -- 0:00:20
819000 -- (-542.899) [-535.131] (-540.030) (-540.962) * (-533.721) [-538.654] (-539.242) (-535.446) -- 0:00:20
819500 -- [-533.984] (-537.564) (-536.910) (-537.023) * (-540.264) (-533.659) [-538.945] (-542.530) -- 0:00:20
820000 -- (-535.505) (-535.803) [-536.550] (-536.248) * (-536.183) [-535.609] (-541.230) (-538.375) -- 0:00:20
Average standard deviation of split frequencies: 0.007180
820500 -- (-535.826) (-541.306) [-534.085] (-540.435) * (-537.232) (-538.842) [-538.053] (-541.566) -- 0:00:20
821000 -- [-535.491] (-542.614) (-536.842) (-542.535) * (-536.510) (-538.764) [-539.674] (-541.132) -- 0:00:20
821500 -- [-538.870] (-537.744) (-542.090) (-544.295) * [-535.535] (-539.397) (-539.619) (-545.387) -- 0:00:20
822000 -- [-531.604] (-542.632) (-536.394) (-536.533) * [-532.872] (-540.964) (-536.206) (-534.092) -- 0:00:20
822500 -- [-542.874] (-538.509) (-532.161) (-536.486) * (-542.398) (-540.963) [-534.191] (-536.775) -- 0:00:20
823000 -- [-530.006] (-537.752) (-538.178) (-539.857) * (-534.274) [-535.434] (-542.261) (-539.994) -- 0:00:20
823500 -- (-538.210) (-540.752) (-538.841) [-537.797] * (-539.667) (-540.417) (-535.357) [-533.131] -- 0:00:20
824000 -- (-537.654) [-532.887] (-544.330) (-540.035) * (-537.663) (-547.060) (-529.712) [-543.025] -- 0:00:20
824500 -- (-537.671) [-529.547] (-543.061) (-541.627) * (-532.816) (-539.600) [-532.627] (-535.842) -- 0:00:20
825000 -- (-538.270) (-533.968) [-529.634] (-544.348) * [-539.000] (-534.598) (-537.119) (-534.674) -- 0:00:20
Average standard deviation of split frequencies: 0.007419
825500 -- (-540.408) (-538.610) [-536.472] (-544.155) * (-533.513) (-535.182) (-538.540) [-540.482] -- 0:00:20
826000 -- (-537.261) (-539.451) [-536.386] (-536.228) * (-536.186) (-536.755) [-537.264] (-535.882) -- 0:00:20
826500 -- (-537.516) [-535.795] (-534.892) (-537.577) * (-547.138) (-537.983) [-534.051] (-534.502) -- 0:00:19
827000 -- (-546.149) [-534.088] (-535.611) (-530.025) * (-536.999) (-541.873) [-535.821] (-532.451) -- 0:00:19
827500 -- (-539.107) (-543.331) (-535.697) [-533.276] * (-535.662) [-541.285] (-538.657) (-534.981) -- 0:00:19
828000 -- (-535.136) (-549.244) (-536.861) [-539.967] * (-531.701) [-532.142] (-547.814) (-535.131) -- 0:00:19
828500 -- (-547.990) (-537.604) (-534.643) [-537.437] * (-539.381) (-532.884) [-531.308] (-541.971) -- 0:00:19
829000 -- [-542.427] (-542.230) (-538.411) (-540.411) * (-538.527) (-537.621) (-533.944) [-536.019] -- 0:00:19
829500 -- (-545.493) (-539.575) [-540.192] (-538.389) * [-534.516] (-536.388) (-534.398) (-538.646) -- 0:00:19
830000 -- [-535.120] (-538.908) (-545.784) (-542.076) * (-540.007) (-538.525) (-534.616) [-535.085] -- 0:00:19
Average standard deviation of split frequencies: 0.007094
830500 -- [-536.073] (-538.883) (-541.570) (-543.882) * [-539.448] (-539.314) (-536.656) (-537.735) -- 0:00:19
831000 -- (-535.943) [-541.154] (-541.172) (-538.387) * (-533.790) (-539.854) [-532.611] (-542.402) -- 0:00:19
831500 -- (-544.697) [-536.788] (-548.424) (-537.404) * (-538.298) [-534.042] (-536.325) (-538.226) -- 0:00:19
832000 -- (-548.955) (-537.654) (-541.847) [-531.921] * (-537.952) (-536.689) [-534.455] (-545.021) -- 0:00:19
832500 -- (-542.750) [-534.716] (-541.839) (-539.617) * (-543.610) (-539.091) (-540.074) [-538.901] -- 0:00:19
833000 -- (-537.129) [-538.178] (-543.570) (-544.926) * [-541.041] (-531.217) (-537.068) (-539.415) -- 0:00:19
833500 -- [-536.404] (-533.668) (-541.930) (-540.948) * (-535.030) (-541.166) (-547.967) [-532.731] -- 0:00:19
834000 -- (-543.686) [-537.320] (-543.107) (-542.048) * (-536.688) (-541.054) [-539.952] (-542.257) -- 0:00:19
834500 -- (-538.063) [-530.699] (-541.341) (-536.384) * (-534.349) (-538.292) [-544.886] (-536.753) -- 0:00:19
835000 -- [-532.556] (-533.170) (-539.309) (-537.156) * (-540.162) (-535.632) [-534.836] (-541.818) -- 0:00:18
Average standard deviation of split frequencies: 0.006767
835500 -- [-537.836] (-535.559) (-537.529) (-542.399) * [-540.202] (-539.334) (-541.846) (-541.946) -- 0:00:18
836000 -- (-537.798) (-537.957) (-533.375) [-534.844] * (-533.554) [-534.089] (-542.417) (-540.461) -- 0:00:18
836500 -- (-542.544) [-540.584] (-542.328) (-537.490) * (-534.700) [-536.769] (-537.532) (-539.799) -- 0:00:18
837000 -- (-540.124) (-541.317) (-534.568) [-541.026] * (-542.142) (-539.980) (-533.106) [-540.086] -- 0:00:18
837500 -- [-531.437] (-536.687) (-538.281) (-538.922) * (-532.188) (-536.234) (-536.484) [-532.132] -- 0:00:18
838000 -- (-541.550) [-535.751] (-542.349) (-541.280) * (-532.922) (-533.849) (-542.563) [-541.505] -- 0:00:18
838500 -- (-552.301) (-533.467) (-539.607) [-538.848] * (-536.142) [-547.636] (-542.217) (-539.103) -- 0:00:18
839000 -- (-540.918) (-535.958) [-540.392] (-541.156) * (-536.329) (-539.546) [-539.047] (-538.829) -- 0:00:18
839500 -- [-540.036] (-533.801) (-542.646) (-536.489) * (-533.501) (-535.446) (-540.674) [-537.959] -- 0:00:18
840000 -- (-540.806) (-539.634) [-536.344] (-543.863) * (-540.138) (-542.408) (-542.906) [-537.942] -- 0:00:18
Average standard deviation of split frequencies: 0.006729
840500 -- [-535.936] (-534.114) (-538.285) (-539.036) * (-538.096) (-535.141) (-543.132) [-535.462] -- 0:00:18
841000 -- (-543.472) (-538.752) (-543.919) [-537.269] * (-539.483) [-531.735] (-547.268) (-535.973) -- 0:00:18
841500 -- (-534.862) (-538.097) [-535.459] (-540.121) * [-543.142] (-534.594) (-539.770) (-539.498) -- 0:00:18
842000 -- (-543.481) (-542.453) (-542.504) [-538.340] * (-538.420) (-537.128) (-550.781) [-539.823] -- 0:00:18
842500 -- (-547.958) (-541.385) (-537.505) [-533.606] * [-539.510] (-536.184) (-538.201) (-538.190) -- 0:00:18
843000 -- [-539.078] (-535.850) (-540.220) (-537.335) * (-538.621) (-536.802) (-548.665) [-536.880] -- 0:00:18
843500 -- (-535.543) [-541.130] (-541.943) (-535.758) * (-534.519) (-541.001) (-543.133) [-536.284] -- 0:00:17
844000 -- (-539.116) (-542.756) (-536.193) [-531.806] * [-532.147] (-540.665) (-538.474) (-536.053) -- 0:00:17
844500 -- (-533.838) (-536.904) [-530.786] (-533.997) * (-543.162) (-534.741) (-534.123) [-538.418] -- 0:00:17
845000 -- (-535.878) (-541.071) (-537.978) [-537.494] * (-535.889) (-542.179) [-531.806] (-539.662) -- 0:00:17
Average standard deviation of split frequencies: 0.006408
845500 -- [-535.993] (-535.158) (-534.110) (-536.286) * (-540.198) [-540.040] (-538.318) (-537.400) -- 0:00:17
846000 -- (-535.060) (-536.374) (-534.277) [-538.219] * [-536.967] (-536.815) (-535.721) (-536.183) -- 0:00:17
846500 -- (-537.158) (-537.820) (-539.064) [-530.541] * (-541.968) [-537.047] (-532.877) (-539.623) -- 0:00:17
847000 -- (-533.988) (-539.384) [-533.092] (-541.496) * (-538.431) (-538.014) [-535.159] (-539.235) -- 0:00:17
847500 -- (-535.375) (-544.027) [-537.322] (-536.976) * (-536.066) (-540.420) (-534.307) [-536.074] -- 0:00:17
848000 -- [-537.912] (-541.726) (-531.894) (-534.503) * (-535.921) (-535.319) [-535.091] (-539.806) -- 0:00:17
848500 -- (-537.293) (-541.819) (-533.724) [-544.418] * (-535.581) (-543.612) (-535.924) [-531.434] -- 0:00:17
849000 -- (-532.863) [-536.847] (-538.516) (-544.746) * [-534.432] (-537.743) (-539.652) (-544.133) -- 0:00:17
849500 -- (-543.528) (-544.162) (-531.776) [-534.630] * [-541.456] (-544.274) (-537.033) (-535.570) -- 0:00:17
850000 -- (-533.517) (-543.920) (-537.497) [-533.826] * [-535.735] (-548.210) (-541.716) (-538.671) -- 0:00:17
Average standard deviation of split frequencies: 0.005542
850500 -- [-533.519] (-547.027) (-534.500) (-534.530) * (-539.067) (-541.838) [-544.522] (-541.119) -- 0:00:17
851000 -- (-532.090) [-544.735] (-534.845) (-534.879) * (-537.988) (-535.634) (-549.715) [-535.649] -- 0:00:17
851500 -- (-541.645) (-544.260) (-542.784) [-535.935] * (-541.324) (-539.553) (-542.759) [-540.516] -- 0:00:17
852000 -- (-533.129) [-537.335] (-538.207) (-539.869) * [-538.110] (-543.807) (-535.218) (-540.328) -- 0:00:17
852500 -- (-536.039) [-538.531] (-538.075) (-542.645) * (-539.000) [-536.941] (-537.594) (-539.031) -- 0:00:16
853000 -- (-533.962) [-538.204] (-537.458) (-549.926) * (-536.125) (-536.124) [-539.216] (-542.327) -- 0:00:16
853500 -- (-530.287) [-535.440] (-541.319) (-541.363) * (-535.051) (-542.756) (-541.886) [-541.262] -- 0:00:16
854000 -- (-544.137) (-534.981) [-533.646] (-538.811) * (-540.119) (-539.990) [-543.479] (-542.431) -- 0:00:16
854500 -- (-542.739) (-539.958) (-535.935) [-542.010] * (-537.677) [-539.476] (-539.897) (-543.199) -- 0:00:16
855000 -- (-541.502) [-538.071] (-535.225) (-541.262) * (-539.103) [-541.508] (-549.055) (-539.763) -- 0:00:16
Average standard deviation of split frequencies: 0.005782
855500 -- (-540.525) (-538.517) [-540.422] (-541.996) * (-536.679) (-538.550) [-534.714] (-540.788) -- 0:00:16
856000 -- (-549.793) (-542.719) [-539.528] (-544.902) * (-541.675) (-540.266) [-537.558] (-537.014) -- 0:00:16
856500 -- (-537.205) (-536.263) [-536.544] (-543.706) * (-534.435) (-541.883) [-537.387] (-539.586) -- 0:00:16
857000 -- (-540.030) [-542.302] (-541.134) (-539.109) * [-533.437] (-542.377) (-535.188) (-544.591) -- 0:00:16
857500 -- (-543.525) (-536.532) (-541.808) [-541.059] * (-533.815) [-535.909] (-533.333) (-542.668) -- 0:00:16
858000 -- (-542.403) (-538.830) [-535.190] (-545.607) * (-536.056) (-539.323) (-538.686) [-542.720] -- 0:00:16
858500 -- (-540.282) (-543.792) (-537.027) [-546.163] * (-535.328) (-543.827) (-538.118) [-538.729] -- 0:00:16
859000 -- (-536.759) (-542.988) [-540.086] (-533.763) * (-537.625) (-540.952) [-533.055] (-542.980) -- 0:00:16
859500 -- [-534.791] (-541.583) (-541.593) (-542.477) * (-534.216) (-539.511) [-533.634] (-539.860) -- 0:00:16
860000 -- [-533.843] (-540.566) (-540.234) (-537.877) * (-545.773) [-537.469] (-544.724) (-540.968) -- 0:00:16
Average standard deviation of split frequencies: 0.006025
860500 -- [-536.579] (-546.468) (-538.973) (-536.071) * (-533.525) [-535.818] (-542.514) (-541.187) -- 0:00:16
861000 -- (-536.659) (-537.866) [-548.829] (-536.091) * (-534.664) (-535.928) [-540.554] (-540.226) -- 0:00:15
861500 -- [-533.797] (-540.245) (-539.235) (-540.382) * (-541.145) [-542.723] (-535.029) (-540.837) -- 0:00:15
862000 -- (-535.590) (-539.432) (-539.319) [-542.201] * [-535.406] (-533.422) (-535.269) (-541.508) -- 0:00:15
862500 -- [-539.274] (-542.348) (-541.836) (-536.138) * [-537.867] (-535.841) (-537.160) (-538.492) -- 0:00:15
863000 -- (-540.630) (-541.653) [-538.952] (-546.136) * (-543.126) (-540.377) [-538.288] (-540.194) -- 0:00:15
863500 -- [-537.096] (-537.026) (-536.865) (-536.572) * [-537.261] (-554.329) (-533.882) (-542.657) -- 0:00:15
864000 -- [-536.782] (-539.597) (-547.123) (-532.213) * [-537.559] (-540.583) (-532.112) (-538.983) -- 0:00:15
864500 -- (-536.950) [-535.573] (-536.817) (-535.730) * (-536.184) (-541.010) (-536.707) [-541.282] -- 0:00:15
865000 -- (-538.225) (-537.513) [-535.646] (-533.853) * (-536.970) (-537.067) [-533.746] (-540.103) -- 0:00:15
Average standard deviation of split frequencies: 0.005443
865500 -- (-536.367) (-541.646) [-538.998] (-535.908) * [-535.837] (-535.059) (-534.124) (-540.338) -- 0:00:15
866000 -- [-539.244] (-536.091) (-533.652) (-539.702) * (-540.513) [-542.607] (-538.071) (-545.208) -- 0:00:15
866500 -- [-535.314] (-549.253) (-535.952) (-543.498) * (-540.280) (-535.880) [-535.671] (-547.475) -- 0:00:15
867000 -- (-542.857) (-533.710) [-535.987] (-536.206) * (-538.495) (-542.098) [-532.559] (-534.920) -- 0:00:15
867500 -- (-541.187) (-539.434) [-539.339] (-541.317) * (-543.944) (-537.627) [-533.018] (-535.087) -- 0:00:15
868000 -- (-540.737) (-543.381) (-533.680) [-539.176] * (-542.734) (-535.571) (-543.022) [-533.475] -- 0:00:15
868500 -- (-540.093) (-534.283) [-536.881] (-541.360) * (-531.835) [-534.289] (-535.091) (-536.789) -- 0:00:15
869000 -- [-538.982] (-537.272) (-534.244) (-543.611) * (-537.888) [-531.193] (-532.300) (-539.878) -- 0:00:15
869500 -- [-537.802] (-538.000) (-541.063) (-543.346) * (-535.959) (-542.570) [-545.214] (-535.733) -- 0:00:15
870000 -- (-538.904) [-535.815] (-533.165) (-536.401) * (-538.407) (-539.801) [-534.358] (-538.112) -- 0:00:14
Average standard deviation of split frequencies: 0.005414
870500 -- (-546.397) (-534.295) [-536.525] (-536.889) * (-535.335) (-536.165) [-534.701] (-540.284) -- 0:00:14
871000 -- (-539.820) (-543.784) [-542.314] (-542.603) * (-534.701) (-538.397) (-538.943) [-535.610] -- 0:00:14
871500 -- (-543.792) (-538.246) [-540.748] (-532.441) * (-537.134) (-540.173) (-538.203) [-536.072] -- 0:00:14
872000 -- (-546.157) (-539.282) (-539.605) [-537.894] * (-540.173) (-538.113) [-543.281] (-534.976) -- 0:00:14
872500 -- (-537.516) (-537.157) [-537.572] (-537.660) * (-535.477) (-539.613) (-539.981) [-538.937] -- 0:00:14
873000 -- (-537.379) [-534.785] (-539.569) (-534.159) * (-537.655) (-540.253) (-534.843) [-536.878] -- 0:00:14
873500 -- [-541.601] (-539.337) (-538.594) (-537.363) * (-542.371) [-539.176] (-533.294) (-540.663) -- 0:00:14
874000 -- [-533.892] (-534.561) (-543.210) (-534.982) * (-548.584) [-539.446] (-533.181) (-536.243) -- 0:00:14
874500 -- [-540.077] (-549.827) (-540.298) (-539.722) * [-547.725] (-536.156) (-537.883) (-541.796) -- 0:00:14
875000 -- (-537.592) (-540.549) (-534.732) [-540.179] * (-547.893) (-536.940) (-537.184) [-535.088] -- 0:00:14
Average standard deviation of split frequencies: 0.005381
875500 -- [-539.771] (-544.059) (-536.138) (-533.951) * (-548.286) (-536.558) (-537.833) [-535.164] -- 0:00:14
876000 -- [-535.813] (-541.006) (-538.721) (-537.360) * (-539.166) [-533.215] (-536.790) (-539.436) -- 0:00:14
876500 -- (-537.889) (-540.169) (-537.478) [-543.112] * (-544.178) (-535.707) [-536.225] (-538.134) -- 0:00:14
877000 -- (-537.717) [-539.611] (-541.269) (-537.149) * (-533.728) (-535.189) [-537.563] (-538.180) -- 0:00:14
877500 -- [-534.308] (-542.855) (-545.254) (-537.521) * [-533.852] (-538.809) (-539.272) (-542.887) -- 0:00:14
878000 -- [-535.614] (-538.976) (-543.231) (-535.824) * (-540.456) [-534.135] (-542.818) (-532.064) -- 0:00:14
878500 -- [-534.821] (-541.011) (-539.177) (-537.062) * [-538.719] (-537.266) (-542.434) (-533.376) -- 0:00:13
879000 -- (-543.012) (-538.932) [-533.293] (-542.665) * [-538.942] (-537.359) (-539.628) (-539.154) -- 0:00:13
879500 -- [-540.526] (-538.662) (-539.001) (-542.093) * (-543.094) (-536.980) [-532.634] (-538.327) -- 0:00:13
880000 -- (-535.495) (-549.263) [-538.038] (-544.875) * (-547.048) [-531.990] (-536.183) (-537.424) -- 0:00:13
Average standard deviation of split frequencies: 0.005353
880500 -- (-548.631) [-547.279] (-535.201) (-535.739) * (-535.477) [-535.209] (-534.555) (-541.201) -- 0:00:13
881000 -- (-539.500) (-543.202) [-532.587] (-538.612) * (-544.189) (-537.920) [-538.876] (-535.225) -- 0:00:13
881500 -- (-546.017) [-541.580] (-537.152) (-542.803) * (-536.174) (-541.579) (-540.869) [-533.974] -- 0:00:13
882000 -- [-538.999] (-533.488) (-535.137) (-539.334) * (-546.959) (-536.239) [-535.256] (-542.599) -- 0:00:13
882500 -- (-538.735) (-546.596) [-540.633] (-538.883) * [-539.713] (-535.420) (-543.054) (-536.841) -- 0:00:13
883000 -- (-544.797) (-538.391) (-534.399) [-539.657] * [-536.170] (-541.110) (-537.512) (-536.393) -- 0:00:13
883500 -- (-541.421) (-536.248) [-540.258] (-537.917) * (-536.903) (-536.045) (-536.101) [-533.288] -- 0:00:13
884000 -- (-547.349) (-539.166) [-535.511] (-539.416) * (-539.265) (-537.419) (-542.182) [-535.481] -- 0:00:13
884500 -- (-543.185) [-535.955] (-537.415) (-540.272) * (-539.927) [-535.836] (-538.782) (-535.099) -- 0:00:13
885000 -- (-538.260) [-534.876] (-534.939) (-537.027) * (-534.107) [-537.464] (-534.670) (-534.434) -- 0:00:13
Average standard deviation of split frequencies: 0.005321
885500 -- [-538.848] (-536.684) (-537.760) (-542.691) * (-541.504) (-538.354) (-536.546) [-540.770] -- 0:00:13
886000 -- (-544.664) (-535.223) [-536.983] (-541.747) * [-536.188] (-539.995) (-533.357) (-534.604) -- 0:00:13
886500 -- (-533.436) (-537.763) [-532.968] (-544.677) * (-535.510) (-537.053) [-536.270] (-538.213) -- 0:00:13
887000 -- (-538.448) (-540.213) (-536.594) [-535.017] * (-537.018) (-535.663) [-536.767] (-537.515) -- 0:00:12
887500 -- (-542.234) (-535.591) (-533.911) [-532.749] * (-536.898) [-537.778] (-544.682) (-533.929) -- 0:00:12
888000 -- (-537.080) (-542.672) [-533.880] (-533.382) * (-541.192) [-533.859] (-545.477) (-535.667) -- 0:00:12
888500 -- (-538.836) (-536.233) [-531.762] (-534.636) * (-537.863) (-538.961) [-539.382] (-532.927) -- 0:00:12
889000 -- (-538.792) (-547.508) (-534.817) [-535.869] * (-539.047) (-540.623) (-537.359) [-535.329] -- 0:00:12
889500 -- [-537.289] (-538.885) (-534.330) (-542.244) * (-541.654) (-534.674) (-539.590) [-534.540] -- 0:00:12
890000 -- [-537.888] (-537.164) (-534.073) (-535.597) * (-542.663) (-537.947) [-536.738] (-541.011) -- 0:00:12
Average standard deviation of split frequencies: 0.004499
890500 -- (-536.959) (-540.498) (-537.595) [-540.654] * (-537.943) (-538.405) (-534.594) [-540.762] -- 0:00:12
891000 -- [-537.422] (-536.350) (-536.132) (-538.276) * (-536.318) [-537.677] (-534.531) (-533.568) -- 0:00:12
891500 -- (-535.905) (-539.679) (-540.605) [-535.825] * (-535.951) (-540.770) (-542.351) [-534.248] -- 0:00:12
892000 -- (-534.399) (-531.892) (-538.225) [-535.033] * [-533.032] (-539.609) (-536.576) (-545.932) -- 0:00:12
892500 -- (-533.869) (-538.489) [-537.365] (-541.487) * [-536.774] (-542.283) (-535.868) (-534.939) -- 0:00:12
893000 -- (-535.357) [-534.588] (-536.497) (-543.630) * (-533.966) (-542.162) (-532.411) [-555.164] -- 0:00:12
893500 -- (-536.282) (-531.560) (-535.122) [-533.874] * (-535.181) [-537.178] (-536.576) (-539.126) -- 0:00:12
894000 -- (-546.396) (-534.233) [-540.180] (-534.629) * (-533.083) (-541.539) (-542.212) [-535.877] -- 0:00:12
894500 -- (-542.644) (-531.547) (-545.773) [-535.462] * (-538.651) (-540.277) [-532.117] (-536.014) -- 0:00:12
895000 -- (-536.182) [-537.045] (-535.341) (-536.645) * (-537.476) (-538.818) [-530.717] (-542.196) -- 0:00:12
Average standard deviation of split frequencies: 0.003946
895500 -- (-537.444) (-539.469) (-535.015) [-536.242] * (-536.629) (-537.115) [-534.828] (-537.694) -- 0:00:12
896000 -- (-542.536) (-540.844) (-540.800) [-537.248] * [-538.057] (-534.565) (-536.973) (-537.353) -- 0:00:11
896500 -- (-541.020) (-536.133) [-536.752] (-543.547) * (-535.677) [-539.822] (-534.897) (-546.392) -- 0:00:11
897000 -- (-536.010) (-540.398) (-539.430) [-536.757] * (-534.139) [-534.451] (-538.733) (-542.633) -- 0:00:11
897500 -- (-537.554) (-537.766) [-532.924] (-536.906) * (-541.668) [-534.697] (-535.334) (-537.934) -- 0:00:11
898000 -- (-534.054) (-537.114) (-540.501) [-541.843] * (-536.283) (-534.707) (-541.864) [-535.514] -- 0:00:11
898500 -- (-537.415) (-535.737) (-540.734) [-533.067] * (-541.151) [-536.535] (-538.177) (-535.994) -- 0:00:11
899000 -- [-533.041] (-533.455) (-540.739) (-539.032) * [-536.508] (-540.456) (-542.655) (-533.350) -- 0:00:11
899500 -- (-538.127) (-537.683) [-532.392] (-537.380) * (-538.592) (-553.112) (-541.979) [-537.413] -- 0:00:11
900000 -- (-542.122) [-540.179] (-536.872) (-533.965) * (-533.651) (-534.543) [-535.568] (-541.789) -- 0:00:11
Average standard deviation of split frequencies: 0.004711
900500 -- (-539.153) [-538.693] (-535.003) (-534.987) * (-535.192) [-538.011] (-539.672) (-543.072) -- 0:00:11
901000 -- (-545.011) [-540.997] (-540.986) (-541.726) * [-537.377] (-538.449) (-541.176) (-541.282) -- 0:00:11
901500 -- (-548.829) (-537.933) [-540.087] (-543.828) * (-536.019) [-541.594] (-538.196) (-538.776) -- 0:00:11
902000 -- (-542.659) (-541.761) (-536.912) [-537.924] * (-531.953) [-542.793] (-535.066) (-543.299) -- 0:00:11
902500 -- (-537.411) (-533.404) (-535.502) [-543.959] * (-533.907) (-539.733) (-534.906) [-540.793] -- 0:00:11
903000 -- (-542.636) (-536.363) [-537.651] (-544.978) * (-538.944) (-539.078) [-538.139] (-540.159) -- 0:00:11
903500 -- (-542.977) [-536.040] (-538.479) (-539.625) * (-531.361) (-539.837) (-535.708) [-535.549] -- 0:00:11
904000 -- (-538.104) (-538.939) (-538.829) [-544.293] * (-538.381) [-537.794] (-538.041) (-536.289) -- 0:00:11
904500 -- (-537.071) (-540.726) [-534.781] (-536.258) * [-533.731] (-540.114) (-540.309) (-532.955) -- 0:00:10
905000 -- (-540.334) [-534.577] (-542.829) (-540.206) * [-537.366] (-535.606) (-533.595) (-533.690) -- 0:00:10
Average standard deviation of split frequencies: 0.004683
905500 -- (-537.827) [-534.569] (-536.512) (-539.859) * (-534.081) (-549.126) [-537.579] (-542.286) -- 0:00:10
906000 -- (-540.865) (-540.494) (-537.092) [-537.060] * (-534.174) (-546.403) [-539.153] (-531.939) -- 0:00:10
906500 -- (-539.409) (-539.394) (-539.582) [-539.899] * (-538.461) (-541.154) (-536.008) [-532.186] -- 0:00:10
907000 -- (-549.815) [-532.767] (-534.960) (-538.876) * (-537.134) (-537.995) [-539.052] (-536.697) -- 0:00:10
907500 -- (-545.172) (-538.258) (-535.528) [-536.865] * [-541.301] (-541.200) (-533.462) (-541.242) -- 0:00:10
908000 -- (-542.237) (-542.298) (-532.625) [-535.206] * (-539.668) [-538.224] (-538.595) (-547.077) -- 0:00:10
908500 -- (-540.270) (-538.594) (-533.190) [-533.358] * (-541.349) (-536.841) [-534.948] (-543.882) -- 0:00:10
909000 -- (-544.956) (-545.131) [-534.169] (-538.091) * (-544.209) [-541.521] (-540.691) (-546.495) -- 0:00:10
909500 -- (-536.226) (-538.382) (-533.638) [-537.528] * (-544.899) [-534.743] (-543.255) (-543.563) -- 0:00:10
910000 -- (-541.504) (-536.598) (-538.449) [-538.851] * (-541.278) [-537.897] (-539.159) (-543.612) -- 0:00:10
Average standard deviation of split frequencies: 0.004918
910500 -- (-545.095) (-540.407) [-532.621] (-538.425) * (-536.935) (-541.711) [-537.742] (-540.448) -- 0:00:10
911000 -- (-539.027) (-538.206) [-536.723] (-537.851) * [-539.130] (-537.068) (-536.603) (-536.143) -- 0:00:10
911500 -- (-542.415) [-536.247] (-534.931) (-534.650) * (-536.873) (-546.275) (-534.073) [-534.641] -- 0:00:10
912000 -- (-540.347) (-537.456) (-540.991) [-534.340] * [-540.278] (-541.423) (-543.953) (-547.566) -- 0:00:10
912500 -- (-545.212) (-535.301) (-542.320) [-537.051] * (-544.147) [-533.948] (-535.807) (-535.931) -- 0:00:10
913000 -- (-540.466) [-534.331] (-536.285) (-542.547) * (-534.337) [-537.451] (-535.340) (-540.899) -- 0:00:10
913500 -- [-541.616] (-540.098) (-539.522) (-532.699) * (-537.216) (-537.248) [-538.027] (-542.148) -- 0:00:09
914000 -- (-534.649) (-539.448) [-545.605] (-536.984) * (-535.563) (-534.039) [-535.922] (-539.530) -- 0:00:09
914500 -- [-531.756] (-545.832) (-544.112) (-539.917) * (-541.954) (-531.984) [-537.439] (-535.266) -- 0:00:09
915000 -- [-533.841] (-541.367) (-536.359) (-534.510) * [-541.758] (-537.502) (-543.762) (-535.312) -- 0:00:09
Average standard deviation of split frequencies: 0.004889
915500 -- (-538.770) (-540.041) (-536.936) [-535.999] * (-538.836) (-539.989) [-535.196] (-532.568) -- 0:00:09
916000 -- (-535.828) (-538.189) [-537.188] (-533.959) * (-541.915) (-546.846) [-542.132] (-536.003) -- 0:00:09
916500 -- [-538.859] (-540.251) (-540.859) (-533.626) * (-541.371) (-536.046) [-532.924] (-539.322) -- 0:00:09
917000 -- (-540.204) (-545.465) (-536.021) [-541.097] * (-538.324) (-540.879) (-534.045) [-535.681] -- 0:00:09
917500 -- (-543.154) (-535.342) [-536.334] (-535.774) * (-538.691) (-534.073) [-535.519] (-540.115) -- 0:00:09
918000 -- (-540.932) (-544.926) [-536.116] (-534.946) * (-534.510) [-536.584] (-539.011) (-533.935) -- 0:00:09
918500 -- (-536.000) [-538.403] (-537.264) (-538.206) * (-537.329) (-535.915) (-537.143) [-534.842] -- 0:00:09
919000 -- (-541.914) [-537.234] (-538.128) (-535.112) * (-533.877) [-532.045] (-534.758) (-534.271) -- 0:00:09
919500 -- (-547.953) (-538.022) [-534.969] (-540.652) * (-537.786) (-532.913) (-537.705) [-539.669] -- 0:00:09
920000 -- (-542.187) (-543.573) (-534.524) [-532.349] * [-534.526] (-543.722) (-545.191) (-540.050) -- 0:00:09
Average standard deviation of split frequencies: 0.004864
920500 -- (-547.660) (-536.519) (-539.125) [-534.183] * [-539.720] (-538.245) (-539.513) (-539.639) -- 0:00:09
921000 -- [-539.448] (-538.599) (-535.154) (-533.815) * [-539.877] (-534.948) (-536.880) (-538.263) -- 0:00:09
921500 -- (-532.641) [-539.495] (-534.515) (-537.466) * [-535.844] (-538.842) (-539.098) (-539.989) -- 0:00:09
922000 -- (-531.793) (-546.123) [-541.624] (-534.517) * (-539.037) (-536.698) [-542.558] (-544.811) -- 0:00:08
922500 -- (-539.215) (-541.120) [-533.105] (-537.775) * (-540.230) [-538.869] (-549.070) (-531.329) -- 0:00:08
923000 -- [-539.381] (-539.445) (-538.450) (-537.640) * (-540.305) (-539.112) [-540.010] (-536.255) -- 0:00:08
923500 -- (-538.274) (-536.119) (-552.882) [-532.340] * [-536.167] (-541.772) (-533.675) (-536.459) -- 0:00:08
924000 -- [-541.738] (-536.582) (-539.881) (-534.737) * [-536.371] (-537.507) (-549.773) (-534.479) -- 0:00:08
924500 -- (-536.771) [-536.923] (-547.355) (-534.775) * [-534.351] (-533.751) (-536.111) (-542.800) -- 0:00:08
925000 -- [-537.086] (-535.064) (-539.776) (-535.970) * (-539.529) [-535.258] (-538.178) (-538.743) -- 0:00:08
Average standard deviation of split frequencies: 0.004836
925500 -- (-535.117) [-534.816] (-539.633) (-536.517) * [-535.968] (-535.179) (-529.254) (-538.591) -- 0:00:08
926000 -- (-535.141) (-535.937) (-540.865) [-534.039] * (-537.374) [-533.135] (-545.377) (-534.596) -- 0:00:08
926500 -- (-542.586) (-539.969) (-542.257) [-538.542] * (-537.667) (-538.564) [-536.936] (-541.983) -- 0:00:08
927000 -- (-539.933) [-536.467] (-537.712) (-531.799) * (-537.661) (-538.763) [-542.712] (-540.015) -- 0:00:08
927500 -- (-545.935) (-534.806) [-533.540] (-540.990) * [-541.815] (-534.828) (-534.645) (-535.009) -- 0:00:08
928000 -- (-536.693) [-544.777] (-538.706) (-534.560) * (-540.094) (-536.349) (-544.165) [-537.726] -- 0:00:08
928500 -- (-542.483) [-540.050] (-537.094) (-539.807) * (-540.785) [-531.535] (-539.483) (-534.904) -- 0:00:08
929000 -- [-529.646] (-537.826) (-543.371) (-542.742) * (-537.168) [-537.272] (-545.260) (-535.619) -- 0:00:08
929500 -- [-534.816] (-541.238) (-541.051) (-537.424) * (-535.039) (-532.559) (-535.972) [-545.274] -- 0:00:08
930000 -- (-539.917) (-540.384) [-534.580] (-541.368) * (-537.760) (-533.759) (-537.256) [-537.996] -- 0:00:08
Average standard deviation of split frequencies: 0.004559
930500 -- [-539.626] (-536.149) (-538.685) (-540.572) * (-535.274) [-536.847] (-539.171) (-542.354) -- 0:00:07
931000 -- [-536.986] (-532.838) (-538.006) (-533.352) * [-536.641] (-539.324) (-544.668) (-542.041) -- 0:00:07
931500 -- (-536.953) (-539.271) (-543.920) [-536.990] * (-535.660) (-533.332) (-538.366) [-536.638] -- 0:00:07
932000 -- (-540.299) [-531.996] (-533.198) (-539.675) * (-534.041) (-546.283) [-537.605] (-545.272) -- 0:00:07
932500 -- [-534.153] (-535.072) (-533.587) (-540.779) * [-531.956] (-539.274) (-538.352) (-537.500) -- 0:00:07
933000 -- [-537.941] (-535.362) (-541.108) (-536.283) * (-532.416) (-536.236) (-544.266) [-538.295] -- 0:00:07
933500 -- (-533.298) (-532.978) [-533.036] (-536.443) * (-542.250) [-536.831] (-542.227) (-538.624) -- 0:00:07
934000 -- (-540.219) [-536.954] (-532.303) (-535.407) * (-535.929) (-535.743) (-542.680) [-540.022] -- 0:00:07
934500 -- (-537.529) (-540.122) (-531.195) [-535.303] * (-538.638) (-537.623) (-551.465) [-538.387] -- 0:00:07
935000 -- (-539.147) [-541.371] (-535.087) (-538.010) * (-536.524) [-538.000] (-537.453) (-542.473) -- 0:00:07
Average standard deviation of split frequencies: 0.004533
935500 -- [-534.403] (-533.883) (-539.750) (-539.199) * (-539.732) (-536.705) [-535.970] (-531.419) -- 0:00:07
936000 -- (-537.237) (-539.244) (-538.844) [-531.093] * (-538.246) (-541.354) (-532.746) [-532.817] -- 0:00:07
936500 -- (-537.119) [-541.524] (-544.277) (-535.526) * [-535.036] (-540.246) (-536.566) (-536.954) -- 0:00:07
937000 -- (-533.354) [-542.578] (-539.847) (-538.627) * (-536.953) (-541.829) [-534.662] (-537.718) -- 0:00:07
937500 -- [-539.515] (-538.187) (-534.444) (-534.533) * (-533.679) (-539.087) [-536.034] (-532.893) -- 0:00:07
938000 -- (-531.362) [-541.726] (-533.777) (-539.302) * (-537.109) (-541.273) (-537.423) [-537.636] -- 0:00:07
938500 -- (-533.120) (-535.108) (-536.857) [-540.871] * (-538.172) [-534.501] (-543.611) (-539.982) -- 0:00:07
939000 -- (-539.042) [-534.108] (-539.074) (-543.023) * [-534.939] (-533.321) (-532.670) (-538.771) -- 0:00:07
939500 -- (-543.594) [-531.494] (-534.281) (-544.046) * (-543.722) [-532.421] (-543.167) (-537.299) -- 0:00:06
940000 -- [-541.714] (-533.199) (-536.182) (-547.774) * (-537.749) (-541.933) (-551.113) [-533.455] -- 0:00:06
Average standard deviation of split frequencies: 0.004510
940500 -- (-535.711) [-534.952] (-543.672) (-537.573) * (-540.370) (-545.813) (-533.600) [-537.617] -- 0:00:06
941000 -- (-538.340) (-534.480) (-538.985) [-540.942] * (-538.523) (-544.103) (-539.745) [-535.243] -- 0:00:06
941500 -- (-541.186) (-534.669) (-535.500) [-535.266] * (-542.919) (-539.963) [-534.105] (-544.435) -- 0:00:06
942000 -- [-538.095] (-532.363) (-535.944) (-536.328) * (-546.196) [-535.781] (-539.920) (-540.027) -- 0:00:06
942500 -- (-539.461) (-537.452) (-536.427) [-536.638] * (-534.201) [-535.420] (-540.417) (-535.224) -- 0:00:06
943000 -- (-539.962) (-535.218) [-538.161] (-535.212) * [-543.535] (-538.271) (-545.758) (-537.601) -- 0:00:06
943500 -- (-541.684) (-538.414) (-538.835) [-535.060] * (-540.589) [-536.387] (-538.248) (-539.145) -- 0:00:06
944000 -- [-541.360] (-537.754) (-534.507) (-541.262) * (-537.879) (-539.037) (-543.163) [-534.640] -- 0:00:06
944500 -- (-538.915) (-534.777) (-545.929) [-535.317] * [-537.255] (-537.936) (-542.763) (-537.534) -- 0:00:06
945000 -- (-537.913) (-538.761) [-537.597] (-532.528) * [-533.757] (-542.606) (-540.089) (-533.735) -- 0:00:06
Average standard deviation of split frequencies: 0.004236
945500 -- (-540.309) (-536.263) (-540.868) [-539.000] * (-539.502) [-537.269] (-536.822) (-536.990) -- 0:00:06
946000 -- (-542.131) (-536.894) (-541.657) [-537.428] * (-538.326) (-537.843) [-533.743] (-534.467) -- 0:00:06
946500 -- (-537.733) (-535.821) (-537.097) [-535.046] * (-539.428) (-533.973) [-538.330] (-543.346) -- 0:00:06
947000 -- (-536.028) (-546.429) (-540.570) [-534.951] * (-542.603) (-535.334) (-540.238) [-539.303] -- 0:00:06
947500 -- (-551.275) (-543.483) (-543.003) [-538.387] * [-537.154] (-537.388) (-541.799) (-534.376) -- 0:00:06
948000 -- [-548.067] (-546.309) (-536.621) (-532.664) * [-534.256] (-532.728) (-544.160) (-539.507) -- 0:00:05
948500 -- (-540.823) (-535.669) [-536.889] (-535.917) * [-540.205] (-539.507) (-534.526) (-543.246) -- 0:00:05
949000 -- (-537.365) (-534.212) [-536.464] (-539.060) * [-539.798] (-540.846) (-537.454) (-536.101) -- 0:00:05
949500 -- (-535.103) [-532.732] (-537.220) (-543.108) * (-538.931) [-538.386] (-538.887) (-537.381) -- 0:00:05
950000 -- (-546.582) (-532.403) (-538.244) [-539.521] * (-536.887) (-537.976) [-539.283] (-550.048) -- 0:00:05
Average standard deviation of split frequencies: 0.004215
950500 -- (-545.225) (-539.831) [-533.761] (-539.020) * (-533.440) (-539.537) [-536.429] (-539.487) -- 0:00:05
951000 -- [-535.709] (-534.641) (-533.604) (-535.915) * (-538.031) [-534.148] (-536.261) (-539.382) -- 0:00:05
951500 -- (-541.158) [-537.139] (-538.579) (-535.088) * (-540.707) (-539.082) (-535.595) [-539.107] -- 0:00:05
952000 -- (-535.967) [-537.709] (-543.655) (-537.389) * [-533.411] (-546.497) (-541.904) (-531.970) -- 0:00:05
952500 -- (-540.247) (-539.488) [-534.879] (-536.645) * (-543.777) [-536.839] (-535.374) (-534.510) -- 0:00:05
953000 -- (-549.587) [-534.637] (-544.369) (-531.920) * (-537.756) (-542.213) (-537.472) [-532.104] -- 0:00:05
953500 -- (-537.803) (-532.769) [-537.718] (-538.427) * (-536.650) [-538.927] (-539.399) (-534.367) -- 0:00:05
954000 -- (-539.267) [-538.981] (-536.903) (-534.527) * (-536.388) [-543.733] (-537.185) (-535.036) -- 0:00:05
954500 -- (-536.356) [-536.976] (-532.540) (-543.169) * (-540.168) (-546.080) (-537.518) [-537.317] -- 0:00:05
955000 -- [-534.876] (-541.929) (-541.816) (-543.662) * (-539.789) (-540.518) [-541.568] (-533.783) -- 0:00:05
Average standard deviation of split frequencies: 0.004438
955500 -- (-536.934) (-535.541) (-536.221) [-540.917] * (-544.214) (-537.076) [-535.000] (-538.931) -- 0:00:05
956000 -- (-534.876) (-542.568) (-535.897) [-533.843] * [-540.302] (-538.460) (-542.029) (-541.435) -- 0:00:05
956500 -- [-536.657] (-541.389) (-532.406) (-543.092) * [-536.562] (-536.966) (-540.528) (-544.686) -- 0:00:05
957000 -- (-539.260) (-544.105) [-542.435] (-540.935) * (-540.920) (-536.971) [-539.264] (-539.870) -- 0:00:04
957500 -- [-533.901] (-542.359) (-538.651) (-542.173) * (-534.900) [-537.110] (-541.593) (-536.947) -- 0:00:04
958000 -- (-543.878) (-537.013) [-537.076] (-537.728) * [-535.952] (-538.169) (-539.047) (-541.578) -- 0:00:04
958500 -- (-545.193) [-536.791] (-534.585) (-535.828) * (-535.045) (-534.443) [-538.097] (-544.328) -- 0:00:04
959000 -- (-538.263) (-536.324) [-536.022] (-531.893) * (-539.490) (-537.448) (-541.024) [-536.760] -- 0:00:04
959500 -- (-537.095) (-545.497) [-531.419] (-538.489) * (-531.921) (-544.353) (-535.892) [-531.294] -- 0:00:04
960000 -- (-544.285) [-533.444] (-538.493) (-536.849) * (-538.272) [-538.263] (-536.711) (-541.018) -- 0:00:04
Average standard deviation of split frequencies: 0.004171
960500 -- (-541.058) (-537.849) (-547.371) [-535.232] * (-541.110) (-533.013) [-537.730] (-536.442) -- 0:00:04
961000 -- (-539.597) (-536.056) (-551.260) [-531.635] * (-544.925) [-536.215] (-534.982) (-539.878) -- 0:00:04
961500 -- (-545.101) [-540.037] (-547.025) (-533.519) * (-540.115) (-536.643) [-542.708] (-537.942) -- 0:00:04
962000 -- (-536.797) [-534.138] (-542.108) (-533.954) * (-546.270) (-538.165) [-537.539] (-539.579) -- 0:00:04
962500 -- [-535.081] (-537.248) (-539.604) (-533.339) * (-544.429) (-537.820) [-536.778] (-539.174) -- 0:00:04
963000 -- (-536.500) [-533.816] (-538.682) (-537.382) * (-544.381) (-534.713) (-540.319) [-538.762] -- 0:00:04
963500 -- [-532.490] (-534.274) (-537.293) (-536.148) * (-551.620) [-538.636] (-534.801) (-537.252) -- 0:00:04
964000 -- [-537.811] (-535.704) (-540.579) (-543.691) * [-540.225] (-540.779) (-542.502) (-537.562) -- 0:00:04
964500 -- (-542.417) [-537.459] (-542.180) (-537.237) * (-536.589) [-533.800] (-533.232) (-540.979) -- 0:00:04
965000 -- (-551.257) (-536.324) (-535.427) [-539.811] * (-538.294) (-537.945) [-537.737] (-544.390) -- 0:00:04
Average standard deviation of split frequencies: 0.004148
965500 -- [-542.833] (-540.375) (-532.316) (-542.978) * (-537.453) [-539.371] (-538.205) (-536.643) -- 0:00:03
966000 -- (-542.055) (-534.813) (-532.167) [-540.965] * (-533.975) [-536.971] (-540.411) (-539.355) -- 0:00:03
966500 -- (-534.296) (-542.863) [-534.838] (-543.938) * (-540.454) (-534.577) [-535.037] (-535.120) -- 0:00:03
967000 -- (-536.251) (-536.987) (-537.979) [-537.052] * (-542.661) (-535.062) (-534.776) [-537.958] -- 0:00:03
967500 -- (-531.011) (-531.595) (-538.984) [-533.702] * (-538.784) (-537.460) (-531.446) [-536.782] -- 0:00:03
968000 -- [-536.406] (-534.476) (-540.506) (-543.463) * (-537.749) (-535.065) [-541.055] (-534.812) -- 0:00:03
968500 -- (-540.241) [-540.110] (-535.413) (-536.268) * (-544.233) (-537.432) [-534.959] (-536.732) -- 0:00:03
969000 -- (-534.628) (-539.682) [-533.330] (-539.813) * [-536.585] (-535.493) (-538.292) (-540.528) -- 0:00:03
969500 -- (-538.753) (-536.274) (-535.646) [-535.792] * [-536.314] (-536.274) (-533.070) (-550.375) -- 0:00:03
970000 -- (-537.645) (-537.814) [-534.514] (-541.224) * (-533.659) (-537.239) (-539.532) [-546.098] -- 0:00:03
Average standard deviation of split frequencies: 0.004128
970500 -- [-536.649] (-546.577) (-538.446) (-540.179) * (-536.324) [-538.599] (-546.636) (-543.573) -- 0:00:03
971000 -- [-538.924] (-532.555) (-546.323) (-539.355) * (-543.901) (-536.023) (-540.578) [-543.583] -- 0:00:03
971500 -- (-537.422) (-539.876) (-540.911) [-536.257] * [-539.067] (-538.422) (-536.862) (-543.393) -- 0:00:03
972000 -- (-535.244) (-536.548) (-549.038) [-538.296] * (-539.422) (-535.570) (-535.478) [-535.874] -- 0:00:03
972500 -- (-541.631) (-543.476) (-537.381) [-540.965] * (-544.190) (-535.157) (-536.203) [-536.889] -- 0:00:03
973000 -- (-539.293) (-538.159) (-539.683) [-537.309] * (-547.885) [-532.153] (-534.481) (-550.461) -- 0:00:03
973500 -- (-548.389) (-538.673) (-543.714) [-538.116] * (-538.884) [-538.612] (-535.986) (-539.220) -- 0:00:03
974000 -- (-542.272) (-536.587) [-541.228] (-542.030) * (-541.131) (-531.975) (-537.529) [-538.974] -- 0:00:02
974500 -- [-535.285] (-538.146) (-548.294) (-535.019) * (-538.223) (-535.886) (-535.361) [-538.638] -- 0:00:02
975000 -- (-533.444) (-541.006) [-539.634] (-542.447) * [-538.043] (-541.305) (-541.619) (-543.088) -- 0:00:02
Average standard deviation of split frequencies: 0.003381
975500 -- [-536.614] (-542.879) (-537.583) (-538.798) * (-540.751) (-534.322) (-534.102) [-536.944] -- 0:00:02
976000 -- [-537.691] (-536.559) (-533.768) (-539.436) * [-533.735] (-534.874) (-538.854) (-533.578) -- 0:00:02
976500 -- (-548.299) (-541.408) (-534.887) [-531.100] * (-540.662) (-533.944) [-539.812] (-537.969) -- 0:00:02
977000 -- (-540.488) (-544.354) [-534.531] (-536.837) * (-534.800) (-536.440) [-540.022] (-536.777) -- 0:00:02
977500 -- (-543.010) [-536.398] (-533.650) (-536.217) * (-533.588) [-538.658] (-544.719) (-538.984) -- 0:00:02
978000 -- (-543.373) (-540.928) (-542.816) [-539.214] * (-541.089) [-535.760] (-536.690) (-534.200) -- 0:00:02
978500 -- [-542.984] (-532.588) (-535.942) (-537.100) * [-540.796] (-532.452) (-535.005) (-539.198) -- 0:00:02
979000 -- [-543.081] (-543.410) (-536.228) (-540.760) * (-542.117) [-540.410] (-534.260) (-533.764) -- 0:00:02
979500 -- [-540.492] (-535.612) (-540.373) (-543.665) * (-535.592) [-534.943] (-538.247) (-538.402) -- 0:00:02
980000 -- (-538.804) (-545.151) (-545.594) [-537.131] * [-532.054] (-544.946) (-539.937) (-545.034) -- 0:00:02
Average standard deviation of split frequencies: 0.003846
980500 -- (-548.221) (-540.941) (-530.637) [-536.395] * (-537.557) (-541.514) [-535.184] (-533.482) -- 0:00:02
981000 -- (-535.821) (-539.204) [-534.912] (-541.390) * (-538.726) (-535.685) [-535.091] (-538.618) -- 0:00:02
981500 -- (-536.482) [-536.166] (-540.156) (-538.959) * (-534.702) (-532.259) [-538.556] (-543.397) -- 0:00:02
982000 -- (-540.796) (-536.134) (-535.263) [-534.095] * [-536.592] (-540.578) (-533.855) (-540.912) -- 0:00:02
982500 -- [-538.567] (-536.316) (-539.414) (-534.283) * [-537.406] (-536.562) (-541.149) (-537.337) -- 0:00:02
983000 -- (-542.960) (-540.372) [-535.431] (-534.292) * (-534.611) (-538.846) [-537.464] (-543.113) -- 0:00:01
983500 -- (-538.241) (-538.907) (-534.445) [-536.251] * (-539.928) [-537.264] (-541.145) (-540.092) -- 0:00:01
984000 -- [-537.708] (-533.667) (-532.426) (-535.547) * (-535.155) (-537.500) [-533.507] (-540.776) -- 0:00:01
984500 -- (-544.792) (-536.288) (-534.351) [-534.939] * (-542.518) [-536.036] (-536.651) (-540.300) -- 0:00:01
985000 -- (-535.419) [-539.066] (-540.601) (-534.730) * (-542.199) (-537.094) (-535.307) [-539.786] -- 0:00:01
Average standard deviation of split frequencies: 0.003586
985500 -- (-534.782) (-543.486) (-536.372) [-532.990] * (-543.907) (-530.388) [-537.745] (-540.640) -- 0:00:01
986000 -- (-536.037) [-538.588] (-540.522) (-539.335) * (-543.264) (-541.094) [-538.556] (-538.431) -- 0:00:01
986500 -- (-532.724) (-542.084) (-535.493) [-534.626] * (-541.205) (-535.491) (-549.547) [-534.256] -- 0:00:01
987000 -- (-532.030) (-541.978) (-531.737) [-535.440] * (-539.131) (-536.293) (-539.978) [-536.783] -- 0:00:01
987500 -- (-534.387) (-544.294) (-539.287) [-533.726] * (-539.445) (-537.660) (-539.366) [-534.080] -- 0:00:01
988000 -- (-536.076) (-538.497) [-536.202] (-539.694) * [-535.103] (-541.205) (-541.376) (-532.744) -- 0:00:01
988500 -- (-533.497) (-535.044) (-537.951) [-532.534] * (-537.476) (-542.305) (-540.938) [-535.873] -- 0:00:01
989000 -- (-540.865) [-534.879] (-542.678) (-535.906) * (-546.438) (-538.463) (-543.591) [-532.485] -- 0:00:01
989500 -- (-540.893) [-534.928] (-536.596) (-536.518) * (-533.553) (-541.468) (-542.940) [-541.597] -- 0:00:01
990000 -- (-536.516) [-530.771] (-530.621) (-543.028) * (-532.759) (-541.569) (-537.573) [-537.707] -- 0:00:01
Average standard deviation of split frequencies: 0.003331
990500 -- (-539.828) (-537.779) (-535.514) [-537.179] * (-536.292) (-534.709) (-532.965) [-536.213] -- 0:00:01
991000 -- (-542.601) (-536.746) (-537.621) [-533.102] * (-538.225) (-544.333) (-541.291) [-541.751] -- 0:00:01
991500 -- (-535.388) [-537.954] (-537.455) (-535.393) * (-535.241) [-535.772] (-538.267) (-536.755) -- 0:00:00
992000 -- [-532.754] (-537.756) (-538.285) (-532.439) * [-538.106] (-537.549) (-536.489) (-541.401) -- 0:00:00
992500 -- [-533.112] (-542.576) (-542.990) (-534.098) * (-540.859) (-535.044) [-536.053] (-538.411) -- 0:00:00
993000 -- [-537.530] (-532.727) (-531.369) (-536.305) * (-536.257) (-535.996) [-536.028] (-539.483) -- 0:00:00
993500 -- (-535.627) [-538.861] (-537.308) (-539.689) * (-534.811) (-543.472) [-536.809] (-541.755) -- 0:00:00
994000 -- (-532.942) (-539.606) [-537.918] (-541.723) * [-534.014] (-547.699) (-536.788) (-536.449) -- 0:00:00
994500 -- (-537.307) (-551.255) (-537.220) [-535.269] * (-533.896) (-539.799) (-537.676) [-543.137] -- 0:00:00
995000 -- (-537.180) [-539.612] (-536.768) (-535.711) * (-544.692) [-537.031] (-536.784) (-534.429) -- 0:00:00
Average standard deviation of split frequencies: 0.002840
995500 -- (-536.521) [-536.041] (-538.433) (-539.194) * [-536.446] (-543.654) (-534.805) (-540.826) -- 0:00:00
996000 -- (-539.550) (-535.464) [-532.837] (-538.516) * [-535.484] (-539.722) (-538.879) (-543.605) -- 0:00:00
996500 -- (-537.934) (-541.272) [-537.915] (-538.206) * (-538.199) (-537.439) [-532.915] (-544.067) -- 0:00:00
997000 -- [-532.222] (-534.510) (-540.092) (-545.679) * (-536.576) [-538.950] (-536.761) (-541.051) -- 0:00:00
997500 -- (-535.545) (-531.297) [-532.996] (-543.166) * (-539.556) [-533.295] (-538.021) (-535.598) -- 0:00:00
998000 -- (-533.793) (-538.168) [-537.815] (-535.715) * (-542.322) [-533.476] (-541.746) (-533.137) -- 0:00:00
998500 -- (-544.793) (-538.437) [-535.056] (-532.162) * (-543.659) (-535.967) [-537.013] (-544.904) -- 0:00:00
999000 -- [-533.835] (-537.357) (-543.038) (-542.224) * (-539.099) (-534.041) (-537.599) [-534.001] -- 0:00:00
999500 -- (-535.901) [-536.852] (-536.521) (-535.672) * (-543.737) (-534.175) (-539.554) [-539.002] -- 0:00:00
1000000 -- (-542.891) (-541.222) [-534.246] (-537.735) * (-542.667) (-535.583) [-541.376] (-541.649) -- 0:00:00
Average standard deviation of split frequencies: 0.003062
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -542.890502 -- 16.735480
Chain 1 -- -542.890502 -- 16.735480
Chain 2 -- -541.221980 -- 17.026383
Chain 2 -- -541.221980 -- 17.026383
Chain 3 -- -534.246304 -- 14.745340
Chain 3 -- -534.246304 -- 14.745340
Chain 4 -- -537.735139 -- 16.230365
Chain 4 -- -537.735139 -- 16.230365
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -542.667023 -- 7.353651
Chain 1 -- -542.667023 -- 7.353651
Chain 2 -- -535.583060 -- 16.489545
Chain 2 -- -535.583060 -- 16.489545
Chain 3 -- -541.376382 -- 15.965095
Chain 3 -- -541.376382 -- 15.965095
Chain 4 -- -541.648948 -- 16.508817
Chain 4 -- -541.648948 -- 16.508817
Analysis completed in 1 mins 55 seconds
Analysis used 115.34 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -527.87
Likelihood of best state for "cold" chain of run 2 was -527.87
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
70.5 % ( 61 %) Dirichlet(Revmat{all})
88.3 % ( 80 %) Slider(Revmat{all})
37.7 % ( 23 %) Dirichlet(Pi{all})
37.5 % ( 31 %) Slider(Pi{all})
68.1 % ( 42 %) Multiplier(Alpha{1,2})
55.8 % ( 28 %) Multiplier(Alpha{3})
57.9 % ( 48 %) Slider(Pinvar{all})
4.6 % ( 7 %) ExtSPR(Tau{all},V{all})
4.5 % ( 4 %) ExtTBR(Tau{all},V{all})
4.6 % ( 3 %) NNI(Tau{all},V{all})
5.0 % ( 5 %) ParsSPR(Tau{all},V{all})
27.5 % ( 31 %) Multiplier(V{all})
45.7 % ( 44 %) Nodeslider(V{all})
29.8 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
70.5 % ( 60 %) Dirichlet(Revmat{all})
87.6 % ( 81 %) Slider(Revmat{all})
37.8 % ( 24 %) Dirichlet(Pi{all})
36.7 % ( 28 %) Slider(Pi{all})
68.9 % ( 47 %) Multiplier(Alpha{1,2})
56.3 % ( 28 %) Multiplier(Alpha{3})
58.7 % ( 35 %) Slider(Pinvar{all})
4.7 % ( 6 %) ExtSPR(Tau{all},V{all})
4.6 % ( 3 %) ExtTBR(Tau{all},V{all})
4.7 % ( 4 %) NNI(Tau{all},V{all})
5.4 % ( 6 %) ParsSPR(Tau{all},V{all})
27.4 % ( 27 %) Multiplier(V{all})
45.7 % ( 50 %) Nodeslider(V{all})
29.6 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.49
2 | 166894 0.82 0.66
3 | 166342 166062 0.83
4 | 166469 166832 167401
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.63 0.49
2 | 166757 0.82 0.66
3 | 166751 166952 0.83
4 | 166618 166144 166778
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -535.19
| 1 1 1 1|
|1 2 1 1 1 |
| 2 2 22 21 |
| 1 2 1 2 11 2 1 1 |
| 2 * 2 2 2 1 2 12 2211 12 2|
| 111 * * 1 22 22 1 2 2 2* 2 2 1 |
| 1 1 2 22 1 11 1 1 11 121 2 1*2 12 |
| 2 1 21 2 1 12 21 2 2 |
|2 2 1 22 2 2 1 11 2 1 |
| 2 1 1 2 |
| 2 1 2 1 2 |
| 1 |
| |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -539.68
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.67 -544.69
2 -533.85 -547.86
--------------------------------------
TOTAL -533.76 -547.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.338529 0.022736 0.084209 0.628346 0.312298 714.73 903.46 1.000
r(A<->C){all} 0.096544 0.005122 0.000118 0.235020 0.079067 435.09 480.13 1.000
r(A<->G){all} 0.431210 0.020094 0.168960 0.700296 0.429661 187.62 303.30 1.004
r(A<->T){all} 0.079932 0.003606 0.000083 0.193898 0.066785 443.47 545.21 1.000
r(C<->G){all} 0.056981 0.003307 0.000032 0.173778 0.039717 432.18 511.45 1.002
r(C<->T){all} 0.211053 0.013148 0.011808 0.433601 0.194551 169.46 266.28 1.011
r(G<->T){all} 0.124280 0.006773 0.001521 0.282328 0.108516 313.28 397.50 1.000
pi(A){all} 0.345884 0.000675 0.293378 0.395541 0.345833 1244.96 1269.36 1.000
pi(C){all} 0.149426 0.000409 0.111153 0.188664 0.148740 1047.02 1156.91 1.000
pi(G){all} 0.236982 0.000531 0.190244 0.280612 0.236830 1163.39 1228.74 1.000
pi(T){all} 0.267708 0.000609 0.220603 0.316854 0.267350 1126.91 1253.70 1.000
alpha{1,2} 0.068074 0.007552 0.000133 0.173050 0.051494 892.00 1018.85 1.001
alpha{3} 1.339010 0.493600 0.320151 2.782082 1.214454 1141.69 1314.97 1.000
pinvar{all} 0.714722 0.014450 0.483432 0.876275 0.740931 696.61 772.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3000 0.999334 0.000000 0.999334 0.999334 2
7 2797 0.931712 0.006124 0.927382 0.936043 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.035248 0.000943 0.000042 0.092980 0.027270 1.000 2
length{all}[2] 0.006243 0.000043 0.000001 0.018957 0.004182 1.000 2
length{all}[3] 0.006590 0.000057 0.000003 0.021472 0.004134 1.001 2
length{all}[4] 0.042201 0.001466 0.000000 0.120153 0.031983 1.001 2
length{all}[5] 0.070369 0.002477 0.001880 0.164000 0.059072 1.000 2
length{all}[6] 0.142077 0.008516 0.013429 0.314435 0.121634 1.000 2
length{all}[7] 0.037876 0.001072 0.000033 0.100506 0.028501 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.003062
Maximum standard deviation of split frequencies = 0.006124
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------93----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/----------- C1 (1)
|
| /------------- C4 (4)
|-----------------------------------------------+
+ \------------------------ C5 (5)
|
| /-- C2 (2)
\----------+
\-- C3 (3)
|------------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (5 trees sampled):
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 300
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
58 patterns at 100 / 100 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
56608 bytes for conP
7888 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 21
84912 bytes for conP, adjusted
0.020836 0.085441 0.042497 0.055975 0.030758 0.000001 0.000000 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -539.770471
Iterating by ming2
Initial: fx= 539.770471
x= 0.02084 0.08544 0.04250 0.05598 0.03076 0.00000 0.00000 0.30000 1.30000
1 h-m-p 0.0000 0.0000 146.5803 ++ 539.770299 m 0.0000 14 | 2/9
2 h-m-p 0.0000 0.0047 159.2535 +++YCCCC 537.362431 4 0.0012 36 | 2/9
3 h-m-p 0.0008 0.0040 106.9220 YCCCC 534.776709 4 0.0019 55 | 2/9
4 h-m-p 0.0007 0.0037 107.9396 CYCCC 534.237110 4 0.0005 75 | 2/9
5 h-m-p 0.0025 0.0528 21.2874 +++ 509.129584 m 0.0528 88 | 2/9
6 h-m-p 0.0167 0.0837 2.4042 CYYYYYYC 506.313952 7 0.0039 109 | 2/9
7 h-m-p 0.0002 0.0048 48.8510 ++CYYCCC 499.801359 5 0.0038 131 | 2/9
8 h-m-p 0.0058 0.0289 3.6763 CCC 499.785431 2 0.0019 147 | 2/9
9 h-m-p 0.1396 1.8057 0.0511 +YCYYCCC 496.951945 6 1.3267 170 | 2/9
10 h-m-p 0.2092 1.0460 0.0985 CYCCC 496.610628 4 0.3028 196 | 2/9
11 h-m-p 0.2408 2.0132 0.1239 YCCCC 495.984337 4 0.6133 222 | 2/9
12 h-m-p 0.6859 8.0000 0.1108 +CCCC 495.251617 3 2.7284 248 | 2/9
13 h-m-p 1.1227 5.6133 0.1959 CYC 494.768148 2 1.1600 270 | 2/9
14 h-m-p 0.9460 4.7301 0.1793 YYYC 494.553824 3 0.8893 292 | 2/9
15 h-m-p 1.2715 8.0000 0.1254 CCC 494.426757 2 1.4600 315 | 2/9
16 h-m-p 1.6000 8.0000 0.0836 CCC 494.392824 2 1.3871 338 | 2/9
17 h-m-p 1.6000 8.0000 0.0531 CC 494.381669 1 1.4376 359 | 2/9
18 h-m-p 1.6000 8.0000 0.0162 +YC 494.365825 1 5.2886 380 | 2/9
19 h-m-p 1.6000 8.0000 0.0076 ++ 494.285351 m 8.0000 399 | 2/9
20 h-m-p 0.8635 8.0000 0.0700 +YCCC 494.199175 3 2.4501 424 | 2/9
21 h-m-p 1.6000 8.0000 0.0856 YCC 494.190123 2 1.0826 446 | 2/9
22 h-m-p 1.6000 8.0000 0.0045 CC 494.189819 1 1.3903 467 | 2/9
23 h-m-p 1.6000 8.0000 0.0007 Y 494.189804 0 1.2527 486 | 2/9
24 h-m-p 1.6000 8.0000 0.0001 Y 494.189804 0 1.0368 505 | 2/9
25 h-m-p 1.6000 8.0000 0.0000 Y 494.189804 0 0.8595 524 | 2/9
26 h-m-p 1.6000 8.0000 0.0000 --Y 494.189804 0 0.0464 545 | 2/9
27 h-m-p 0.0269 8.0000 0.0000 -------------Y 494.189804 0 0.0000 577
Out..
lnL = -494.189804
578 lfun, 578 eigenQcodon, 4046 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 21
0.020837 0.085441 0.042497 0.055976 0.030758 0.000001 0.000000 1.843762 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.864443
np = 10
lnL0 = -517.770267
Iterating by ming2
Initial: fx= 517.770267
x= 0.02084 0.08544 0.04250 0.05598 0.03076 0.00000 0.00000 1.84376 0.57321 0.49224
1 h-m-p 0.0000 0.0000 139.4615 ++ 517.770107 m 0.0000 15 | 2/10
2 h-m-p 0.0000 0.0026 43.5354 +++YCYCCCC 517.408842 6 0.0009 41 | 2/10
3 h-m-p 0.0003 0.0039 146.7991 ++ 501.746596 m 0.0039 54 | 3/10
4 h-m-p 0.0001 0.0007 104.9503 CYCCC 501.641530 4 0.0002 74 | 3/10
5 h-m-p 0.0003 0.0016 40.1201 CYCCC 501.509530 4 0.0007 94 | 3/10
6 h-m-p 0.0231 2.9688 1.1663 -------------.. | 3/10
7 h-m-p 0.0000 0.0005 244.1617 ++CCYCC 498.669901 4 0.0002 140 | 3/10
8 h-m-p 0.0001 0.0004 90.0975 +YYYCCC 497.169142 5 0.0003 161 | 3/10
9 h-m-p 0.0001 0.0003 216.9883 +YCYCCC 495.502674 5 0.0002 183 | 3/10
10 h-m-p 0.0001 0.0004 201.1258 CYCCC 494.607817 4 0.0002 203 | 3/10
11 h-m-p 0.0014 0.0072 10.0831 YCC 494.572588 2 0.0007 219 | 3/10
12 h-m-p 0.0094 0.1840 0.7525 YC 494.571830 1 0.0017 233 | 3/10
13 h-m-p 0.0126 6.3148 0.1760 +++YCCC 494.382669 3 0.6445 261 | 3/10
14 h-m-p 1.3071 6.5354 0.0119 CCCCC 494.205640 4 1.5539 289 | 3/10
15 h-m-p 0.3435 8.0000 0.0537 +C 494.192999 0 1.3894 310 | 3/10
16 h-m-p 1.6000 8.0000 0.0350 YC 494.190194 1 1.0862 331 | 3/10
17 h-m-p 1.6000 8.0000 0.0016 C 494.189927 0 1.4972 351 | 3/10
18 h-m-p 1.6000 8.0000 0.0006 C 494.189903 0 1.3510 371 | 3/10
19 h-m-p 1.6000 8.0000 0.0002 Y 494.189903 0 0.8366 391 | 3/10
20 h-m-p 1.6000 8.0000 0.0000 Y 494.189903 0 0.9463 411 | 3/10
21 h-m-p 1.6000 8.0000 0.0000 C 494.189903 0 0.4000 431 | 3/10
22 h-m-p 0.6967 8.0000 0.0000 --C 494.189903 0 0.0109 453
Out..
lnL = -494.189903
454 lfun, 1362 eigenQcodon, 6356 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 21
initial w for M2:NSpselection reset.
0.020837 0.085440 0.042498 0.055976 0.030759 0.000001 0.000000 1.843781 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.540059
np = 12
lnL0 = -522.119265
Iterating by ming2
Initial: fx= 522.119265
x= 0.02084 0.08544 0.04250 0.05598 0.03076 0.00000 0.00000 1.84378 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0000 130.5675 ++ 522.119116 m 0.0000 17 | 2/12
2 h-m-p 0.0000 0.0051 30.2145 +++YCCCC 521.828766 4 0.0014 42 | 2/12
3 h-m-p 0.0004 0.0026 94.3941 CCCCC 521.443358 4 0.0007 65 | 2/12
4 h-m-p 0.0004 0.0027 162.2659 ++ 516.941329 m 0.0027 80 | 3/12
5 h-m-p 0.0003 0.0015 126.6559 YYCC 516.881698 3 0.0002 99 | 3/12
6 h-m-p 0.0020 0.0747 14.1960 ++CYCCCC 514.647201 5 0.0436 125 | 3/12
7 h-m-p 0.0001 0.0007 504.2323 CYCCC 514.293535 4 0.0002 147 | 3/12
8 h-m-p 0.0193 0.2186 5.7114 ++ 507.010519 m 0.2186 162 | 4/12
9 h-m-p 0.2937 3.0146 3.0768 +CYCCCC 498.741977 5 0.9125 187 | 4/12
10 h-m-p 0.9128 4.5638 0.3865 YCCCC 495.751252 4 1.8105 209 | 3/12
11 h-m-p 0.0549 0.2744 3.7875 ---CC 495.749867 1 0.0002 237 | 3/12
12 h-m-p 0.0015 0.7313 0.9569 +++++ 494.807707 m 0.7313 255 | 4/12
13 h-m-p 0.5581 2.7903 0.9116 CCCCC 494.528824 4 0.7740 287 | 4/12
14 h-m-p 1.6000 8.0000 0.0874 YCCC 494.430602 3 2.8668 315 | 3/12
15 h-m-p 0.0007 0.0059 341.8697 CYC 494.412620 2 0.0001 341 | 3/12
16 h-m-p 0.5134 8.0000 0.0915 +YC 494.329330 1 3.7371 358 | 3/12
17 h-m-p 1.6000 8.0000 0.1394 CC 494.310029 1 1.6000 384 | 3/12
18 h-m-p 1.6000 8.0000 0.1339 YCC 494.283268 2 2.7123 411 | 3/12
19 h-m-p 1.6000 8.0000 0.1126 YC 494.266128 1 2.6781 436 | 3/12
20 h-m-p 1.6000 8.0000 0.1219 +YC 494.233531 1 4.2877 462 | 3/12
21 h-m-p 1.6000 8.0000 0.2911 CC 494.221891 1 1.4858 488 | 3/12
22 h-m-p 1.6000 8.0000 0.1622 CC 494.209022 1 1.9604 514 | 3/12
23 h-m-p 0.8740 8.0000 0.3638 +YC 494.199118 1 2.4239 540 | 3/12
24 h-m-p 1.6000 8.0000 0.2217 CC 494.195318 1 2.0144 566 | 3/12
25 h-m-p 1.4083 8.0000 0.3171 YC 494.193044 1 2.4936 591 | 3/12
26 h-m-p 1.6000 8.0000 0.2247 CC 494.191691 1 2.2542 617 | 3/12
27 h-m-p 1.6000 8.0000 0.3005 YC 494.190608 1 3.0714 642 | 3/12
28 h-m-p 1.6000 8.0000 0.2777 CC 494.190162 1 2.1037 668 | 3/12
29 h-m-p 1.6000 8.0000 0.2486 YC 494.189992 1 3.3344 693 | 3/12
30 h-m-p 1.6000 8.0000 0.3134 YC 494.189877 1 2.7493 718 | 3/12
31 h-m-p 1.6000 8.0000 0.3614 YC 494.189833 1 2.8695 743 | 3/12
32 h-m-p 1.6000 8.0000 0.3763 C 494.189816 0 2.4179 767 | 3/12
33 h-m-p 1.6000 8.0000 0.3533 Y 494.189809 0 2.7213 791 | 3/12
34 h-m-p 1.6000 8.0000 0.3708 C 494.189806 0 2.5065 815 | 3/12
35 h-m-p 1.6000 8.0000 0.3674 Y 494.189805 0 2.6082 839 | 3/12
36 h-m-p 1.6000 8.0000 0.3693 C 494.189805 0 2.5290 863 | 3/12
37 h-m-p 1.6000 8.0000 0.3689 Y 494.189804 0 2.5952 887 | 3/12
38 h-m-p 1.6000 8.0000 0.3708 C 494.189804 0 2.5404 911 | 3/12
39 h-m-p 1.6000 8.0000 0.3698 Y 494.189804 0 2.5791 935 | 3/12
40 h-m-p 1.6000 8.0000 0.3740 Y 494.189804 0 2.5694 959 | 3/12
41 h-m-p 1.6000 8.0000 0.3684 C 494.189804 0 2.5231 983 | 3/12
42 h-m-p 1.6000 8.0000 0.3776 Y 494.189804 0 2.6652 1007 | 3/12
43 h-m-p 1.6000 8.0000 0.3032 C 494.189804 0 2.1478 1031 | 3/12
44 h-m-p 1.6000 8.0000 0.4015 +Y 494.189804 0 4.0122 1056 | 3/12
45 h-m-p 1.6000 8.0000 0.4357 C 494.189804 0 1.7792 1080 | 3/12
46 h-m-p 1.6000 8.0000 0.2242 Y 494.189804 0 2.6421 1104 | 3/12
47 h-m-p 1.6000 8.0000 0.0427 Y 494.189804 0 0.7336 1128 | 3/12
48 h-m-p 0.0194 8.0000 1.6117 -Y 494.189804 0 0.0012 1153 | 3/12
49 h-m-p 0.0160 8.0000 5.2927 -----C 494.189804 0 0.0000 1173 | 3/12
50 h-m-p 0.0160 8.0000 0.1773 -------------.. | 3/12
51 h-m-p 0.0160 8.0000 0.0000 ------------- | 3/12
52 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -494.189804
1270 lfun, 5080 eigenQcodon, 26670 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -507.265977 S = -493.505899 -5.971566
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:11
did 20 / 58 patterns 0:11
did 30 / 58 patterns 0:11
did 40 / 58 patterns 0:11
did 50 / 58 patterns 0:11
did 58 / 58 patterns 0:11
Time used: 0:11
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 21
0.020838 0.085439 0.042497 0.055975 0.030759 0.000000 0.000002 1.843762 0.331355 0.382499 0.005901 0.014732 0.024667
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 20.316296
np = 13
lnL0 = -494.225542
Iterating by ming2
Initial: fx= 494.225542
x= 0.02084 0.08544 0.04250 0.05597 0.03076 0.00000 0.00000 1.84376 0.33136 0.38250 0.00590 0.01473 0.02467
1 h-m-p 0.0000 0.0000 73.5796 ++ 494.225389 m 0.0000 31 | 2/13
2 h-m-p 0.0000 0.0028 5.0509 ++YC 494.221145 1 0.0004 63 | 2/13
3 h-m-p 0.0011 0.0221 1.7055 CC 494.220652 1 0.0004 92 | 2/13
4 h-m-p 0.0014 0.3078 0.4645 CC 494.220505 1 0.0011 121 | 2/13
5 h-m-p 0.0016 0.1160 0.3289 +CC 494.219844 1 0.0079 151 | 2/13
6 h-m-p 0.0011 0.0141 2.3039 ++ 494.210226 m 0.0141 178 | 3/13
7 h-m-p 0.0001 0.0007 49.1703 YCC 494.207455 2 0.0001 208 | 3/13
8 h-m-p 0.0091 0.0461 0.4500 ++ 494.202108 m 0.0461 234 | 4/13
9 h-m-p 0.0739 0.3696 0.1894 YC 494.201343 1 0.0140 261 | 3/13
10 h-m-p 0.0001 0.0018 37.5726 -C 494.201338 0 0.0000 287 | 3/13
11 h-m-p 0.0043 1.0708 0.0503 +++YC 494.197245 1 0.4662 317 | 2/13
12 h-m-p 0.0376 1.4469 0.6241 -C 494.197085 0 0.0022 344 | 2/13
13 h-m-p 0.0303 0.7071 0.0457 -------------C 494.197085 0 0.0000 384 | 2/13
14 h-m-p 0.0006 0.3216 0.0950 +++++ 494.195982 m 0.3216 414 | 3/13
15 h-m-p 0.5814 8.0000 0.0525 YC 494.194728 1 1.0121 442 | 3/13
16 h-m-p 1.6000 8.0000 0.0080 YC 494.193777 1 1.1005 469 | 2/13
17 h-m-p 0.0085 0.0642 1.0338 C 494.193494 0 0.0081 495 | 2/13
18 h-m-p 0.2194 1.0970 0.0168 ++ 494.192693 m 1.0970 522 | 3/13
19 h-m-p 0.2559 5.6214 0.0721 +YY 494.191412 1 0.9748 551 | 3/13
20 h-m-p 1.6000 8.0000 0.0052 C 494.191198 0 1.3581 577 | 2/13
21 h-m-p 0.0022 0.0336 3.2171 +YC 494.190872 1 0.0065 605 | 2/13
22 h-m-p 0.8112 8.0000 0.0258 +YC 494.190338 1 2.1815 634 | 2/13
23 h-m-p 1.4206 7.1028 0.0264 CC 494.190061 1 1.2330 663 | 2/13
24 h-m-p 0.9239 6.5387 0.0352 CC 494.189908 1 0.9741 692 | 2/13
25 h-m-p 1.6000 8.0000 0.0051 YC 494.189836 1 1.1323 720 | 2/13
26 h-m-p 0.9936 8.0000 0.0058 C 494.189817 0 1.5066 747 | 2/13
27 h-m-p 1.6000 8.0000 0.0023 Y 494.189815 0 0.9519 774 | 2/13
28 h-m-p 1.6000 8.0000 0.0005 +C 494.189811 0 5.8894 802 | 2/13
29 h-m-p 0.7641 8.0000 0.0035 +C 494.189804 0 3.2998 830 | 2/13
30 h-m-p 1.6000 8.0000 0.0010 Y 494.189804 0 1.0964 857 | 2/13
31 h-m-p 1.6000 8.0000 0.0000 Y 494.189804 0 1.1720 884 | 2/13
32 h-m-p 1.6000 8.0000 0.0000 Y 494.189804 0 0.2164 911 | 2/13
33 h-m-p 0.2898 8.0000 0.0000 ----Y 494.189804 0 0.0003 942
Out..
lnL = -494.189804
943 lfun, 3772 eigenQcodon, 19803 P(t)
Time used: 0:17
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 21
0.020836 0.085440 0.042497 0.055975 0.030758 0.000000 0.000001 1.843762 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.109597
np = 10
lnL0 = -506.459890
Iterating by ming2
Initial: fx= 506.459890
x= 0.02084 0.08544 0.04250 0.05598 0.03076 0.00000 0.00000 1.84376 0.66567 1.54913
1 h-m-p 0.0000 0.0000 73.2982 ++ 506.459737 m 0.0000 25 | 2/10
2 h-m-p 0.0000 0.0044 45.5852 +++YCCCC 505.980261 4 0.0014 58 | 2/10
3 h-m-p 0.0004 0.0022 154.2478 CYCCC 505.224373 4 0.0007 86 | 2/10
4 h-m-p 0.0003 0.0014 390.7517 +YYCYCYCCC 496.997310 8 0.0013 121 | 2/10
5 h-m-p 0.0013 0.0063 10.8379 CC 496.978102 1 0.0005 144 | 2/10
6 h-m-p 0.0022 1.0921 2.2808 ++YYCCC 496.702624 4 0.0591 173 | 2/10
7 h-m-p 0.0254 0.1271 4.2657 YCCCC 495.679579 4 0.0494 201 | 2/10
8 h-m-p 0.0005 0.0024 418.4520 CCCC 494.488816 3 0.0007 228 | 2/10
9 h-m-p 0.8902 8.0000 0.3310 CC 494.296508 1 0.8902 251 | 2/10
10 h-m-p 1.6000 8.0000 0.1663 YYC 494.230831 2 1.2942 274 | 2/10
11 h-m-p 1.6000 8.0000 0.1334 YCC 494.206027 2 1.0666 298 | 2/10
12 h-m-p 1.6000 8.0000 0.0142 CC 494.204889 1 1.4091 321 | 2/10
13 h-m-p 1.6000 8.0000 0.0023 C 494.204827 0 1.4273 342 | 2/10
14 h-m-p 1.6000 8.0000 0.0004 C 494.204824 0 2.1629 363 | 2/10
15 h-m-p 1.0221 8.0000 0.0008 ++ 494.204815 m 8.0000 384 | 2/10
16 h-m-p 0.3149 8.0000 0.0206 +YC 494.204769 1 2.9600 407 | 2/10
17 h-m-p 1.6000 8.0000 0.0319 ++ 494.204327 m 8.0000 428 | 2/10
18 h-m-p 0.0962 8.0000 2.6532 ++CYC 494.201469 2 1.4131 454 | 2/10
19 h-m-p 1.6000 8.0000 0.6244 +YC 494.198657 1 4.8079 477 | 2/10
20 h-m-p 1.6000 8.0000 1.4904 +YC 494.197088 1 4.9371 500 | 2/10
21 h-m-p 1.6000 8.0000 2.2799 CC 494.196234 1 2.2526 523 | 2/10
22 h-m-p 1.6000 8.0000 2.8428 +YC 494.195421 1 5.2658 546 | 2/10
23 h-m-p 1.6000 8.0000 4.4882 CC 494.195008 1 2.3394 569 | 2/10
24 h-m-p 1.6000 8.0000 5.6046 +YC 494.194658 1 4.6422 592 | 2/10
25 h-m-p 0.6592 3.2959 7.6386 +C 494.194495 0 2.3263 614 | 2/10
26 h-m-p 0.1664 0.8322 8.8992 ++ 494.194447 m 0.8322 635 | 3/10
27 h-m-p 0.0694 8.0000 1.4040 --------------.. | 3/10
28 h-m-p 0.0034 1.6971 0.1155 C 494.194441 0 0.0010 688 | 3/10
29 h-m-p 0.0010 0.5181 0.1337 C 494.194436 0 0.0009 708 | 3/10
30 h-m-p 0.0018 0.9172 0.2455 C 494.194422 0 0.0017 728 | 3/10
31 h-m-p 0.0020 0.9766 0.6969 +C 494.194249 0 0.0079 749 | 3/10
32 h-m-p 0.0005 0.1293 10.1753 +YC 494.192904 1 0.0043 771 | 3/10
33 h-m-p 0.0011 0.0332 38.3620 CC 494.191112 1 0.0015 793 | 3/10
34 h-m-p 1.6000 8.0000 0.0048 Y 494.191101 0 0.7809 813 | 3/10
35 h-m-p 1.6000 8.0000 0.0005 Y 494.191101 0 0.8830 833 | 3/10
36 h-m-p 1.6000 8.0000 0.0000 Y 494.191101 0 0.9412 853 | 3/10
37 h-m-p 1.6000 8.0000 0.0000 ---C 494.191101 0 0.0063 876
Out..
lnL = -494.191101
877 lfun, 9647 eigenQcodon, 61390 P(t)
Time used: 0:36
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 21
initial w for M8:NSbetaw>1 reset.
0.020837 0.085441 0.042497 0.055976 0.030758 0.000001 0.000000 1.843961 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.571239
np = 12
lnL0 = -508.472157
Iterating by ming2
Initial: fx= 508.472157
x= 0.02084 0.08544 0.04250 0.05598 0.03076 0.00000 0.00000 1.84396 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0000 86.4186 ++ 508.471964 m 0.0000 29 | 2/12
2 h-m-p 0.0000 0.0003 337.4765 +++ 503.002678 m 0.0003 57 | 3/12
3 h-m-p 0.0003 0.0031 126.2579 +CYYYCYCYCC 498.231960 10 0.0028 98 | 3/12
4 h-m-p 0.0001 0.0006 75.2709 CYCCCC 498.083768 5 0.0002 131 | 3/12
5 h-m-p 0.0042 0.2398 3.6101 +YCCC 497.825339 3 0.0325 161 | 2/12
6 h-m-p 0.0019 0.0094 38.7859 YCCC 497.676677 3 0.0010 190 | 2/12
7 h-m-p 0.0024 0.0191 16.9546 YCCC 497.545130 3 0.0050 220 | 2/12
8 h-m-p 0.0029 0.0147 21.3391 ++ 496.497310 m 0.0147 245 | 3/12
9 h-m-p 0.0009 0.0044 131.8691 CYCCC 496.114953 4 0.0015 277 | 3/12
10 h-m-p 0.0151 0.0756 8.8767 +YCCC 495.207259 3 0.0663 307 | 3/12
11 h-m-p 0.0284 0.1419 0.5350 ++ 494.903846 m 0.1419 331 | 4/12
12 h-m-p 0.0550 0.8547 0.3444 +YCYCCCC 494.363402 6 0.3407 366 | 4/12
13 h-m-p 0.4212 2.1061 0.2478 YCCC 494.243796 3 0.2860 394 | 4/12
14 h-m-p 0.5480 8.0000 0.1294 CC 494.211574 1 0.6129 419 | 4/12
15 h-m-p 1.6000 8.0000 0.0339 YC 494.207000 1 0.7720 443 | 4/12
16 h-m-p 1.6000 8.0000 0.0063 YC 494.205979 1 0.6882 467 | 4/12
17 h-m-p 0.9958 8.0000 0.0043 Y 494.205947 0 0.7371 490 | 4/12
18 h-m-p 1.6000 8.0000 0.0002 Y 494.205943 0 1.0527 513 | 4/12
19 h-m-p 0.2401 8.0000 0.0007 ++Y 494.205941 0 2.9763 538 | 4/12
20 h-m-p 1.1028 8.0000 0.0019 ++ 494.205912 m 8.0000 561 | 4/12
21 h-m-p 0.1104 8.0000 0.1412 ++YC 494.205551 1 2.9433 587 | 4/12
22 h-m-p 1.6000 8.0000 0.2228 ++ 494.202439 m 8.0000 610 | 4/12
23 h-m-p 0.3424 8.0000 5.2057 +YYC 494.197799 2 1.9799 636 | 4/12
24 h-m-p 1.6000 8.0000 1.1847 YC 494.197145 1 1.1090 660 | 4/12
25 h-m-p 1.1808 8.0000 1.1127 +YC 494.196759 1 3.8107 685 | 4/12
26 h-m-p 1.5485 8.0000 2.7382 +YC 494.196027 1 3.9335 710 | 4/12
27 h-m-p 1.6000 8.0000 3.7793 YC 494.195673 1 2.7486 734 | 4/12
28 h-m-p 1.6000 8.0000 4.8297 YC 494.195412 1 3.6651 758 | 4/12
29 h-m-p 1.3465 6.7327 5.9160 YC 494.195286 1 2.5618 782 | 4/12
30 h-m-p 0.7733 3.8666 6.3815 ++ 494.195205 m 3.8666 805 | 5/12
31 h-m-p 0.2805 8.0000 1.1691 ---------------.. | 5/12
32 h-m-p 0.0016 0.7942 0.1469 Y 494.195194 0 0.0010 863 | 5/12
33 h-m-p 0.0009 0.4331 0.1561 C 494.195189 0 0.0008 885 | 5/12
34 h-m-p 0.0023 1.1673 0.1810 Y 494.195179 0 0.0015 907 | 5/12
35 h-m-p 0.0025 1.2254 0.5840 +C 494.194968 0 0.0105 930 | 5/12
36 h-m-p 0.0005 0.1078 12.3022 ++CCC 494.191398 2 0.0083 958 | 5/12
37 h-m-p 0.0214 0.1099 4.7894 -YC 494.191268 1 0.0008 982 | 5/12
38 h-m-p 0.2824 8.0000 0.0136 +YC 494.191199 1 0.7473 1006 | 5/12
39 h-m-p 1.6000 8.0000 0.0004 Y 494.191199 0 0.9652 1028 | 5/12
40 h-m-p 1.6000 8.0000 0.0000 Y 494.191199 0 0.8964 1050 | 5/12
41 h-m-p 1.6000 8.0000 0.0000 -------C 494.191199 0 0.0000 1079
Out..
lnL = -494.191199
1080 lfun, 12960 eigenQcodon, 83160 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -508.263595 S = -493.505511 -7.640272
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 1:01
did 20 / 58 patterns 1:01
did 30 / 58 patterns 1:01
did 40 / 58 patterns 1:01
did 50 / 58 patterns 1:01
did 58 / 58 patterns 1:02
Time used: 1:02
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=100
D_melanogaster_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
D_sechellia_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
D_simulans_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
D_yakuba_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
D_erecta_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
**************************************************
D_melanogaster_Arl4-PC NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
D_sechellia_Arl4-PC NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
D_simulans_Arl4-PC NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
D_yakuba_Arl4-PC NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
D_erecta_Arl4-PC NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
*********************************************.****
>D_melanogaster_Arl4-PC ATGGGTGCTACAATGGTAAAACCGTTGGTAAAAAATGGAAATATTTTGGA TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACCCT TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG AAAAATTGAGACCACTTTGGAGAAGTTATACACGAAAGAATGGAAGAAGC >D_sechellia_Arl4-PC ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC >D_simulans_Arl4-PC ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC >D_yakuba_Arl4-PC ATGGGGGCTACGATGGTAAAACCTTTGGTAAAGAATGGAAATATTTTGGA TGCACTGCCATCACAGGCAACTCTGCATGTAGTTATGTTAGGTTTGGATT CTGCGGGAAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG AGAAATTAAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC >D_erecta_Arl4-PC ATGGGGGCTACAATGGTAAAACCTTTAGTAAAGAATGGAAATATTTTGGA TGCTTTGCCATCGCAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT CTGCGGGTAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG AAAAATTGAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
>D_melanogaster_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS >D_sechellia_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS >D_simulans_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS >D_yakuba_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS >D_erecta_Arl4-PC MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
#NEXUS
[ID: 1333697368]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_Arl4-PC
D_sechellia_Arl4-PC
D_simulans_Arl4-PC
D_yakuba_Arl4-PC
D_erecta_Arl4-PC
;
end;
begin trees;
translate
1 D_melanogaster_Arl4-PC,
2 D_sechellia_Arl4-PC,
3 D_simulans_Arl4-PC,
4 D_yakuba_Arl4-PC,
5 D_erecta_Arl4-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02727024,(4:0.03198346,5:0.05907249)0.999:0.121634,(2:0.004182471,3:0.00413366)0.932:0.02850064);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02727024,(4:0.03198346,5:0.05907249):0.121634,(2:0.004182471,3:0.00413366):0.02850064);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.67 -544.69
2 -533.85 -547.86
--------------------------------------
TOTAL -533.76 -547.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.338529 0.022736 0.084209 0.628346 0.312298 714.73 903.46 1.000
r(A<->C){all} 0.096544 0.005122 0.000118 0.235020 0.079067 435.09 480.13 1.000
r(A<->G){all} 0.431210 0.020094 0.168960 0.700296 0.429661 187.62 303.30 1.004
r(A<->T){all} 0.079932 0.003606 0.000083 0.193898 0.066785 443.47 545.21 1.000
r(C<->G){all} 0.056981 0.003307 0.000032 0.173778 0.039717 432.18 511.45 1.002
r(C<->T){all} 0.211053 0.013148 0.011808 0.433601 0.194551 169.46 266.28 1.011
r(G<->T){all} 0.124280 0.006773 0.001521 0.282328 0.108516 313.28 397.50 1.000
pi(A){all} 0.345884 0.000675 0.293378 0.395541 0.345833 1244.96 1269.36 1.000
pi(C){all} 0.149426 0.000409 0.111153 0.188664 0.148740 1047.02 1156.91 1.000
pi(G){all} 0.236982 0.000531 0.190244 0.280612 0.236830 1163.39 1228.74 1.000
pi(T){all} 0.267708 0.000609 0.220603 0.316854 0.267350 1126.91 1253.70 1.000
alpha{1,2} 0.068074 0.007552 0.000133 0.173050 0.051494 892.00 1018.85 1.001
alpha{3} 1.339010 0.493600 0.320151 2.782082 1.214454 1141.69 1314.97 1.000
pinvar{all} 0.714722 0.014450 0.483432 0.876275 0.740931 696.61 772.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/14/Arl4-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 100
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 | Ser TCT 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 | Cys TGT 2 2 2 1 1
TTC 0 0 0 0 0 | TCC 0 0 0 0 0 | TAC 2 2 2 2 2 | TGC 0 0 0 1 1
Leu TTA 3 3 3 4 4 | TCA 1 1 1 1 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 5 5 5 4 5 | TCG 0 0 0 0 1 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 | Pro CCT 0 1 1 1 1 | His CAT 2 2 2 2 2 | Arg CGT 0 0 0 0 0
CTC 0 0 0 0 0 | CCC 0 0 0 0 0 | CAC 0 0 0 0 0 | CGC 0 0 0 0 0
CTA 1 1 1 0 1 | CCA 3 3 3 3 3 | Gln CAA 3 2 2 2 2 | CGA 1 1 1 2 2
CTG 1 1 1 2 0 | CCG 1 0 0 0 0 | CAG 1 2 2 2 2 | CGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 | Thr ACT 2 2 2 2 2 | Asn AAT 4 4 4 4 4 | Ser AGT 1 1 1 1 1
ATC 0 0 0 0 0 | ACC 1 0 0 1 1 | AAC 1 1 1 1 1 | AGC 1 1 1 1 1
ATA 0 0 0 0 0 | ACA 4 5 5 3 4 | Lys AAA 6 6 6 5 5 | Arg AGA 4 4 4 3 3
Met ATG 3 3 3 3 3 | ACG 1 2 2 2 1 | AAG 3 2 2 4 4 | AGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 | Ala GCT 2 2 2 1 2 | Asp GAT 4 4 4 4 4 | Gly GGT 2 1 1 1 2
GTC 1 1 1 1 1 | GCC 0 0 0 0 0 | GAC 0 0 0 0 0 | GGC 1 1 1 1 1
GTA 4 4 4 4 4 | GCA 3 3 3 4 3 | Glu GAA 2 2 2 1 2 | GGA 7 7 7 7 6
GTG 1 1 1 1 1 | GCG 1 1 1 1 1 | GAG 0 0 0 1 0 | GGG 0 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Arl4-PC
position 1: T:0.20000 C:0.16000 A:0.33000 G:0.31000
position 2: T:0.30000 C:0.20000 A:0.29000 G:0.21000
position 3: T:0.32000 C:0.07000 A:0.42000 G:0.19000
Average T:0.27333 C:0.14333 A:0.34667 G:0.23667
#2: D_sechellia_Arl4-PC
position 1: T:0.20000 C:0.16000 A:0.33000 G:0.31000
position 2: T:0.30000 C:0.21000 A:0.28000 G:0.21000
position 3: T:0.32000 C:0.06000 A:0.42000 G:0.20000
Average T:0.27333 C:0.14333 A:0.34333 G:0.24000
#3: D_simulans_Arl4-PC
position 1: T:0.20000 C:0.16000 A:0.33000 G:0.31000
position 2: T:0.30000 C:0.21000 A:0.28000 G:0.21000
position 3: T:0.32000 C:0.06000 A:0.42000 G:0.20000
Average T:0.27333 C:0.14333 A:0.34333 G:0.24000
#4: D_yakuba_Arl4-PC
position 1: T:0.20000 C:0.17000 A:0.32000 G:0.31000
position 2: T:0.30000 C:0.20000 A:0.29000 G:0.21000
position 3: T:0.30000 C:0.08000 A:0.39000 G:0.23000
Average T:0.26667 C:0.15000 A:0.33333 G:0.25000
#5: D_erecta_Arl4-PC
position 1: T:0.21000 C:0.16000 A:0.32000 G:0.31000
position 2: T:0.30000 C:0.20000 A:0.29000 G:0.21000
position 3: T:0.32000 C:0.08000 A:0.39000 G:0.21000
Average T:0.27667 C:0.14667 A:0.33333 G:0.24333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 15 | Ser S TCT 5 | Tyr Y TAT 5 | Cys C TGT 8
TTC 0 | TCC 0 | TAC 10 | TGC 2
Leu L TTA 17 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 1 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 15 | Pro P CCT 4 | His H CAT 10 | Arg R CGT 0
CTC 0 | CCC 0 | CAC 0 | CGC 0
CTA 4 | CCA 15 | Gln Q CAA 11 | CGA 7
CTG 5 | CCG 1 | CAG 9 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 10 | Thr T ACT 10 | Asn N AAT 20 | Ser S AGT 5
ATC 0 | ACC 3 | AAC 5 | AGC 5
ATA 0 | ACA 21 | Lys K AAA 28 | Arg R AGA 18
Met M ATG 15 | ACG 8 | AAG 15 | AGG 0
------------------------------------------------------------------------------
Val V GTT 15 | Ala A GCT 9 | Asp D GAT 20 | Gly G GGT 7
GTC 5 | GCC 0 | GAC 0 | GGC 5
GTA 20 | GCA 16 | Glu E GAA 9 | GGA 34
GTG 5 | GCG 5 | GAG 1 | GGG 4
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.20200 C:0.16200 A:0.32600 G:0.31000
position 2: T:0.30000 C:0.20400 A:0.28600 G:0.21000
position 3: T:0.31600 C:0.07000 A:0.40800 G:0.20600
Average T:0.27267 C:0.14533 A:0.34000 G:0.24200
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Arl4-PC
D_sechellia_Arl4-PC 0.0759 (0.0044 0.0579)
D_simulans_Arl4-PC 0.0759 (0.0044 0.0579)-1.0000 (0.0000 0.0000)
D_yakuba_Arl4-PC -1.0000 (0.0000 0.2070) 0.0214 (0.0044 0.2060) 0.0214 (0.0044 0.2060)
D_erecta_Arl4-PC -1.0000 (0.0000 0.2271) 0.0195 (0.0044 0.2259) 0.0195 (0.0044 0.2259)-1.0000 (0.0000 0.1370)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 21
lnL(ntime: 7 np: 9): -494.189804 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.022059 0.083966 0.041289 0.058284 0.033600 0.000004 0.000004 1.843762 0.011802
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.23921
(1: 0.022059, (4: 0.041289, 5: 0.058284): 0.083966, (2: 0.000004, 3: 0.000004): 0.033600);
(D_melanogaster_Arl4-PC: 0.022059, (D_yakuba_Arl4-PC: 0.041289, D_erecta_Arl4-PC: 0.058284): 0.083966, (D_sechellia_Arl4-PC: 0.000004, D_simulans_Arl4-PC: 0.000004): 0.033600);
Detailed output identifying parameters
kappa (ts/tv) = 1.84376
omega (dN/dS) = 0.01180
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.022 236.6 63.4 0.0118 0.0004 0.0333 0.1 2.1
6..7 0.084 236.6 63.4 0.0118 0.0015 0.1269 0.4 8.0
7..4 0.041 236.6 63.4 0.0118 0.0007 0.0624 0.2 4.0
7..5 0.058 236.6 63.4 0.0118 0.0010 0.0881 0.2 5.6
6..8 0.034 236.6 63.4 0.0118 0.0006 0.0508 0.1 3.2
8..2 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
8..3 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0043
tree length for dS: 0.3615
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 21
lnL(ntime: 7 np: 10): -494.189903 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.022059 0.083967 0.041289 0.058285 0.033600 0.000004 0.000004 1.843781 0.999990 0.011797
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.23921
(1: 0.022059, (4: 0.041289, 5: 0.058285): 0.083967, (2: 0.000004, 3: 0.000004): 0.033600);
(D_melanogaster_Arl4-PC: 0.022059, (D_yakuba_Arl4-PC: 0.041289, D_erecta_Arl4-PC: 0.058285): 0.083967, (D_sechellia_Arl4-PC: 0.000004, D_simulans_Arl4-PC: 0.000004): 0.033600);
Detailed output identifying parameters
kappa (ts/tv) = 1.84378
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.01180 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.022 236.6 63.4 0.0118 0.0004 0.0333 0.1 2.1
6..7 0.084 236.6 63.4 0.0118 0.0015 0.1269 0.4 8.0
7..4 0.041 236.6 63.4 0.0118 0.0007 0.0624 0.2 4.0
7..5 0.058 236.6 63.4 0.0118 0.0010 0.0881 0.2 5.6
6..8 0.034 236.6 63.4 0.0118 0.0006 0.0508 0.1 3.2
8..2 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
8..3 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 21
check convergence..
lnL(ntime: 7 np: 12): -494.189804 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.022059 0.083966 0.041289 0.058284 0.033600 0.000004 0.000004 1.843762 1.000000 0.000000 0.011802 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.23921
(1: 0.022059, (4: 0.041289, 5: 0.058284): 0.083966, (2: 0.000004, 3: 0.000004): 0.033600);
(D_melanogaster_Arl4-PC: 0.022059, (D_yakuba_Arl4-PC: 0.041289, D_erecta_Arl4-PC: 0.058284): 0.083966, (D_sechellia_Arl4-PC: 0.000004, D_simulans_Arl4-PC: 0.000004): 0.033600);
Detailed output identifying parameters
kappa (ts/tv) = 1.84376
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.01180 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.022 236.6 63.4 0.0118 0.0004 0.0333 0.1 2.1
6..7 0.084 236.6 63.4 0.0118 0.0015 0.1269 0.4 8.0
7..4 0.041 236.6 63.4 0.0118 0.0007 0.0624 0.2 4.0
7..5 0.058 236.6 63.4 0.0118 0.0010 0.0881 0.2 5.6
6..8 0.034 236.6 63.4 0.0118 0.0006 0.0508 0.1 3.2
8..2 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
8..3 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Arl4-PC)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.248 0.142 0.105 0.088 0.079 0.073 0.069 0.067 0.065 0.064
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.011 0.983
sum of density on p0-p1 = 1.000000
Time used: 0:11
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 21
lnL(ntime: 7 np: 13): -494.189804 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.022059 0.083966 0.041289 0.058284 0.033600 0.000004 0.000004 1.843762 0.256475 0.340307 0.011802 0.011802 0.011803
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.23921
(1: 0.022059, (4: 0.041289, 5: 0.058284): 0.083966, (2: 0.000004, 3: 0.000004): 0.033600);
(D_melanogaster_Arl4-PC: 0.022059, (D_yakuba_Arl4-PC: 0.041289, D_erecta_Arl4-PC: 0.058284): 0.083966, (D_sechellia_Arl4-PC: 0.000004, D_simulans_Arl4-PC: 0.000004): 0.033600);
Detailed output identifying parameters
kappa (ts/tv) = 1.84376
dN/dS (w) for site classes (K=3)
p: 0.25648 0.34031 0.40322
w: 0.01180 0.01180 0.01180
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.022 236.6 63.4 0.0118 0.0004 0.0333 0.1 2.1
6..7 0.084 236.6 63.4 0.0118 0.0015 0.1269 0.4 8.0
7..4 0.041 236.6 63.4 0.0118 0.0007 0.0624 0.2 4.0
7..5 0.058 236.6 63.4 0.0118 0.0010 0.0881 0.2 5.6
6..8 0.034 236.6 63.4 0.0118 0.0006 0.0508 0.1 3.2
8..2 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
8..3 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:17
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 21
lnL(ntime: 7 np: 10): -494.191101 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.022063 0.083975 0.041292 0.058289 0.033603 0.000004 0.000004 1.843961 1.221274 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.23923
(1: 0.022063, (4: 0.041292, 5: 0.058289): 0.083975, (2: 0.000004, 3: 0.000004): 0.033603);
(D_melanogaster_Arl4-PC: 0.022063, (D_yakuba_Arl4-PC: 0.041292, D_erecta_Arl4-PC: 0.058289): 0.083975, (D_sechellia_Arl4-PC: 0.000004, D_simulans_Arl4-PC: 0.000004): 0.033603);
Detailed output identifying parameters
kappa (ts/tv) = 1.84396
Parameters in M7 (beta):
p = 1.22127 q = 99.00000
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00099 0.00261 0.00425 0.00603 0.00802 0.01034 0.01317 0.01687 0.02237 0.03384
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.022 236.6 63.4 0.0118 0.0004 0.0333 0.1 2.1
6..7 0.084 236.6 63.4 0.0118 0.0015 0.1269 0.4 8.0
7..4 0.041 236.6 63.4 0.0118 0.0007 0.0624 0.2 4.0
7..5 0.058 236.6 63.4 0.0118 0.0010 0.0881 0.2 5.6
6..8 0.034 236.6 63.4 0.0118 0.0006 0.0508 0.1 3.2
8..2 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
8..3 0.000 236.6 63.4 0.0118 0.0000 0.0000 0.0 0.0
Time used: 0:36
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 21
lnL(ntime: 7 np: 12): -494.191199 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.022063 0.083976 0.041292 0.058289 0.033604 0.000004 0.000004 1.843978 0.999990 1.220757 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.23923
(1: 0.022063, (4: 0.041292, 5: 0.058289): 0.083976, (2: 0.000004, 3: 0.000004): 0.033604);
(D_melanogaster_Arl4-PC: 0.022063, (D_yakuba_Arl4-PC: 0.041292, D_erecta_Arl4-PC: 0.058289): 0.083976, (D_sechellia_Arl4-PC: 0.000004, D_simulans_Arl4-PC: 0.000004): 0.033604);
Detailed output identifying parameters
kappa (ts/tv) = 1.84398
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 1.22076 q = 99.00000
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00099 0.00261 0.00425 0.00602 0.00801 0.01033 0.01316 0.01687 0.02236 0.03383 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.022 236.6 63.4 0.0119 0.0004 0.0333 0.1 2.1
6..7 0.084 236.6 63.4 0.0119 0.0015 0.1269 0.4 8.0
7..4 0.041 236.6 63.4 0.0119 0.0007 0.0624 0.2 4.0
7..5 0.058 236.6 63.4 0.0119 0.0010 0.0881 0.2 5.6
6..8 0.034 236.6 63.4 0.0119 0.0006 0.0508 0.1 3.2
8..2 0.000 236.6 63.4 0.0119 0.0000 0.0000 0.0 0.0
8..3 0.000 236.6 63.4 0.0119 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Arl4-PC)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
p : 0.994 0.006 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.001 0.006 0.024 0.058 0.111 0.181 0.263 0.356
ws: 0.350 0.152 0.098 0.076 0.064 0.058 0.054 0.051 0.049 0.048
Time used: 1:02
Model 1: NearlyNeutral -494.189903 Model 2: PositiveSelection -494.189804 Model 0: one-ratio -494.189804 Model 3: discrete -494.189804 Model 7: beta -494.191101 Model 8: beta&w>1 -494.191199 Model 0 vs 1 1.9800000006853224E-4 Model 2 vs 1 1.9800000006853224E-4 Model 8 vs 7 1.9599999995989492E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
