--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 02 14:35:40 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/14/Arl4-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -533.67          -544.69
2       -533.85          -547.86
--------------------------------------
TOTAL     -533.76          -547.21
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.338529    0.022736    0.084209    0.628346    0.312298    714.73    903.46    1.000
r(A<->C){all}   0.096544    0.005122    0.000118    0.235020    0.079067    435.09    480.13    1.000
r(A<->G){all}   0.431210    0.020094    0.168960    0.700296    0.429661    187.62    303.30    1.004
r(A<->T){all}   0.079932    0.003606    0.000083    0.193898    0.066785    443.47    545.21    1.000
r(C<->G){all}   0.056981    0.003307    0.000032    0.173778    0.039717    432.18    511.45    1.002
r(C<->T){all}   0.211053    0.013148    0.011808    0.433601    0.194551    169.46    266.28    1.011
r(G<->T){all}   0.124280    0.006773    0.001521    0.282328    0.108516    313.28    397.50    1.000
pi(A){all}      0.345884    0.000675    0.293378    0.395541    0.345833   1244.96   1269.36    1.000
pi(C){all}      0.149426    0.000409    0.111153    0.188664    0.148740   1047.02   1156.91    1.000
pi(G){all}      0.236982    0.000531    0.190244    0.280612    0.236830   1163.39   1228.74    1.000
pi(T){all}      0.267708    0.000609    0.220603    0.316854    0.267350   1126.91   1253.70    1.000
alpha{1,2}      0.068074    0.007552    0.000133    0.173050    0.051494    892.00   1018.85    1.001
alpha{3}        1.339010    0.493600    0.320151    2.782082    1.214454   1141.69   1314.97    1.000
pinvar{all}     0.714722    0.014450    0.483432    0.876275    0.740931    696.61    772.32    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-494.189903
Model 2: PositiveSelection	-494.189804
Model 0: one-ratio	-494.189804
Model 3: discrete	-494.189804
Model 7: beta	-494.191101
Model 8: beta&w>1	-494.191199


Model 0 vs 1	1.9800000006853224E-4

Model 2 vs 1	1.9800000006853224E-4

Model 8 vs 7	1.9599999995989492E-4
>C1
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS

>C2
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS

>C3
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS

>C4
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS

>C5
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS

CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=100 

C1              MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
C2              MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
C3              MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
C4              MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
C5              MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
                **************************************************

C1              NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
C2              NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
C3              NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
C4              NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
C5              NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
                *********************************************.****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  100 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  100 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2000]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [2000]--->[2000]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/14/Arl4-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.249 Mb, Max= 30.423 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C2
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C3
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C4
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C5
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS

FORMAT of file /tmp/tmp121887551155636606aln Not Supported[FATAL:T-COFFEE]
>C1
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C2
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C3
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS
>C4
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
>C5
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:100 S:100 BS:100
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.00 C1	 C2	 99.00
TOP	    1    0	 99.00 C2	 C1	 99.00
BOT	    0    2	 99.00 C1	 C3	 99.00
TOP	    2    0	 99.00 C3	 C1	 99.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 99.00 C2	 C4	 99.00
TOP	    3    1	 99.00 C4	 C2	 99.00
BOT	    1    4	 99.00 C2	 C5	 99.00
TOP	    4    1	 99.00 C5	 C2	 99.00
BOT	    2    3	 99.00 C3	 C4	 99.00
TOP	    3    2	 99.00 C4	 C3	 99.00
BOT	    2    4	 99.00 C3	 C5	 99.00
TOP	    4    2	 99.00 C5	 C3	 99.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
AVG	 0	 C1	  *	 99.50
AVG	 1	 C2	  *	 99.25
AVG	 2	 C3	  *	 99.25
AVG	 3	 C4	  *	 99.50
AVG	 4	 C5	  *	 99.50
TOT	 TOT	  *	 99.40
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGGTGCTACAATGGTAAAACCGTTGGTAAAAAATGGAAATATTTTGGA
C2              ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA
C3              ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA
C4              ATGGGGGCTACGATGGTAAAACCTTTGGTAAAGAATGGAAATATTTTGGA
C5              ATGGGGGCTACAATGGTAAAACCTTTAGTAAAGAATGGAAATATTTTGGA
                ***** *****.*********** **.*****.*****************

C1              TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
C2              TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
C3              TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
C4              TGCACTGCCATCACAGGCAACTCTGCATGTAGTTATGTTAGGTTTGGATT
C5              TGCTTTGCCATCGCAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
                ***: *******.***********.*************************

C1              CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
C2              CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
C3              CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
C4              CTGCGGGAAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA
C5              CTGCGGGTAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA
                *******:***********:***********************.******

C1              AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACCCT
C2              AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT
C3              AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT
C4              AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT
C5              AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT
                ** *********************** ** *****************.**

C1              TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
C2              TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG
C3              TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG
C4              TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
C5              TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
                ************************************************.*

C1              AAAAATTGAGACCACTTTGGAGAAGTTATACACGAAAGAATGGAAGAAGC
C2              AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC
C3              AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC
C4              AGAAATTAAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
C5              AAAAATTGAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
                *.*****.************.***************.*************



>C1
ATGGGTGCTACAATGGTAAAACCGTTGGTAAAAAATGGAAATATTTTGGA
TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACCCT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
AAAAATTGAGACCACTTTGGAGAAGTTATACACGAAAGAATGGAAGAAGC
>C2
ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA
TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG
AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC
>C3
ATGGGGGCTACAATGGTAAAACCTTTGGTAAAAAATGGAAATATTTTGGA
TGCACTGCCATCACAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
CTGCGGGAAAAACAACGGCTTTATACAGACTTAAGTTTGATCAATACTTA
AACACAGTGCCAACTATTGGATTTAATTGTGAAAAGGTACAATGTACACT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAGG
AAAAATTGAGACCACTTTGGAGAAGTTATACACGAACGAATGGAAGAAGC
>C4
ATGGGGGCTACGATGGTAAAACCTTTGGTAAAGAATGGAAATATTTTGGA
TGCACTGCCATCACAGGCAACTCTGCATGTAGTTATGTTAGGTTTGGATT
CTGCGGGAAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA
AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
AGAAATTAAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
>C5
ATGGGGGCTACAATGGTAAAACCTTTAGTAAAGAATGGAAATATTTTGGA
TGCTTTGCCATCGCAGGCAACTCTACATGTAGTTATGTTAGGTTTGGATT
CTGCGGGTAAAACAACGGCATTATACAGACTTAAGTTTGATCAGTACTTA
AATACAGTGCCAACTATTGGATTTAACTGCGAAAAGGTACAATGTACCCT
TGGCAAAGCAAAAGGAGTTCATTTTTTGGTTTGGGATGTCGGAGGACAAG
AAAAATTGAGACCACTTTGGCGAAGTTATACACGAAAGAATGGAAGAAGC
>C1
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS

>C2
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS

>C3
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRTNGRS

>C4
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS

>C5
MGATMVKPLVKNGNILDALPSQATLHVVMLGLDSAGKTTALYRLKFDQYL
NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRSYTRKNGRS



                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 300 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478097162
      Setting output file names to "/opt/ADOPS/14/Arl4-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1029836742
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1333697368
      Seed = 1967666340
      Swapseed = 1478097162
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 6 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 17 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -717.921241 -- -25.624409
         Chain 2 -- -717.921241 -- -25.624409
         Chain 3 -- -694.892957 -- -25.624409
         Chain 4 -- -719.833681 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -717.921241 -- -25.624409
         Chain 2 -- -705.490392 -- -25.624409
         Chain 3 -- -715.359656 -- -25.624409
         Chain 4 -- -715.359656 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-717.921] (-717.921) (-694.893) (-719.834) * [-717.921] (-705.490) (-715.360) (-715.360) 
        500 -- [-541.934] (-546.956) (-540.865) (-550.020) * (-545.247) (-536.720) [-540.758] (-552.290) -- 0:00:00
       1000 -- [-542.115] (-535.190) (-535.439) (-541.822) * [-539.669] (-537.411) (-538.126) (-542.221) -- 0:00:00
       1500 -- (-542.814) (-540.227) [-535.186] (-538.637) * (-540.875) (-538.851) [-538.223] (-543.275) -- 0:00:00
       2000 -- (-545.500) [-537.733] (-538.447) (-540.748) * (-542.289) [-537.232] (-537.859) (-537.999) -- 0:00:00
       2500 -- [-538.815] (-536.248) (-540.918) (-535.614) * (-542.974) (-537.785) (-539.660) [-537.185] -- 0:00:00
       3000 -- (-542.741) (-538.223) (-539.767) [-535.723] * (-538.630) [-538.561] (-538.500) (-542.431) -- 0:00:00
       3500 -- (-539.089) (-542.249) [-533.615] (-535.750) * (-543.468) [-540.560] (-536.273) (-540.237) -- 0:00:00
       4000 -- (-538.226) (-546.359) (-535.705) [-539.482] * (-546.748) (-540.651) (-538.027) [-540.473] -- 0:00:00
       4500 -- [-539.401] (-534.537) (-542.938) (-535.055) * (-544.329) [-535.593] (-546.644) (-539.149) -- 0:03:41
       5000 -- (-545.066) (-538.449) (-539.664) [-538.400] * [-540.436] (-538.867) (-540.957) (-545.002) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-546.784) [-534.447] (-546.433) (-533.755) * [-537.440] (-540.766) (-538.183) (-543.878) -- 0:03:00
       6000 -- (-542.428) [-537.117] (-542.339) (-539.623) * (-549.092) (-538.951) [-538.452] (-536.737) -- 0:02:45
       6500 -- [-541.178] (-540.654) (-542.164) (-534.620) * (-541.500) [-540.263] (-536.089) (-543.910) -- 0:02:32
       7000 -- (-543.867) (-542.594) (-533.168) [-535.442] * (-541.290) [-539.858] (-536.402) (-539.021) -- 0:02:21
       7500 -- (-548.672) (-539.580) [-537.499] (-539.676) * (-542.178) (-544.412) (-538.079) [-542.106] -- 0:02:12
       8000 -- (-540.755) (-537.823) (-545.190) [-539.891] * [-542.254] (-536.527) (-539.406) (-539.274) -- 0:02:04
       8500 -- (-544.119) [-537.464] (-546.416) (-538.654) * (-538.166) (-535.624) (-536.627) [-541.424] -- 0:01:56
       9000 -- (-542.283) [-538.634] (-536.721) (-539.452) * (-534.975) [-535.721] (-537.706) (-537.462) -- 0:01:50
       9500 -- (-539.629) [-534.747] (-546.041) (-547.930) * (-540.516) (-536.468) [-533.849] (-541.479) -- 0:01:44
      10000 -- (-543.091) [-533.500] (-538.756) (-543.206) * (-537.256) (-536.968) (-538.872) [-536.576] -- 0:01:39

      Average standard deviation of split frequencies: 0.022097

      10500 -- (-540.334) (-535.964) [-537.460] (-543.441) * [-536.652] (-538.660) (-542.768) (-535.034) -- 0:01:34
      11000 -- (-545.656) [-532.991] (-543.057) (-537.159) * (-539.909) (-535.052) [-532.672] (-534.542) -- 0:01:29
      11500 -- (-545.934) [-535.645] (-542.213) (-540.383) * (-532.160) [-536.153] (-536.591) (-540.974) -- 0:01:25
      12000 -- (-540.465) (-537.331) [-536.637] (-541.176) * (-535.423) [-541.146] (-541.433) (-539.611) -- 0:01:22
      12500 -- (-537.610) [-536.817] (-539.267) (-540.227) * (-533.869) [-542.120] (-537.987) (-540.408) -- 0:01:19
      13000 -- (-542.044) (-538.324) [-536.287] (-540.518) * (-539.598) [-534.246] (-542.891) (-539.037) -- 0:02:31
      13500 -- (-550.791) (-532.377) (-537.780) [-534.886] * (-541.562) [-536.837] (-533.588) (-532.156) -- 0:02:26
      14000 -- [-541.515] (-534.393) (-541.931) (-538.902) * (-535.859) (-535.517) (-539.218) [-535.717] -- 0:02:20
      14500 -- [-540.593] (-534.298) (-547.470) (-547.662) * (-539.367) [-535.021] (-543.565) (-539.135) -- 0:02:15
      15000 -- (-538.085) (-539.098) (-543.943) [-536.225] * [-535.699] (-533.069) (-540.551) (-546.034) -- 0:02:11

      Average standard deviation of split frequencies: 0.029463

      15500 -- (-540.560) (-536.022) [-538.853] (-540.519) * (-532.379) [-532.555] (-539.054) (-537.856) -- 0:02:07
      16000 -- (-541.807) [-533.696] (-539.798) (-544.385) * (-540.958) [-537.654] (-537.948) (-536.401) -- 0:02:03
      16500 -- [-542.068] (-537.823) (-541.938) (-537.368) * [-539.901] (-534.981) (-543.824) (-532.849) -- 0:01:59
      17000 -- (-538.539) (-534.311) [-539.122] (-540.289) * (-541.420) [-537.068] (-544.460) (-535.322) -- 0:01:55
      17500 -- (-535.558) [-532.283] (-535.483) (-540.303) * (-549.216) (-541.542) (-536.928) [-533.778] -- 0:01:52
      18000 -- (-540.378) [-537.957] (-548.611) (-538.686) * (-544.029) [-534.465] (-546.113) (-541.278) -- 0:01:49
      18500 -- [-534.230] (-537.377) (-543.384) (-536.777) * (-534.193) (-540.701) [-535.626] (-537.793) -- 0:01:46
      19000 -- [-539.057] (-541.027) (-541.265) (-540.222) * (-538.478) (-544.032) (-544.094) [-537.304] -- 0:01:43
      19500 -- (-535.678) (-539.537) (-541.452) [-535.386] * [-536.314] (-536.254) (-536.264) (-540.275) -- 0:01:40
      20000 -- (-535.197) [-536.717] (-537.778) (-536.380) * [-533.327] (-539.761) (-541.594) (-539.575) -- 0:01:38

      Average standard deviation of split frequencies: 0.022810

      20500 -- (-535.050) [-537.370] (-542.122) (-549.753) * [-537.828] (-540.647) (-540.052) (-542.017) -- 0:01:35
      21000 -- (-535.614) (-540.040) (-534.591) [-533.267] * (-539.594) [-532.310] (-539.112) (-540.990) -- 0:01:33
      21500 -- (-540.285) (-540.917) (-538.847) [-535.109] * (-536.410) (-535.216) [-536.580] (-537.869) -- 0:02:16
      22000 -- [-533.286] (-541.794) (-544.970) (-534.223) * (-543.629) [-537.961] (-545.058) (-536.853) -- 0:02:13
      22500 -- (-536.565) [-531.836] (-544.366) (-539.179) * [-534.563] (-537.888) (-537.366) (-545.066) -- 0:02:10
      23000 -- (-538.480) [-532.516] (-539.693) (-534.472) * (-533.323) (-542.110) (-537.167) [-536.526] -- 0:02:07
      23500 -- (-543.753) [-541.255] (-539.298) (-537.094) * (-539.518) (-534.818) [-536.150] (-540.782) -- 0:02:04
      24000 -- (-533.832) (-540.481) [-534.994] (-537.894) * (-540.977) (-551.529) (-540.560) [-539.799] -- 0:02:02
      24500 -- (-545.088) (-539.716) [-539.005] (-537.789) * (-544.854) [-532.228] (-538.943) (-544.368) -- 0:01:59
      25000 -- [-539.833] (-543.779) (-540.707) (-533.340) * [-535.444] (-535.531) (-532.864) (-537.643) -- 0:01:57

      Average standard deviation of split frequencies: 0.009065

      25500 -- (-533.167) [-545.706] (-542.894) (-537.591) * (-537.985) [-539.674] (-535.421) (-542.928) -- 0:01:54
      26000 -- [-535.776] (-540.641) (-535.706) (-536.801) * [-535.281] (-533.910) (-538.202) (-537.791) -- 0:01:52
      26500 -- (-541.176) (-541.551) (-542.535) [-533.226] * (-539.760) (-545.038) [-538.563] (-537.933) -- 0:01:50
      27000 -- [-533.589] (-537.222) (-537.967) (-539.943) * (-543.236) (-546.750) [-536.925] (-537.911) -- 0:01:48
      27500 -- (-534.177) (-534.629) (-542.607) [-535.618] * (-541.560) (-549.742) [-536.502] (-538.484) -- 0:01:46
      28000 -- (-535.757) [-531.355] (-535.311) (-544.988) * (-536.434) (-537.624) [-537.758] (-537.026) -- 0:01:44
      28500 -- (-535.524) (-535.439) [-539.483] (-534.334) * (-541.095) [-536.958] (-539.740) (-537.518) -- 0:01:42
      29000 -- (-538.506) [-538.369] (-546.828) (-542.221) * [-543.635] (-544.754) (-534.421) (-538.749) -- 0:01:40
      29500 -- [-536.502] (-537.826) (-541.347) (-535.266) * [-547.293] (-544.059) (-541.198) (-538.528) -- 0:01:38
      30000 -- (-537.805) [-545.876] (-540.687) (-538.381) * (-549.025) [-533.913] (-537.907) (-543.197) -- 0:01:37

      Average standard deviation of split frequencies: 0.015372

      30500 -- (-536.191) [-538.949] (-544.875) (-532.743) * (-549.010) (-535.839) (-536.467) [-535.932] -- 0:02:07
      31000 -- (-540.138) (-533.817) (-540.669) [-533.329] * (-548.140) (-546.868) [-540.322] (-533.225) -- 0:02:05
      31500 -- [-534.336] (-536.550) (-542.099) (-536.072) * (-549.762) (-542.833) (-534.742) [-536.797] -- 0:02:02
      32000 -- (-535.933) (-535.517) (-542.910) [-534.904] * (-552.336) [-541.827] (-535.756) (-533.447) -- 0:02:01
      32500 -- (-539.428) [-533.794] (-542.876) (-542.236) * (-546.348) (-542.900) (-533.303) [-540.667] -- 0:01:59
      33000 -- (-539.507) (-540.566) (-539.645) [-537.256] * (-548.806) (-537.885) (-536.801) [-536.422] -- 0:01:57
      33500 -- (-541.184) [-539.426] (-537.719) (-539.860) * (-540.438) (-542.673) (-539.305) [-532.404] -- 0:01:55
      34000 -- (-533.801) (-541.155) (-543.395) [-537.116] * (-541.504) (-543.321) [-539.159] (-537.505) -- 0:01:53
      34500 -- (-537.341) (-535.924) (-539.126) [-532.604] * (-545.597) (-541.959) (-536.944) [-541.672] -- 0:01:51
      35000 -- (-536.080) [-535.381] (-538.882) (-538.550) * [-538.396] (-537.300) (-535.405) (-539.519) -- 0:01:50

      Average standard deviation of split frequencies: 0.026189

      35500 -- (-535.094) (-540.118) (-540.492) [-534.240] * (-540.885) (-539.001) (-536.763) [-535.599] -- 0:01:48
      36000 -- (-548.330) (-540.292) [-538.988] (-538.981) * (-537.838) (-539.682) [-533.310] (-542.994) -- 0:01:47
      36500 -- (-538.681) (-539.937) [-540.364] (-542.282) * (-542.831) [-539.806] (-539.485) (-536.357) -- 0:01:45
      37000 -- [-540.645] (-538.102) (-539.612) (-545.273) * (-537.837) (-541.155) [-535.249] (-541.736) -- 0:01:44
      37500 -- (-536.203) (-534.079) (-539.262) [-545.292] * (-540.950) [-542.637] (-531.295) (-534.686) -- 0:01:42
      38000 -- (-534.892) [-537.541] (-539.861) (-547.691) * (-552.364) (-533.477) [-531.738] (-537.976) -- 0:01:41
      38500 -- [-535.742] (-536.819) (-538.258) (-547.982) * [-543.348] (-539.067) (-536.982) (-545.924) -- 0:01:39
      39000 -- (-535.843) [-536.280] (-541.789) (-542.298) * [-538.709] (-542.477) (-534.757) (-540.966) -- 0:02:03
      39500 -- [-541.709] (-538.647) (-550.443) (-541.870) * (-540.053) (-540.136) (-540.275) [-540.857] -- 0:02:01
      40000 -- [-536.042] (-536.670) (-541.269) (-540.192) * (-542.378) [-533.841] (-536.173) (-540.108) -- 0:02:00

      Average standard deviation of split frequencies: 0.023184

      40500 -- (-535.549) [-537.074] (-540.490) (-539.417) * [-535.922] (-539.395) (-537.146) (-538.370) -- 0:01:58
      41000 -- (-538.163) [-539.636] (-539.920) (-544.415) * (-542.283) (-537.752) (-533.966) [-534.527] -- 0:01:56
      41500 -- [-537.169] (-540.226) (-538.584) (-539.954) * (-539.532) [-535.296] (-533.847) (-545.136) -- 0:01:55
      42000 -- (-540.977) [-538.484] (-539.685) (-540.084) * (-538.824) [-539.483] (-532.448) (-550.093) -- 0:01:54
      42500 -- (-536.030) [-533.390] (-541.447) (-543.224) * (-535.873) (-538.226) (-534.803) [-540.753] -- 0:01:52
      43000 -- (-537.479) (-535.747) [-536.923] (-540.937) * (-536.189) (-539.923) (-535.793) [-538.899] -- 0:01:51
      43500 -- (-538.837) (-542.269) [-539.328] (-539.661) * (-535.981) (-544.630) [-538.995] (-536.543) -- 0:01:49
      44000 -- (-535.466) (-544.848) (-539.607) [-538.793] * (-543.058) (-537.530) [-537.892] (-533.245) -- 0:01:48
      44500 -- [-532.827] (-550.272) (-544.136) (-539.307) * [-535.727] (-536.160) (-539.704) (-536.663) -- 0:01:47
      45000 -- (-535.979) [-544.720] (-536.353) (-542.986) * (-542.062) (-539.532) [-531.946] (-536.664) -- 0:01:46

      Average standard deviation of split frequencies: 0.020496

      45500 -- (-536.098) (-548.196) [-535.488] (-538.517) * [-539.282] (-536.048) (-536.504) (-532.294) -- 0:01:44
      46000 -- (-542.109) (-541.244) [-537.792] (-538.277) * (-538.509) (-535.898) (-534.284) [-534.983] -- 0:01:43
      46500 -- (-537.007) [-538.917] (-543.572) (-540.107) * [-534.909] (-537.475) (-537.957) (-534.609) -- 0:01:42
      47000 -- (-541.687) [-537.259] (-537.668) (-541.172) * [-534.776] (-543.152) (-542.279) (-534.220) -- 0:01:41
      47500 -- [-537.515] (-537.242) (-544.329) (-536.704) * (-536.914) (-537.459) [-536.723] (-538.130) -- 0:01:40
      48000 -- [-539.464] (-535.062) (-537.363) (-545.595) * (-538.568) (-539.269) (-536.573) [-537.848] -- 0:01:59
      48500 -- (-536.529) (-535.637) [-535.279] (-533.758) * (-539.395) (-533.078) (-544.794) [-551.003] -- 0:01:57
      49000 -- [-536.647] (-543.316) (-539.271) (-540.484) * [-539.940] (-537.425) (-531.756) (-540.993) -- 0:01:56
      49500 -- (-540.451) [-533.145] (-539.221) (-538.259) * (-540.585) (-536.945) [-537.273] (-546.741) -- 0:01:55
      50000 -- (-541.866) [-533.916] (-541.133) (-541.893) * (-543.282) [-531.351] (-536.236) (-537.258) -- 0:01:54

      Average standard deviation of split frequencies: 0.023260

      50500 -- (-545.863) (-539.434) (-539.273) [-535.474] * (-541.594) (-535.915) (-541.885) [-538.281] -- 0:01:52
      51000 -- (-540.624) (-539.898) [-534.867] (-542.368) * [-537.336] (-537.809) (-536.626) (-539.889) -- 0:01:51
      51500 -- [-541.026] (-537.514) (-535.066) (-542.073) * (-537.487) [-531.861] (-539.935) (-534.245) -- 0:01:50
      52000 -- (-537.459) (-540.926) (-539.742) [-538.806] * (-539.888) (-548.158) (-547.993) [-534.081] -- 0:01:49
      52500 -- (-542.052) [-536.269] (-534.619) (-549.869) * (-546.292) [-543.374] (-542.237) (-539.919) -- 0:01:48
      53000 -- (-543.276) (-538.064) (-539.533) [-536.641] * (-536.558) (-543.032) [-533.766] (-533.710) -- 0:01:47
      53500 -- (-542.879) (-536.690) [-536.344] (-536.351) * (-537.910) (-534.148) [-534.961] (-539.100) -- 0:01:46
      54000 -- (-538.962) (-534.268) [-536.555] (-540.450) * (-537.308) (-533.745) [-537.765] (-537.776) -- 0:01:45
      54500 -- (-541.082) (-534.333) [-534.449] (-538.965) * (-537.294) [-543.582] (-537.211) (-541.755) -- 0:01:44
      55000 -- (-537.725) (-537.966) [-534.944] (-547.524) * [-537.935] (-533.903) (-540.559) (-544.543) -- 0:01:43

      Average standard deviation of split frequencies: 0.012627

      55500 -- (-539.420) [-541.491] (-536.179) (-545.495) * (-537.141) (-536.687) (-543.322) [-538.179] -- 0:01:42
      56000 -- [-536.987] (-538.082) (-535.993) (-535.254) * [-534.591] (-536.993) (-535.499) (-539.900) -- 0:01:41
      56500 -- [-536.574] (-532.086) (-534.128) (-542.932) * [-536.619] (-532.547) (-538.254) (-539.540) -- 0:01:40
      57000 -- [-536.046] (-532.859) (-532.020) (-534.202) * [-534.680] (-538.345) (-538.281) (-545.335) -- 0:01:55
      57500 -- (-544.564) (-536.358) (-533.550) [-534.755] * [-537.570] (-536.473) (-540.081) (-548.924) -- 0:01:54
      58000 -- (-543.138) (-531.245) [-535.947] (-532.586) * [-539.014] (-536.096) (-533.629) (-541.639) -- 0:01:53
      58500 -- (-546.819) (-538.514) [-531.819] (-534.337) * (-538.874) (-543.030) [-533.339] (-539.646) -- 0:01:52
      59000 -- (-534.518) (-540.668) (-530.487) [-535.711] * (-536.925) (-541.026) [-540.512] (-538.551) -- 0:01:51
      59500 -- (-542.279) (-543.193) (-543.119) [-535.878] * (-539.501) (-538.874) (-540.358) [-537.997] -- 0:01:50
      60000 -- (-536.600) (-538.817) [-536.353] (-533.255) * (-535.739) [-535.907] (-543.603) (-532.034) -- 0:01:49

      Average standard deviation of split frequencies: 0.015541

      60500 -- [-537.039] (-541.345) (-538.587) (-534.547) * (-535.185) [-537.638] (-537.888) (-540.662) -- 0:01:48
      61000 -- (-541.750) (-536.195) [-536.687] (-538.696) * (-538.812) (-541.501) [-542.033] (-543.520) -- 0:01:47
      61500 -- (-543.716) [-538.972] (-533.462) (-538.137) * (-543.088) (-542.372) [-536.785] (-536.851) -- 0:01:46
      62000 -- (-543.503) (-541.079) [-533.379] (-534.819) * (-540.218) (-537.521) [-538.002] (-536.849) -- 0:01:45
      62500 -- (-538.454) [-536.988] (-534.519) (-537.643) * (-540.583) (-538.214) (-540.527) [-536.698] -- 0:01:45
      63000 -- (-540.381) (-533.479) [-536.297] (-548.898) * [-537.615] (-539.484) (-539.362) (-541.858) -- 0:01:44
      63500 -- (-544.709) [-533.693] (-538.657) (-539.050) * [-538.812] (-544.387) (-546.997) (-538.432) -- 0:01:43
      64000 -- (-539.911) (-534.024) (-538.342) [-535.386] * (-543.798) [-535.777] (-542.252) (-535.511) -- 0:01:42
      64500 -- (-543.818) [-537.094] (-539.996) (-534.828) * [-535.169] (-538.443) (-544.050) (-535.810) -- 0:01:41
      65000 -- (-537.805) [-536.295] (-542.723) (-536.444) * [-535.642] (-538.479) (-541.343) (-536.954) -- 0:01:40

      Average standard deviation of split frequencies: 0.010714

      65500 -- [-538.884] (-540.711) (-545.587) (-536.659) * (-535.839) (-537.835) [-539.182] (-538.494) -- 0:01:54
      66000 -- (-539.715) (-543.015) [-537.398] (-540.642) * [-533.796] (-547.718) (-535.083) (-534.473) -- 0:01:53
      66500 -- (-543.843) [-536.674] (-540.779) (-540.104) * (-535.308) (-548.984) (-535.950) [-542.821] -- 0:01:52
      67000 -- (-537.458) (-539.315) (-537.070) [-543.718] * [-535.128] (-544.078) (-536.778) (-537.311) -- 0:01:51
      67500 -- [-534.136] (-539.590) (-534.924) (-540.940) * (-538.051) [-538.548] (-535.234) (-536.862) -- 0:01:50
      68000 -- (-535.097) (-535.415) [-539.155] (-548.066) * (-534.804) (-545.651) [-544.606] (-536.270) -- 0:01:49
      68500 -- [-541.133] (-536.854) (-544.740) (-542.839) * (-536.428) (-544.745) [-540.743] (-536.268) -- 0:01:48
      69000 -- (-541.148) [-536.825] (-540.667) (-541.898) * [-536.434] (-543.364) (-538.592) (-539.529) -- 0:01:47
      69500 -- (-539.781) [-534.248] (-552.909) (-539.765) * [-534.073] (-541.224) (-535.309) (-542.354) -- 0:01:47
      70000 -- (-542.263) (-538.113) (-532.453) [-537.370] * [-536.190] (-541.874) (-536.308) (-539.030) -- 0:01:46

      Average standard deviation of split frequencies: 0.016677

      70500 -- (-538.697) [-540.202] (-537.223) (-534.313) * [-536.993] (-543.276) (-535.127) (-550.588) -- 0:01:45
      71000 -- (-538.302) (-542.954) [-537.897] (-543.752) * [-536.822] (-548.873) (-536.675) (-546.955) -- 0:01:44
      71500 -- (-537.959) [-539.913] (-538.231) (-534.731) * (-536.345) (-542.071) (-535.888) [-534.346] -- 0:01:43
      72000 -- [-535.617] (-538.382) (-536.835) (-541.925) * [-535.222] (-542.495) (-535.318) (-539.326) -- 0:01:43
      72500 -- (-535.192) (-542.316) (-537.159) [-538.796] * (-534.683) (-558.877) [-539.830] (-540.488) -- 0:01:42
      73000 -- (-540.266) (-544.663) [-542.727] (-543.836) * (-539.229) (-544.625) [-536.273] (-536.855) -- 0:01:41
      73500 -- (-541.914) (-535.792) [-533.604] (-542.592) * (-534.907) (-542.560) [-535.931] (-539.655) -- 0:01:40
      74000 -- (-533.416) [-539.247] (-548.285) (-547.623) * (-535.394) (-541.881) [-531.499] (-539.513) -- 0:01:52
      74500 -- (-531.599) [-536.456] (-540.588) (-537.361) * (-538.744) (-546.493) [-534.530] (-541.624) -- 0:01:51
      75000 -- (-536.618) (-542.436) [-532.777] (-532.932) * (-536.362) (-547.801) [-534.211] (-540.378) -- 0:01:51

      Average standard deviation of split frequencies: 0.015507

      75500 -- (-534.770) (-538.322) [-538.871] (-536.527) * [-532.589] (-540.142) (-535.880) (-538.217) -- 0:01:50
      76000 -- (-535.028) [-530.666] (-544.890) (-539.247) * (-534.236) (-537.909) [-537.773] (-536.307) -- 0:01:49
      76500 -- (-543.148) [-543.791] (-537.622) (-546.193) * [-534.894] (-542.082) (-535.328) (-537.179) -- 0:01:48
      77000 -- [-537.571] (-546.286) (-536.760) (-536.044) * (-536.610) (-542.700) (-539.534) [-538.083] -- 0:01:47
      77500 -- (-538.563) (-549.845) (-539.233) [-536.063] * [-545.304] (-538.445) (-538.291) (-541.343) -- 0:01:47
      78000 -- (-538.600) (-543.983) [-534.510] (-537.337) * (-539.540) (-546.747) (-533.802) [-537.607] -- 0:01:46
      78500 -- (-535.475) (-548.322) (-537.622) [-532.738] * (-538.588) (-539.353) [-537.429] (-536.406) -- 0:01:45
      79000 -- [-537.167] (-542.134) (-534.055) (-537.700) * (-537.501) (-545.094) (-538.138) [-533.129] -- 0:01:44
      79500 -- [-542.674] (-535.334) (-537.929) (-541.142) * [-539.461] (-539.373) (-540.209) (-535.616) -- 0:01:44
      80000 -- [-536.252] (-539.721) (-537.343) (-536.577) * (-537.121) (-542.431) [-539.926] (-541.802) -- 0:01:43

      Average standard deviation of split frequencies: 0.017532

      80500 -- (-540.200) [-542.251] (-543.413) (-538.061) * (-537.096) (-540.719) (-537.316) [-534.039] -- 0:01:42
      81000 -- (-533.628) [-536.819] (-543.986) (-538.164) * (-541.289) (-540.421) (-540.126) [-539.255] -- 0:01:42
      81500 -- (-537.697) (-534.931) [-536.845] (-538.271) * (-542.261) (-545.557) [-535.976] (-534.342) -- 0:01:41
      82000 -- (-536.350) [-533.517] (-533.899) (-536.695) * [-538.215] (-548.913) (-538.744) (-543.620) -- 0:01:40
      82500 -- (-534.082) [-537.583] (-544.901) (-540.153) * [-536.400] (-546.616) (-534.475) (-540.884) -- 0:01:51
      83000 -- (-534.146) (-538.198) [-537.476] (-546.316) * (-543.027) (-542.087) [-536.507] (-539.956) -- 0:01:50
      83500 -- [-536.575] (-536.781) (-540.875) (-541.702) * (-535.057) (-545.908) [-536.851] (-534.595) -- 0:01:49
      84000 -- (-539.132) [-537.472] (-537.210) (-540.058) * [-536.574] (-541.859) (-543.313) (-533.694) -- 0:01:49
      84500 -- [-531.134] (-538.840) (-543.482) (-538.818) * (-538.343) (-538.136) (-540.291) [-534.373] -- 0:01:48
      85000 -- [-534.404] (-542.697) (-537.655) (-534.934) * (-537.131) (-541.315) [-536.224] (-540.793) -- 0:01:47

      Average standard deviation of split frequencies: 0.016444

      85500 -- [-537.252] (-541.580) (-539.239) (-539.740) * [-534.918] (-538.070) (-546.520) (-540.189) -- 0:01:46
      86000 -- (-534.518) (-537.894) (-540.417) [-540.153] * (-538.403) [-534.253] (-541.314) (-538.541) -- 0:01:46
      86500 -- [-533.269] (-537.257) (-539.531) (-544.620) * [-534.337] (-534.623) (-538.643) (-540.741) -- 0:01:45
      87000 -- [-532.883] (-543.612) (-541.481) (-538.707) * (-537.911) (-540.386) [-539.634] (-546.821) -- 0:01:44
      87500 -- (-533.679) (-540.437) (-540.455) [-532.278] * (-539.355) (-539.827) [-535.529] (-540.323) -- 0:01:44
      88000 -- [-536.293] (-537.119) (-535.752) (-536.587) * (-537.646) (-537.463) (-536.872) [-547.822] -- 0:01:43
      88500 -- [-531.853] (-538.807) (-543.415) (-536.911) * (-536.003) (-543.068) [-532.825] (-535.979) -- 0:01:42
      89000 -- (-532.628) (-537.294) [-546.631] (-540.298) * (-541.299) (-539.109) [-536.775] (-536.381) -- 0:01:42
      89500 -- (-533.552) (-537.150) (-541.094) [-531.856] * (-540.000) [-537.169] (-534.564) (-537.418) -- 0:01:41
      90000 -- (-531.730) [-536.957] (-539.505) (-537.912) * (-543.282) (-538.668) (-539.596) [-537.871] -- 0:01:41

      Average standard deviation of split frequencies: 0.015598

      90500 -- [-531.808] (-543.599) (-543.077) (-534.394) * (-542.715) [-536.949] (-539.765) (-538.351) -- 0:01:40
      91000 -- [-536.973] (-539.100) (-546.215) (-534.666) * (-547.891) (-538.706) (-545.302) [-533.843] -- 0:01:39
      91500 -- [-534.192] (-537.239) (-538.774) (-544.111) * (-535.257) [-539.963] (-538.834) (-535.816) -- 0:01:49
      92000 -- (-535.239) [-538.809] (-537.506) (-536.334) * (-535.891) [-540.009] (-536.327) (-539.434) -- 0:01:48
      92500 -- [-535.590] (-531.445) (-538.269) (-539.654) * (-543.478) (-543.873) [-540.392] (-539.203) -- 0:01:47
      93000 -- (-535.558) (-533.490) (-540.381) [-535.486] * [-538.048] (-537.265) (-542.282) (-534.187) -- 0:01:47
      93500 -- (-533.074) (-537.191) [-536.254] (-534.391) * (-535.610) [-535.139] (-541.263) (-537.386) -- 0:01:46
      94000 -- (-538.605) (-540.510) [-535.455] (-536.698) * (-539.031) (-536.879) [-537.178] (-536.224) -- 0:01:46
      94500 -- [-533.272] (-537.544) (-533.864) (-537.775) * [-537.940] (-537.631) (-539.951) (-544.261) -- 0:01:45
      95000 -- (-539.534) (-544.904) [-540.263] (-538.897) * (-538.287) (-541.958) (-539.760) [-535.081] -- 0:01:44

      Average standard deviation of split frequencies: 0.012276

      95500 -- [-540.270] (-548.103) (-539.159) (-536.837) * (-540.743) [-538.007] (-540.382) (-534.073) -- 0:01:44
      96000 -- (-541.731) (-538.332) (-544.735) [-537.578] * [-534.394] (-537.956) (-538.751) (-534.963) -- 0:01:43
      96500 -- [-532.848] (-543.788) (-536.304) (-535.529) * [-537.533] (-539.404) (-536.111) (-538.041) -- 0:01:42
      97000 -- (-537.402) (-542.347) [-534.426] (-535.138) * (-540.248) (-534.860) [-534.943] (-537.638) -- 0:01:42
      97500 -- (-538.394) (-541.017) (-539.930) [-535.957] * (-538.311) [-535.402] (-542.948) (-537.604) -- 0:01:41
      98000 -- (-537.803) (-537.941) (-539.226) [-536.939] * (-538.073) [-535.303] (-536.589) (-543.854) -- 0:01:41
      98500 -- (-539.185) [-538.394] (-540.669) (-543.050) * (-538.752) (-534.022) [-537.654] (-539.540) -- 0:01:40
      99000 -- [-544.216] (-548.752) (-538.932) (-549.280) * (-536.076) (-534.068) [-540.542] (-540.610) -- 0:01:40
      99500 -- (-540.680) [-539.133] (-538.902) (-539.736) * [-538.986] (-535.539) (-539.234) (-536.591) -- 0:01:39
      100000 -- (-539.684) (-545.231) (-550.431) [-545.226] * (-535.949) [-532.407] (-542.883) (-537.457) -- 0:01:48

      Average standard deviation of split frequencies: 0.009366

      100500 -- (-541.080) (-533.796) (-551.561) [-538.348] * (-541.604) [-538.920] (-538.978) (-531.775) -- 0:01:47
      101000 -- (-534.478) (-535.429) [-544.796] (-535.950) * (-542.090) [-540.342] (-544.696) (-535.893) -- 0:01:46
      101500 -- [-538.281] (-538.492) (-541.733) (-539.724) * (-537.452) [-534.592] (-549.507) (-535.926) -- 0:01:46
      102000 -- (-535.797) (-539.394) (-539.525) [-535.657] * (-541.145) [-537.105] (-540.664) (-535.418) -- 0:01:45
      102500 -- [-532.862] (-538.837) (-544.371) (-533.736) * [-535.846] (-534.600) (-542.205) (-537.169) -- 0:01:45
      103000 -- (-537.869) (-539.825) (-543.393) [-536.327] * (-538.512) [-538.967] (-539.959) (-535.685) -- 0:01:44
      103500 -- (-540.908) (-540.223) (-550.216) [-536.461] * (-536.727) (-538.082) (-538.495) [-539.325] -- 0:01:43
      104000 -- (-537.103) [-537.411] (-548.516) (-541.769) * (-535.493) [-536.216] (-538.865) (-535.223) -- 0:01:43
      104500 -- (-534.879) (-537.998) [-539.901] (-537.842) * (-536.212) (-534.808) (-544.344) [-532.642] -- 0:01:42
      105000 -- (-537.003) (-548.161) (-540.462) [-536.406] * [-536.608] (-539.139) (-544.056) (-532.006) -- 0:01:42

      Average standard deviation of split frequencies: 0.011118

      105500 -- (-537.822) (-536.328) [-545.314] (-535.078) * (-536.880) (-540.920) (-546.663) [-538.655] -- 0:01:41
      106000 -- (-538.333) (-536.483) (-542.188) [-537.013] * (-538.729) [-539.653] (-545.269) (-532.781) -- 0:01:41
      106500 -- (-543.765) (-535.484) (-547.910) [-540.884] * (-536.019) [-537.900] (-548.890) (-534.487) -- 0:01:40
      107000 -- (-541.143) [-534.330] (-540.256) (-542.810) * (-538.839) [-536.510] (-541.821) (-540.143) -- 0:01:40
      107500 -- [-531.153] (-536.511) (-546.565) (-540.397) * (-535.293) (-538.223) [-539.950] (-542.802) -- 0:01:39
      108000 -- [-531.194] (-542.081) (-552.585) (-539.892) * (-537.052) [-533.481] (-544.366) (-540.672) -- 0:01:39
      108500 -- (-534.213) (-540.819) [-541.745] (-534.598) * (-532.942) [-537.769] (-538.350) (-541.982) -- 0:01:38
      109000 -- [-536.162] (-540.178) (-542.384) (-535.240) * (-537.850) [-544.473] (-541.728) (-537.248) -- 0:01:46
      109500 -- (-537.005) [-538.671] (-540.741) (-541.119) * [-533.056] (-536.925) (-545.550) (-544.550) -- 0:01:45
      110000 -- [-535.502] (-537.605) (-537.374) (-539.232) * (-534.105) (-543.842) (-541.588) [-539.062] -- 0:01:45

      Average standard deviation of split frequencies: 0.006390

      110500 -- (-537.554) [-536.274] (-552.125) (-543.265) * (-537.166) [-536.617] (-543.278) (-542.773) -- 0:01:44
      111000 -- (-536.162) [-538.378] (-535.822) (-534.311) * [-540.597] (-539.280) (-544.524) (-540.396) -- 0:01:44
      111500 -- (-535.798) (-539.263) [-539.322] (-536.999) * [-539.154] (-542.859) (-545.515) (-543.348) -- 0:01:43
      112000 -- [-535.697] (-544.252) (-539.193) (-532.240) * (-539.275) [-537.209] (-544.786) (-541.852) -- 0:01:43
      112500 -- (-546.096) [-540.862] (-545.329) (-533.621) * (-538.246) (-539.634) [-538.168] (-545.669) -- 0:01:42
      113000 -- [-541.524] (-538.779) (-537.191) (-536.492) * [-531.845] (-541.460) (-546.181) (-545.289) -- 0:01:42
      113500 -- (-542.270) (-535.992) (-541.014) [-542.823] * [-534.630] (-542.135) (-542.972) (-544.262) -- 0:01:41
      114000 -- (-535.605) (-535.943) (-546.426) [-537.397] * (-537.449) (-544.011) (-542.970) [-542.518] -- 0:01:41
      114500 -- [-535.960] (-536.449) (-541.684) (-535.780) * (-538.915) (-534.886) (-541.277) [-538.117] -- 0:01:40
      115000 -- (-533.333) (-538.969) (-544.980) [-538.512] * (-537.554) [-536.646] (-544.007) (-540.329) -- 0:01:40

      Average standard deviation of split frequencies: 0.006096

      115500 -- (-533.095) (-538.560) (-540.038) [-538.475] * (-539.316) [-540.580] (-544.412) (-538.805) -- 0:01:39
      116000 -- (-534.468) (-537.358) (-539.829) [-540.124] * (-539.321) [-537.522] (-543.660) (-536.358) -- 0:01:39
      116500 -- (-538.889) (-536.610) (-541.857) [-535.150] * (-546.865) (-545.007) [-542.691] (-542.048) -- 0:01:38
      117000 -- [-534.869] (-536.779) (-546.968) (-542.072) * [-534.727] (-537.543) (-539.548) (-543.272) -- 0:01:38
      117500 -- [-535.084] (-536.520) (-537.040) (-545.586) * (-542.668) [-539.612] (-546.610) (-537.870) -- 0:01:45
      118000 -- [-533.199] (-545.029) (-548.915) (-539.944) * (-541.548) (-546.220) (-551.044) [-539.929] -- 0:01:44
      118500 -- [-535.522] (-539.599) (-543.505) (-532.951) * (-539.897) (-538.827) [-537.519] (-540.743) -- 0:01:44
      119000 -- (-540.838) (-540.093) (-544.209) [-537.948] * (-539.468) (-542.305) [-542.830] (-538.572) -- 0:01:43
      119500 -- [-539.962] (-536.926) (-537.391) (-534.607) * [-533.969] (-538.655) (-535.610) (-538.527) -- 0:01:43
      120000 -- (-532.815) (-538.621) [-536.066] (-540.520) * (-538.767) [-538.214] (-537.367) (-537.160) -- 0:01:42

      Average standard deviation of split frequencies: 0.007813

      120500 -- (-535.132) (-547.487) (-536.336) [-535.783] * [-536.605] (-536.598) (-535.333) (-541.361) -- 0:01:42
      121000 -- (-537.548) (-544.596) [-536.792] (-533.915) * (-542.211) (-544.884) [-537.333] (-547.804) -- 0:01:41
      121500 -- (-532.638) (-544.697) [-535.734] (-532.986) * (-535.604) (-541.381) [-539.735] (-542.279) -- 0:01:41
      122000 -- (-534.436) (-545.003) (-536.077) [-533.124] * (-540.094) (-542.081) (-537.546) [-537.293] -- 0:01:40
      122500 -- (-537.346) (-548.624) (-544.218) [-538.674] * (-541.058) [-535.207] (-537.567) (-539.450) -- 0:01:40
      123000 -- (-531.841) (-548.885) (-538.179) [-539.094] * (-542.661) (-541.095) [-535.442] (-543.859) -- 0:01:39
      123500 -- (-539.503) (-548.175) [-538.712] (-543.558) * (-538.677) [-536.584] (-539.928) (-539.053) -- 0:01:39
      124000 -- (-534.226) (-539.669) (-545.143) [-539.059] * [-537.838] (-534.740) (-538.032) (-533.459) -- 0:01:38
      124500 -- [-535.715] (-537.008) (-540.907) (-542.372) * (-539.915) (-535.525) (-535.671) [-538.826] -- 0:01:38
      125000 -- [-532.299] (-535.542) (-540.104) (-536.131) * (-537.901) (-539.895) [-531.843] (-536.517) -- 0:01:38

      Average standard deviation of split frequencies: 0.009353

      125500 -- (-537.236) [-539.522] (-539.557) (-532.880) * (-533.951) [-535.582] (-542.234) (-540.127) -- 0:01:37
      126000 -- (-531.476) [-538.843] (-538.482) (-538.272) * (-539.620) (-538.224) (-536.154) [-532.685] -- 0:01:44
      126500 -- [-535.296] (-549.250) (-539.204) (-539.364) * (-540.703) (-536.586) (-537.694) [-537.680] -- 0:01:43
      127000 -- [-536.050] (-545.138) (-534.583) (-537.258) * (-537.572) (-540.908) (-535.426) [-532.768] -- 0:01:43
      127500 -- [-543.245] (-539.451) (-534.319) (-539.780) * (-543.186) (-535.573) (-537.999) [-538.825] -- 0:01:42
      128000 -- [-541.795] (-535.877) (-536.493) (-539.185) * (-538.967) [-536.396] (-535.479) (-534.979) -- 0:01:42
      128500 -- (-537.378) (-535.454) [-531.394] (-538.035) * [-542.504] (-535.110) (-544.748) (-532.626) -- 0:01:41
      129000 -- (-542.680) (-536.514) [-537.777] (-536.707) * (-542.464) (-542.751) (-540.363) [-534.124] -- 0:01:41
      129500 -- (-540.967) [-537.919] (-544.121) (-535.699) * [-535.185] (-536.703) (-541.853) (-534.616) -- 0:01:40
      130000 -- [-536.688] (-544.471) (-536.807) (-545.039) * (-537.875) (-536.193) (-537.926) [-535.033] -- 0:01:40

      Average standard deviation of split frequencies: 0.009019

      130500 -- (-538.225) (-543.750) [-538.352] (-545.493) * (-541.322) (-534.805) [-533.274] (-537.768) -- 0:01:39
      131000 -- (-542.751) [-542.039] (-544.163) (-535.122) * (-534.212) (-543.366) (-541.271) [-537.182] -- 0:01:39
      131500 -- (-540.004) (-536.430) [-532.473] (-536.035) * (-535.274) (-537.276) (-547.104) [-537.020] -- 0:01:39
      132000 -- (-542.867) (-542.153) [-534.805] (-538.450) * (-535.237) [-533.005] (-537.787) (-536.512) -- 0:01:38
      132500 -- (-535.244) (-533.634) [-542.299] (-536.874) * (-543.010) [-537.820] (-534.649) (-537.897) -- 0:01:38
      133000 -- (-537.027) (-537.588) (-534.751) [-537.573] * (-540.438) (-536.898) [-537.445] (-540.342) -- 0:01:37
      133500 -- (-539.635) (-537.520) (-539.904) [-532.369] * (-539.265) (-537.532) (-542.496) [-539.672] -- 0:01:37
      134000 -- (-535.296) [-536.534] (-537.249) (-536.164) * (-538.956) (-540.420) [-536.492] (-536.385) -- 0:01:36
      134500 -- (-542.765) (-536.731) [-534.250] (-538.168) * [-536.552] (-538.407) (-544.870) (-539.553) -- 0:01:36
      135000 -- (-535.794) (-538.629) [-533.290] (-543.122) * [-539.176] (-538.656) (-541.240) (-539.573) -- 0:01:42

      Average standard deviation of split frequencies: 0.006932

      135500 -- (-539.157) (-546.720) [-536.852] (-538.450) * (-538.813) (-536.401) (-539.724) [-540.147] -- 0:01:42
      136000 -- (-541.101) [-531.428] (-537.739) (-538.729) * (-546.894) (-534.657) [-534.857] (-538.663) -- 0:01:41
      136500 -- (-536.364) (-542.679) (-538.777) [-535.658] * (-537.743) (-540.970) (-538.860) [-538.007] -- 0:01:41
      137000 -- [-534.465] (-537.315) (-533.767) (-536.299) * (-542.511) [-536.664] (-544.429) (-542.429) -- 0:01:40
      137500 -- (-537.761) (-532.116) (-542.243) [-535.448] * (-536.677) (-550.048) [-534.929] (-537.716) -- 0:01:40
      138000 -- (-534.190) [-532.213] (-537.951) (-533.432) * (-538.191) (-546.140) (-535.092) [-534.554] -- 0:01:39
      138500 -- (-534.422) (-536.177) [-538.759] (-540.754) * (-536.862) (-536.212) [-533.169] (-534.894) -- 0:01:39
      139000 -- (-542.326) (-534.146) [-537.424] (-540.984) * (-543.332) (-534.938) [-535.738] (-542.820) -- 0:01:39
      139500 -- (-543.949) (-536.309) [-541.489] (-537.562) * (-540.806) (-531.754) [-532.859] (-548.708) -- 0:01:38
      140000 -- (-542.591) [-531.787] (-533.206) (-534.790) * (-536.792) (-540.111) (-538.239) [-542.200] -- 0:01:38

      Average standard deviation of split frequencies: 0.003351

      140500 -- (-539.940) [-534.590] (-539.438) (-538.076) * [-537.856] (-533.230) (-536.390) (-543.287) -- 0:01:37
      141000 -- (-534.878) (-544.444) [-538.086] (-543.174) * (-539.469) (-539.157) [-535.035] (-541.132) -- 0:01:37
      141500 -- [-536.877] (-536.818) (-545.942) (-540.242) * (-547.484) (-538.704) (-532.972) [-546.830] -- 0:01:37
      142000 -- (-536.450) (-537.834) [-533.802] (-543.073) * (-541.027) [-534.989] (-547.027) (-534.240) -- 0:01:36
      142500 -- (-537.783) (-540.511) [-533.209] (-543.234) * (-536.799) [-533.354] (-540.630) (-536.530) -- 0:01:36
      143000 -- (-534.576) [-532.322] (-533.039) (-539.804) * (-534.367) (-531.987) (-539.115) [-534.659] -- 0:01:35
      143500 -- (-535.889) (-535.656) [-535.470] (-536.967) * (-538.886) [-536.680] (-541.738) (-539.591) -- 0:01:35
      144000 -- (-534.819) [-534.623] (-541.423) (-538.560) * (-539.263) (-541.883) (-538.694) [-538.732] -- 0:01:41
      144500 -- [-533.257] (-535.840) (-539.347) (-537.256) * (-534.994) (-547.430) (-533.665) [-542.416] -- 0:01:40
      145000 -- (-541.013) (-541.395) (-535.928) [-532.650] * (-540.193) (-541.141) (-534.293) [-537.933] -- 0:01:40

      Average standard deviation of split frequencies: 0.004843

      145500 -- (-537.000) [-531.497] (-538.312) (-540.238) * (-533.616) (-540.304) [-533.592] (-533.277) -- 0:01:39
      146000 -- (-539.085) (-541.504) (-535.185) [-534.379] * [-534.684] (-544.186) (-539.947) (-540.006) -- 0:01:39
      146500 -- (-535.759) (-545.333) (-537.791) [-536.546] * (-541.977) (-540.989) [-534.326] (-542.244) -- 0:01:39
      147000 -- (-541.295) (-538.409) [-533.749] (-536.952) * (-540.136) [-537.742] (-545.750) (-542.040) -- 0:01:38
      147500 -- (-536.256) [-532.642] (-535.791) (-539.957) * (-535.119) [-541.470] (-540.191) (-539.305) -- 0:01:38
      148000 -- [-542.903] (-533.496) (-539.833) (-531.493) * (-536.273) (-546.137) (-533.574) [-537.265] -- 0:01:37
      148500 -- (-538.566) [-536.452] (-534.663) (-533.682) * (-543.155) (-538.251) (-550.495) [-534.387] -- 0:01:37
      149000 -- (-541.964) [-533.756] (-536.305) (-537.504) * (-536.605) (-538.289) (-543.896) [-539.394] -- 0:01:37
      149500 -- (-535.780) (-534.062) [-532.228] (-533.953) * [-534.204] (-534.886) (-540.081) (-537.559) -- 0:01:36
      150000 -- [-538.098] (-537.166) (-537.111) (-536.545) * (-539.403) (-536.030) (-539.963) [-531.019] -- 0:01:36

      Average standard deviation of split frequencies: 0.004693

      150500 -- (-539.473) (-536.973) (-535.496) [-532.893] * [-535.134] (-534.910) (-534.981) (-533.387) -- 0:01:35
      151000 -- (-535.930) [-536.663] (-535.048) (-533.602) * (-548.372) [-537.313] (-533.841) (-533.699) -- 0:01:35
      151500 -- [-536.303] (-539.808) (-534.370) (-548.779) * (-537.560) (-538.683) [-531.252] (-538.042) -- 0:01:35
      152000 -- (-538.152) [-535.447] (-538.181) (-534.205) * (-539.839) (-539.265) [-531.147] (-539.416) -- 0:01:34
      152500 -- (-538.579) (-538.127) (-535.653) [-533.565] * (-539.804) (-536.309) [-535.276] (-537.392) -- 0:01:40
      153000 -- (-537.882) (-536.228) (-537.142) [-538.287] * (-535.620) (-538.469) [-542.430] (-536.982) -- 0:01:39
      153500 -- (-536.780) [-538.250] (-535.547) (-541.524) * [-535.780] (-543.479) (-543.900) (-535.185) -- 0:01:39
      154000 -- (-544.516) (-537.621) [-537.503] (-542.768) * (-538.570) [-537.705] (-538.255) (-536.653) -- 0:01:38
      154500 -- (-539.100) (-534.961) (-541.989) [-538.136] * (-536.324) (-539.104) (-538.553) [-529.867] -- 0:01:38
      155000 -- (-543.894) (-542.482) [-537.463] (-541.385) * (-536.771) (-541.605) [-540.489] (-538.809) -- 0:01:38

      Average standard deviation of split frequencies: 0.003022

      155500 -- (-540.098) [-536.043] (-537.221) (-534.747) * (-539.264) (-536.549) (-535.894) [-532.290] -- 0:01:37
      156000 -- [-534.329] (-539.043) (-535.397) (-547.214) * [-534.438] (-540.498) (-540.845) (-534.813) -- 0:01:37
      156500 -- (-541.317) [-534.587] (-536.698) (-544.413) * (-530.958) [-545.277] (-538.678) (-535.520) -- 0:01:37
      157000 -- (-538.423) (-542.500) [-534.576] (-546.248) * [-536.247] (-542.699) (-538.586) (-538.321) -- 0:01:36
      157500 -- (-538.806) (-535.222) (-532.147) [-536.758] * [-538.080] (-538.471) (-534.011) (-537.893) -- 0:01:36
      158000 -- [-534.743] (-537.204) (-533.869) (-540.815) * (-539.379) [-538.019] (-533.147) (-539.411) -- 0:01:35
      158500 -- (-532.505) (-539.324) [-531.473] (-533.078) * (-541.597) [-537.955] (-544.089) (-534.072) -- 0:01:35
      159000 -- (-539.101) (-533.568) [-538.696] (-536.887) * (-542.909) (-539.004) [-538.544] (-533.706) -- 0:01:35
      159500 -- [-537.061] (-540.527) (-533.347) (-539.194) * (-538.758) [-538.457] (-538.248) (-539.433) -- 0:01:34
      160000 -- (-543.503) (-538.993) (-533.125) [-536.405] * [-538.234] (-543.567) (-537.867) (-535.557) -- 0:01:34

      Average standard deviation of split frequencies: 0.001467

      160500 -- (-544.261) (-544.261) (-540.397) [-539.353] * (-540.155) (-540.317) (-540.430) [-539.152] -- 0:01:34
      161000 -- (-544.023) (-537.064) (-542.033) [-536.050] * (-535.996) (-541.508) [-535.042] (-538.636) -- 0:01:39
      161500 -- [-535.930] (-536.723) (-529.402) (-536.928) * [-538.441] (-552.359) (-537.585) (-535.334) -- 0:01:38
      162000 -- (-537.803) (-544.500) [-531.285] (-534.197) * (-537.456) (-538.362) (-538.461) [-541.615] -- 0:01:38
      162500 -- (-537.909) (-537.218) (-543.886) [-533.036] * [-538.829] (-546.439) (-543.659) (-543.818) -- 0:01:37
      163000 -- [-537.430] (-545.557) (-533.548) (-532.296) * (-536.405) (-535.330) (-538.505) [-537.836] -- 0:01:37
      163500 -- [-534.571] (-541.404) (-535.667) (-539.352) * (-535.827) [-539.223] (-538.321) (-540.680) -- 0:01:37
      164000 -- [-539.128] (-537.909) (-539.294) (-536.292) * (-540.769) [-537.081] (-538.564) (-544.494) -- 0:01:36
      164500 -- (-540.406) [-536.735] (-538.921) (-534.996) * [-538.148] (-537.300) (-535.414) (-542.334) -- 0:01:36
      165000 -- (-545.847) (-535.986) [-535.642] (-532.718) * (-543.533) [-536.869] (-535.188) (-546.271) -- 0:01:36

      Average standard deviation of split frequencies: 0.001420

      165500 -- [-534.228] (-539.405) (-546.947) (-537.008) * (-542.502) [-536.594] (-531.110) (-542.477) -- 0:01:35
      166000 -- (-541.954) (-533.801) (-539.164) [-539.262] * (-543.890) [-541.175] (-540.246) (-541.171) -- 0:01:35
      166500 -- (-542.948) (-533.938) [-536.677] (-541.830) * (-539.547) (-537.210) (-537.318) [-534.515] -- 0:01:35
      167000 -- (-546.591) [-533.879] (-540.533) (-535.626) * (-541.285) [-537.503] (-536.230) (-539.001) -- 0:01:34
      167500 -- (-544.751) (-534.921) [-536.196] (-540.075) * (-544.422) (-547.122) [-540.750] (-540.038) -- 0:01:34
      168000 -- (-542.151) (-541.281) (-541.459) [-542.373] * (-541.550) (-545.677) [-536.470] (-544.471) -- 0:01:34
      168500 -- [-539.461] (-536.224) (-538.146) (-545.103) * (-543.624) (-537.305) [-533.019] (-548.603) -- 0:01:33
      169000 -- [-535.306] (-539.320) (-537.136) (-551.038) * (-538.446) [-538.139] (-535.036) (-544.710) -- 0:01:33
      169500 -- [-537.494] (-544.892) (-538.625) (-542.530) * (-538.871) (-541.076) (-537.432) [-541.032] -- 0:01:33
      170000 -- (-536.486) (-540.697) [-536.639] (-542.560) * (-541.271) (-547.786) (-542.269) [-535.763] -- 0:01:37

      Average standard deviation of split frequencies: 0.002762

      170500 -- (-545.701) [-541.903] (-541.799) (-548.424) * (-539.963) (-537.704) (-542.213) [-542.130] -- 0:01:37
      171000 -- (-543.719) (-536.194) [-538.913] (-539.969) * [-545.428] (-534.484) (-548.890) (-538.886) -- 0:01:36
      171500 -- [-540.698] (-541.274) (-533.315) (-544.001) * (-540.376) (-535.653) [-537.647] (-539.186) -- 0:01:36
      172000 -- (-541.068) [-537.614] (-536.451) (-540.134) * (-537.550) (-539.381) (-535.643) [-540.414] -- 0:01:36
      172500 -- (-539.738) [-534.689] (-538.179) (-540.883) * [-537.710] (-545.016) (-540.947) (-540.439) -- 0:01:35
      173000 -- [-535.035] (-533.740) (-537.938) (-537.088) * [-538.987] (-535.636) (-539.035) (-538.791) -- 0:01:35
      173500 -- (-539.172) (-539.853) [-536.673] (-538.744) * (-542.419) [-533.773] (-538.348) (-544.004) -- 0:01:35
      174000 -- [-537.348] (-535.273) (-547.715) (-544.855) * (-534.905) (-542.788) [-535.019] (-542.204) -- 0:01:34
      174500 -- (-542.614) [-536.250] (-536.733) (-539.028) * (-540.648) (-536.911) (-534.613) [-538.507] -- 0:01:34
      175000 -- (-541.576) (-541.379) [-541.546] (-542.532) * (-548.354) [-539.433] (-531.433) (-539.221) -- 0:01:34

      Average standard deviation of split frequencies: 0.001339

      175500 -- [-536.827] (-531.167) (-544.561) (-544.671) * (-540.170) [-535.009] (-540.198) (-538.289) -- 0:01:33
      176000 -- (-534.698) (-536.156) (-542.440) [-542.089] * (-543.703) (-540.088) [-530.581] (-541.694) -- 0:01:33
      176500 -- [-533.850] (-534.112) (-542.712) (-538.221) * (-540.809) (-537.119) [-539.069] (-545.588) -- 0:01:33
      177000 -- [-536.167] (-538.461) (-537.520) (-539.673) * (-536.644) (-535.047) [-537.543] (-544.599) -- 0:01:32
      177500 -- (-544.389) (-536.885) [-539.365] (-538.598) * (-542.844) [-537.256] (-539.211) (-544.428) -- 0:01:32
      178000 -- (-543.230) (-533.838) (-541.091) [-536.925] * [-538.743] (-538.235) (-541.918) (-543.660) -- 0:01:32
      178500 -- (-541.603) [-534.711] (-540.776) (-535.629) * (-542.066) (-545.646) (-543.478) [-535.901] -- 0:01:36
      179000 -- (-539.833) (-533.790) [-543.529] (-536.512) * [-539.753] (-539.831) (-540.753) (-542.397) -- 0:01:36
      179500 -- (-535.898) [-535.305] (-542.492) (-537.665) * (-543.194) (-535.679) [-531.083] (-542.087) -- 0:01:35
      180000 -- (-538.808) [-533.708] (-544.180) (-539.805) * [-538.090] (-539.906) (-537.260) (-544.649) -- 0:01:35

      Average standard deviation of split frequencies: 0.001305

      180500 -- [-533.991] (-541.383) (-545.483) (-536.165) * (-549.766) (-542.557) [-531.001] (-543.045) -- 0:01:35
      181000 -- (-534.506) (-540.199) (-539.120) [-539.922] * (-542.037) (-537.632) [-534.349] (-539.869) -- 0:01:35
      181500 -- [-538.895] (-536.464) (-536.329) (-535.780) * [-548.336] (-536.043) (-536.713) (-538.264) -- 0:01:34
      182000 -- (-535.407) (-533.810) (-541.321) [-540.159] * (-545.679) (-537.788) [-539.758] (-543.434) -- 0:01:34
      182500 -- (-540.783) [-534.632] (-542.458) (-538.675) * [-537.984] (-538.637) (-538.156) (-549.240) -- 0:01:34
      183000 -- (-536.726) [-534.764] (-539.841) (-536.342) * (-538.733) (-539.206) [-541.357] (-547.391) -- 0:01:33
      183500 -- (-536.640) [-536.110] (-534.587) (-541.184) * [-539.049] (-547.319) (-545.567) (-538.111) -- 0:01:33
      184000 -- [-538.791] (-532.943) (-543.522) (-539.277) * (-550.139) (-540.584) (-541.630) [-539.539] -- 0:01:33
      184500 -- (-535.485) (-537.912) (-542.816) [-542.231] * (-535.882) [-541.196] (-540.965) (-541.685) -- 0:01:32
      185000 -- (-535.107) [-537.148] (-540.402) (-533.745) * (-537.379) [-540.706] (-544.876) (-542.925) -- 0:01:32

      Average standard deviation of split frequencies: 0.001267

      185500 -- [-534.649] (-534.309) (-538.568) (-541.764) * (-535.764) (-540.972) [-536.495] (-538.127) -- 0:01:32
      186000 -- [-538.005] (-538.622) (-537.254) (-538.628) * (-539.027) [-540.574] (-537.258) (-540.841) -- 0:01:31
      186500 -- (-547.630) (-535.577) [-540.528] (-538.172) * [-537.381] (-538.175) (-538.118) (-545.089) -- 0:01:31
      187000 -- (-535.823) (-542.220) (-535.065) [-536.460] * (-531.324) [-535.373] (-543.436) (-543.451) -- 0:01:31
      187500 -- (-540.915) [-536.984] (-534.010) (-536.471) * (-537.504) [-536.101] (-542.918) (-537.583) -- 0:01:35
      188000 -- (-531.860) [-538.976] (-537.613) (-536.889) * (-543.786) (-535.904) (-540.619) [-540.052] -- 0:01:35
      188500 -- (-548.311) (-534.503) (-535.130) [-536.727] * (-536.794) (-538.964) (-539.868) [-539.785] -- 0:01:34
      189000 -- (-548.021) (-537.863) [-541.463] (-536.422) * [-535.733] (-543.244) (-535.651) (-540.809) -- 0:01:34
      189500 -- (-535.573) [-531.904] (-540.777) (-533.277) * (-542.235) (-542.898) [-540.359] (-543.070) -- 0:01:34
      190000 -- (-536.833) [-537.439] (-541.518) (-538.626) * (-543.060) (-544.086) (-545.609) [-539.712] -- 0:01:33

      Average standard deviation of split frequencies: 0.003709

      190500 -- (-544.168) (-534.028) (-550.403) [-536.702] * (-538.924) [-535.654] (-545.126) (-535.635) -- 0:01:33
      191000 -- (-533.398) [-545.539] (-548.520) (-540.133) * [-535.588] (-540.582) (-542.476) (-542.447) -- 0:01:33
      191500 -- (-535.180) [-535.683] (-543.243) (-544.182) * (-541.404) [-539.567] (-535.645) (-535.594) -- 0:01:32
      192000 -- (-536.424) [-537.931] (-543.024) (-536.223) * [-533.280] (-545.181) (-544.806) (-534.100) -- 0:01:32
      192500 -- (-538.239) (-539.201) [-545.172] (-537.208) * [-535.229] (-543.069) (-538.111) (-537.803) -- 0:01:32
      193000 -- (-542.069) [-539.555] (-542.382) (-536.017) * (-543.342) [-533.205] (-539.589) (-538.629) -- 0:01:31
      193500 -- [-535.538] (-542.609) (-550.103) (-542.307) * (-538.037) (-535.538) (-535.459) [-537.324] -- 0:01:31
      194000 -- (-537.378) (-541.600) [-544.810] (-541.644) * (-536.737) (-538.951) [-537.431] (-535.459) -- 0:01:31
      194500 -- (-538.862) (-540.326) (-542.558) [-534.326] * (-541.124) [-538.110] (-542.465) (-535.216) -- 0:01:31
      195000 -- [-536.061] (-538.177) (-541.157) (-539.652) * [-536.480] (-535.636) (-537.804) (-539.187) -- 0:01:30

      Average standard deviation of split frequencies: 0.002405

      195500 -- (-539.563) (-538.597) (-535.012) [-541.960] * (-540.376) (-542.988) (-541.238) [-534.349] -- 0:01:30
      196000 -- (-541.258) (-539.059) (-536.539) [-532.056] * (-541.749) [-534.080] (-539.442) (-533.499) -- 0:01:34
      196500 -- [-536.384] (-541.138) (-537.046) (-536.604) * (-541.928) (-539.599) [-538.303] (-540.937) -- 0:01:34
      197000 -- [-538.239] (-534.981) (-538.173) (-536.953) * [-536.072] (-539.425) (-535.522) (-537.143) -- 0:01:33
      197500 -- (-536.123) (-539.939) (-537.448) [-532.383] * (-543.073) [-538.428] (-538.680) (-542.662) -- 0:01:33
      198000 -- [-533.444] (-540.175) (-547.620) (-537.922) * [-543.395] (-534.025) (-535.091) (-547.310) -- 0:01:33
      198500 -- (-531.801) (-539.563) [-534.246] (-537.419) * (-539.587) [-536.172] (-549.624) (-535.451) -- 0:01:32
      199000 -- (-534.738) (-547.384) (-535.862) [-535.008] * (-541.317) [-536.379] (-539.290) (-537.050) -- 0:01:32
      199500 -- (-541.893) (-541.209) (-539.115) [-533.048] * (-539.351) (-534.903) (-543.353) [-538.895] -- 0:01:32
      200000 -- (-538.582) (-538.329) (-539.574) [-534.203] * (-536.426) [-535.958] (-539.288) (-544.626) -- 0:01:32

      Average standard deviation of split frequencies: 0.003524

      200500 -- [-533.036] (-535.938) (-548.354) (-535.614) * (-536.491) [-535.541] (-534.958) (-541.926) -- 0:01:31
      201000 -- [-533.220] (-543.591) (-541.263) (-539.209) * (-541.404) [-547.848] (-544.818) (-538.478) -- 0:01:31
      201500 -- (-536.351) (-537.524) (-543.673) [-538.535] * (-540.855) (-535.917) (-544.891) [-535.857] -- 0:01:31
      202000 -- [-534.306] (-548.628) (-547.278) (-534.082) * (-542.003) [-537.067] (-542.280) (-539.917) -- 0:01:30
      202500 -- (-535.038) (-539.934) (-540.460) [-536.226] * [-539.088] (-542.535) (-535.969) (-544.058) -- 0:01:30
      203000 -- [-534.508] (-539.971) (-542.472) (-535.293) * (-538.683) [-536.264] (-536.918) (-541.423) -- 0:01:30
      203500 -- (-535.024) (-535.580) [-543.091] (-532.991) * [-539.997] (-540.791) (-539.851) (-548.449) -- 0:01:30
      204000 -- (-534.796) (-537.010) [-542.334] (-539.908) * [-542.684] (-539.659) (-538.142) (-537.767) -- 0:01:29
      204500 -- [-535.622] (-535.078) (-536.909) (-540.907) * (-539.428) (-536.701) [-541.437] (-541.315) -- 0:01:33
      205000 -- [-536.746] (-544.090) (-532.124) (-539.215) * (-543.262) (-538.937) (-533.922) [-538.408] -- 0:01:33

      Average standard deviation of split frequencies: 0.004577

      205500 -- (-537.647) [-534.923] (-534.986) (-544.497) * (-538.431) (-539.601) [-535.696] (-540.545) -- 0:01:32
      206000 -- (-538.957) [-539.767] (-539.766) (-540.325) * (-544.647) (-541.107) [-533.035] (-537.874) -- 0:01:32
      206500 -- [-534.289] (-534.377) (-534.797) (-543.012) * (-537.722) [-535.035] (-544.463) (-535.201) -- 0:01:32
      207000 -- (-538.264) [-537.798] (-542.161) (-542.239) * (-543.148) [-537.806] (-539.233) (-535.665) -- 0:01:31
      207500 -- (-545.404) (-534.663) (-537.082) [-535.661] * (-538.534) (-545.322) (-541.567) [-534.817] -- 0:01:31
      208000 -- (-534.973) [-535.492] (-540.295) (-534.566) * (-535.062) (-540.252) (-532.061) [-537.266] -- 0:01:31
      208500 -- [-538.618] (-536.768) (-534.944) (-531.651) * (-537.980) (-546.516) (-532.021) [-535.160] -- 0:01:31
      209000 -- (-539.646) (-535.639) (-544.515) [-532.810] * [-540.730] (-540.892) (-531.599) (-532.992) -- 0:01:30
      209500 -- (-535.151) (-531.681) (-542.600) [-533.149] * (-542.906) (-544.760) (-536.905) [-540.158] -- 0:01:30
      210000 -- (-535.091) (-543.047) [-540.045] (-531.278) * [-535.774] (-538.326) (-534.715) (-535.824) -- 0:01:30

      Average standard deviation of split frequencies: 0.002238

      210500 -- [-533.553] (-538.368) (-538.642) (-537.482) * (-541.834) (-539.177) [-538.265] (-540.879) -- 0:01:30
      211000 -- (-535.103) (-533.886) [-535.711] (-536.905) * (-540.648) (-540.068) (-533.471) [-537.039] -- 0:01:29
      211500 -- (-536.826) (-540.825) [-533.230] (-529.470) * [-537.476] (-544.627) (-535.687) (-536.261) -- 0:01:29
      212000 -- (-537.533) [-534.593] (-537.912) (-539.494) * (-538.657) (-546.555) [-536.100] (-538.151) -- 0:01:29
      212500 -- [-533.910] (-537.144) (-537.103) (-535.705) * (-536.314) (-536.756) [-534.068] (-538.549) -- 0:01:28
      213000 -- (-534.383) (-534.297) (-541.656) [-534.399] * [-536.627] (-541.100) (-531.417) (-540.906) -- 0:01:28
      213500 -- (-539.832) (-543.390) (-533.406) [-532.533] * (-539.277) (-542.675) (-535.130) [-536.892] -- 0:01:32
      214000 -- (-534.199) [-539.234] (-534.193) (-547.114) * (-543.298) [-540.315] (-538.923) (-543.478) -- 0:01:31
      214500 -- (-535.844) (-536.382) (-543.100) [-536.244] * (-536.817) (-550.076) [-531.348] (-539.513) -- 0:01:31
      215000 -- [-532.313] (-536.469) (-538.074) (-535.914) * (-541.368) (-539.595) [-538.195] (-541.626) -- 0:01:31

      Average standard deviation of split frequencies: 0.002182

      215500 -- (-532.250) [-536.309] (-533.916) (-537.284) * [-535.620] (-544.266) (-535.800) (-535.748) -- 0:01:31
      216000 -- (-532.194) [-534.168] (-537.410) (-544.748) * (-534.147) (-542.362) (-535.433) [-536.235] -- 0:01:30
      216500 -- (-535.750) (-534.704) (-541.601) [-541.128] * [-537.070] (-545.350) (-543.644) (-538.747) -- 0:01:30
      217000 -- (-535.510) (-537.603) [-534.738] (-537.412) * [-541.381] (-543.130) (-531.542) (-544.644) -- 0:01:30
      217500 -- (-534.372) (-544.699) (-536.418) [-540.617] * (-538.982) (-541.065) (-538.168) [-545.294] -- 0:01:29
      218000 -- (-544.888) (-532.744) (-541.917) [-541.751] * (-539.750) (-540.857) [-537.751] (-537.951) -- 0:01:29
      218500 -- (-539.030) [-534.459] (-539.457) (-539.322) * (-538.406) [-534.594] (-537.480) (-535.723) -- 0:01:29
      219000 -- [-534.304] (-532.085) (-535.158) (-550.863) * (-539.511) (-539.215) (-540.712) [-535.833] -- 0:01:29
      219500 -- (-532.804) (-533.065) [-536.603] (-542.501) * (-539.268) (-538.677) (-537.596) [-532.740] -- 0:01:28
      220000 -- (-538.811) [-538.577] (-538.081) (-543.455) * [-537.134] (-541.705) (-538.881) (-535.457) -- 0:01:28

      Average standard deviation of split frequencies: 0.003204

      220500 -- (-540.760) (-534.263) (-544.473) [-538.509] * (-541.792) (-536.144) [-535.437] (-537.676) -- 0:01:28
      221000 -- [-537.755] (-540.391) (-537.462) (-535.038) * (-540.194) (-542.177) (-536.241) [-533.986] -- 0:01:28
      221500 -- (-532.383) (-535.679) [-539.575] (-534.557) * (-539.838) (-547.555) (-539.544) [-530.120] -- 0:01:27
      222000 -- (-536.198) (-537.767) (-541.197) [-536.238] * (-536.024) (-539.697) (-538.751) [-533.445] -- 0:01:31
      222500 -- (-534.935) (-535.909) (-538.643) [-537.445] * (-543.141) [-535.897] (-538.161) (-543.408) -- 0:01:30
      223000 -- (-545.430) (-538.309) (-539.457) [-536.880] * (-542.803) [-540.246] (-539.940) (-535.114) -- 0:01:30
      223500 -- [-533.252] (-532.334) (-541.953) (-535.011) * (-536.342) (-541.154) (-540.228) [-534.718] -- 0:01:30
      224000 -- [-533.494] (-532.926) (-549.193) (-533.625) * (-537.634) (-549.202) [-543.285] (-546.751) -- 0:01:30
      224500 -- (-543.591) [-535.789] (-539.310) (-533.518) * (-542.992) (-538.056) [-537.286] (-540.721) -- 0:01:29
      225000 -- (-543.238) (-533.690) [-537.014] (-537.054) * (-540.600) (-544.273) (-535.925) [-536.428] -- 0:01:29

      Average standard deviation of split frequencies: 0.001043

      225500 -- [-535.972] (-541.807) (-542.852) (-537.157) * [-537.998] (-537.966) (-535.886) (-552.080) -- 0:01:29
      226000 -- (-544.371) [-538.092] (-557.560) (-535.744) * [-539.956] (-537.690) (-534.816) (-536.477) -- 0:01:29
      226500 -- [-540.146] (-538.498) (-541.497) (-538.763) * (-549.341) (-534.251) [-538.415] (-533.013) -- 0:01:28
      227000 -- (-532.482) (-543.372) (-538.407) [-531.913] * (-542.120) (-542.685) (-541.980) [-535.655] -- 0:01:28
      227500 -- (-540.095) (-544.490) (-536.448) [-538.363] * (-539.951) (-545.755) (-536.660) [-536.345] -- 0:01:28
      228000 -- (-539.184) [-533.820] (-540.757) (-535.937) * (-543.300) (-538.732) [-535.332] (-535.425) -- 0:01:28
      228500 -- (-535.660) [-537.416] (-543.063) (-536.850) * (-533.313) (-541.983) [-534.841] (-537.951) -- 0:01:27
      229000 -- [-536.267] (-535.762) (-546.321) (-536.124) * (-536.088) (-543.872) (-532.512) [-531.487] -- 0:01:27
      229500 -- (-536.559) (-533.358) [-538.272] (-538.236) * (-543.423) (-544.989) (-535.957) [-535.060] -- 0:01:27
      230000 -- (-535.366) (-534.026) (-543.415) [-537.610] * (-540.914) (-541.444) [-534.783] (-534.902) -- 0:01:27

      Average standard deviation of split frequencies: 0.002044

      230500 -- (-536.339) (-543.243) (-541.519) [-535.324] * (-541.210) (-536.954) [-540.445] (-540.208) -- 0:01:26
      231000 -- (-537.857) [-536.196] (-540.025) (-534.910) * (-543.741) (-536.073) (-539.575) [-532.858] -- 0:01:29
      231500 -- (-539.005) (-540.659) (-540.083) [-533.452] * (-540.614) (-537.769) [-539.025] (-534.937) -- 0:01:29
      232000 -- (-538.669) (-540.657) (-538.047) [-536.582] * [-536.688] (-537.158) (-534.998) (-535.776) -- 0:01:29
      232500 -- (-536.549) (-537.377) (-547.149) [-539.666] * (-533.578) (-539.442) (-537.256) [-532.077] -- 0:01:29
      233000 -- (-534.115) (-539.159) (-537.707) [-537.929] * (-538.993) [-537.174] (-534.187) (-534.950) -- 0:01:28
      233500 -- (-542.076) [-540.998] (-541.896) (-539.161) * (-540.813) (-537.646) (-538.137) [-533.704] -- 0:01:28
      234000 -- [-533.579] (-544.334) (-536.355) (-540.754) * (-541.300) (-542.664) (-539.287) [-531.273] -- 0:01:28
      234500 -- (-539.717) (-539.525) [-539.989] (-534.679) * (-538.724) (-540.757) [-535.856] (-539.441) -- 0:01:28
      235000 -- (-538.019) [-533.623] (-545.225) (-542.035) * (-537.613) (-534.027) [-537.620] (-543.762) -- 0:01:27

      Average standard deviation of split frequencies: 0.002996

      235500 -- [-534.424] (-537.728) (-545.911) (-542.451) * [-536.841] (-537.063) (-537.079) (-534.455) -- 0:01:27
      236000 -- (-538.003) (-540.717) (-539.405) [-540.477] * (-539.603) [-539.678] (-540.422) (-534.273) -- 0:01:27
      236500 -- [-533.843] (-534.790) (-548.984) (-545.472) * (-535.964) (-538.583) (-540.743) [-534.314] -- 0:01:27
      237000 -- [-537.924] (-537.284) (-542.855) (-538.354) * [-541.751] (-549.603) (-544.395) (-534.642) -- 0:01:26
      237500 -- [-532.860] (-541.017) (-539.959) (-543.589) * (-540.114) (-542.032) [-538.485] (-536.678) -- 0:01:26
      238000 -- (-540.906) [-536.264] (-548.507) (-544.172) * (-534.615) [-540.399] (-536.101) (-538.919) -- 0:01:26
      238500 -- [-533.377] (-533.654) (-538.679) (-534.741) * (-534.917) (-536.919) (-534.310) [-538.973] -- 0:01:26
      239000 -- (-541.074) (-541.746) (-537.903) [-534.206] * (-535.086) [-534.858] (-536.615) (-537.909) -- 0:01:25
      239500 -- (-534.136) (-543.852) [-549.913] (-539.498) * (-535.174) [-536.398] (-539.025) (-533.452) -- 0:01:25
      240000 -- [-538.492] (-542.109) (-541.331) (-535.723) * [-537.677] (-542.798) (-540.232) (-538.378) -- 0:01:28

      Average standard deviation of split frequencies: 0.002938

      240500 -- [-535.851] (-543.149) (-540.787) (-536.617) * (-545.642) (-544.012) (-540.951) [-530.947] -- 0:01:28
      241000 -- (-539.100) (-540.209) [-531.783] (-535.634) * (-534.706) [-538.504] (-540.125) (-536.700) -- 0:01:28
      241500 -- (-536.476) (-539.295) (-532.722) [-535.990] * (-532.849) (-537.904) (-546.496) [-542.051] -- 0:01:27
      242000 -- (-542.811) [-539.008] (-545.394) (-536.725) * [-536.864] (-543.439) (-541.771) (-537.358) -- 0:01:27
      242500 -- (-539.663) (-540.274) (-535.258) [-533.176] * (-541.501) (-543.663) (-542.316) [-534.245] -- 0:01:27
      243000 -- [-533.651] (-542.638) (-537.078) (-537.937) * [-544.836] (-539.401) (-540.342) (-531.144) -- 0:01:27
      243500 -- (-541.644) (-536.346) (-534.508) [-536.380] * (-530.392) [-538.055] (-537.610) (-538.888) -- 0:01:26
      244000 -- (-533.312) [-538.337] (-541.000) (-538.121) * [-538.242] (-538.522) (-539.418) (-537.148) -- 0:01:26
      244500 -- (-541.269) (-541.546) (-536.822) [-537.394] * (-533.829) (-539.054) (-550.701) [-539.001] -- 0:01:26
      245000 -- (-536.340) (-538.153) (-543.155) [-534.430] * (-544.963) (-536.938) (-538.730) [-538.003] -- 0:01:26

      Average standard deviation of split frequencies: 0.003833

      245500 -- (-541.887) (-534.199) (-541.261) [-535.887] * (-540.024) [-538.426] (-540.655) (-537.555) -- 0:01:26
      246000 -- (-535.830) (-538.461) [-535.515] (-537.027) * [-536.056] (-536.439) (-541.760) (-536.858) -- 0:01:25
      246500 -- (-536.449) (-540.316) [-536.151] (-538.341) * (-539.924) (-534.700) (-543.109) [-532.845] -- 0:01:25
      247000 -- (-539.730) (-532.166) [-536.464] (-538.916) * [-539.583] (-538.322) (-539.565) (-536.394) -- 0:01:25
      247500 -- (-534.389) [-537.603] (-535.609) (-537.385) * [-533.201] (-542.089) (-540.950) (-535.140) -- 0:01:25
      248000 -- (-533.456) [-534.768] (-537.915) (-546.968) * (-534.831) [-537.880] (-540.217) (-535.381) -- 0:01:24
      248500 -- (-540.148) [-534.822] (-533.005) (-538.702) * (-536.751) (-538.046) (-536.524) [-536.751] -- 0:01:27
      249000 -- (-537.789) (-541.222) [-532.335] (-538.412) * (-536.583) (-533.120) (-542.291) [-531.347] -- 0:01:27
      249500 -- (-540.408) [-532.251] (-542.001) (-541.187) * (-538.184) (-532.985) (-540.244) [-535.194] -- 0:01:27
      250000 -- [-533.995] (-537.027) (-540.619) (-541.273) * (-541.440) (-534.161) (-539.338) [-536.976] -- 0:01:27

      Average standard deviation of split frequencies: 0.003761

      250500 -- (-537.905) [-536.628] (-540.465) (-542.278) * [-537.311] (-532.133) (-535.932) (-547.030) -- 0:01:26
      251000 -- (-535.327) [-531.447] (-535.691) (-538.552) * [-539.499] (-551.024) (-535.226) (-538.300) -- 0:01:26
      251500 -- [-535.200] (-537.636) (-535.116) (-535.070) * (-541.612) (-537.742) [-536.431] (-538.307) -- 0:01:26
      252000 -- (-536.490) (-535.308) [-534.554] (-543.464) * (-539.530) [-540.256] (-535.133) (-539.485) -- 0:01:26
      252500 -- [-535.590] (-535.089) (-539.947) (-539.509) * [-537.376] (-539.518) (-544.182) (-537.534) -- 0:01:25
      253000 -- (-537.058) [-537.885] (-544.265) (-541.080) * (-541.542) (-540.482) (-540.545) [-536.254] -- 0:01:25
      253500 -- (-542.660) (-531.799) [-535.753] (-541.305) * [-541.541] (-537.263) (-539.809) (-543.896) -- 0:01:25
      254000 -- (-535.164) [-536.604] (-536.593) (-536.901) * (-535.786) (-542.133) [-536.792] (-538.837) -- 0:01:25
      254500 -- (-544.119) (-540.220) [-539.135] (-537.004) * (-536.449) [-539.169] (-538.268) (-533.302) -- 0:01:24
      255000 -- (-542.395) (-537.012) (-540.898) [-532.001] * (-535.511) (-536.568) [-540.801] (-534.653) -- 0:01:24

      Average standard deviation of split frequencies: 0.004604

      255500 -- [-532.683] (-539.929) (-534.418) (-540.942) * (-541.536) (-539.836) (-539.895) [-536.097] -- 0:01:24
      256000 -- (-534.484) (-537.000) [-531.113] (-534.829) * [-538.623] (-544.201) (-536.143) (-536.881) -- 0:01:24
      256500 -- [-540.087] (-543.764) (-535.266) (-543.053) * (-540.619) [-537.017] (-544.062) (-540.148) -- 0:01:24
      257000 -- (-534.909) [-534.965] (-539.057) (-538.945) * (-546.430) (-536.363) (-540.672) [-536.413] -- 0:01:26
      257500 -- (-538.221) [-533.046] (-533.385) (-540.492) * (-539.586) [-538.141] (-536.042) (-536.647) -- 0:01:26
      258000 -- (-534.768) (-534.535) (-532.640) [-534.336] * (-537.515) [-534.716] (-540.893) (-542.231) -- 0:01:26
      258500 -- [-534.046] (-534.587) (-538.243) (-535.976) * (-548.202) (-535.060) (-535.223) [-537.428] -- 0:01:26
      259000 -- [-532.419] (-546.196) (-540.126) (-540.870) * (-546.820) (-537.092) (-535.591) [-537.567] -- 0:01:25
      259500 -- [-538.487] (-537.087) (-538.497) (-545.485) * (-542.981) (-537.502) [-539.513] (-541.803) -- 0:01:25
      260000 -- [-534.295] (-535.687) (-537.809) (-544.392) * (-544.462) [-536.897] (-535.714) (-541.259) -- 0:01:25

      Average standard deviation of split frequencies: 0.005425

      260500 -- (-536.723) (-533.795) (-544.825) [-536.361] * (-548.293) (-537.805) [-535.741] (-537.208) -- 0:01:25
      261000 -- [-541.588] (-538.353) (-540.170) (-533.888) * (-541.417) (-538.884) (-538.122) [-538.271] -- 0:01:24
      261500 -- [-543.986] (-539.234) (-537.003) (-538.825) * (-540.690) (-541.071) [-536.393] (-537.689) -- 0:01:24
      262000 -- (-536.649) (-535.917) [-536.989] (-541.188) * (-543.656) (-536.801) (-531.545) [-539.171] -- 0:01:24
      262500 -- (-540.684) (-532.416) (-537.086) [-546.835] * (-537.843) [-548.536] (-540.457) (-537.534) -- 0:01:24
      263000 -- (-534.562) (-535.012) [-533.661] (-543.357) * [-539.789] (-535.358) (-536.545) (-534.340) -- 0:01:24
      263500 -- (-541.697) (-537.690) (-534.353) [-536.098] * (-532.925) (-541.271) (-535.865) [-536.491] -- 0:01:23
      264000 -- [-535.905] (-538.054) (-540.784) (-539.324) * [-534.501] (-536.488) (-538.268) (-545.860) -- 0:01:23
      264500 -- (-538.175) (-534.311) (-539.608) [-538.947] * [-537.143] (-540.917) (-547.244) (-537.257) -- 0:01:23
      265000 -- (-541.095) (-540.492) (-533.150) [-540.082] * (-537.708) (-542.185) [-536.887] (-538.412) -- 0:01:23

      Average standard deviation of split frequencies: 0.005317

      265500 -- [-532.148] (-538.764) (-542.635) (-537.670) * (-534.819) (-545.354) (-534.720) [-535.582] -- 0:01:22
      266000 -- (-534.265) [-535.664] (-537.623) (-537.197) * (-536.358) (-544.712) (-534.668) [-535.257] -- 0:01:25
      266500 -- (-532.766) (-538.704) (-537.986) [-540.354] * (-535.426) (-537.387) [-533.949] (-538.265) -- 0:01:25
      267000 -- (-532.986) (-536.279) [-537.558] (-543.649) * [-541.956] (-537.064) (-534.193) (-537.959) -- 0:01:25
      267500 -- (-536.929) (-544.531) [-542.176] (-538.770) * [-539.083] (-544.159) (-538.228) (-542.599) -- 0:01:24
      268000 -- (-532.871) (-545.957) (-540.985) [-535.293] * (-542.187) (-541.037) (-539.906) [-548.759] -- 0:01:24
      268500 -- (-539.444) (-533.911) [-538.666] (-532.738) * [-536.391] (-537.764) (-537.146) (-538.850) -- 0:01:24
      269000 -- (-538.385) (-538.970) (-534.895) [-534.513] * (-542.524) (-535.313) [-534.344] (-537.275) -- 0:01:24
      269500 -- (-532.882) [-534.640] (-534.291) (-533.803) * [-544.605] (-540.674) (-540.822) (-539.820) -- 0:01:24
      270000 -- (-537.525) [-536.229] (-540.467) (-540.159) * (-540.774) (-543.270) [-545.984] (-539.799) -- 0:01:23

      Average standard deviation of split frequencies: 0.006967

      270500 -- (-536.169) (-534.308) (-536.546) [-536.838] * (-540.022) [-536.891] (-543.672) (-539.931) -- 0:01:23
      271000 -- (-539.741) [-534.537] (-543.510) (-540.861) * (-544.771) [-537.971] (-535.518) (-540.747) -- 0:01:23
      271500 -- (-541.486) (-539.497) (-537.118) [-539.822] * (-538.530) [-536.805] (-537.368) (-537.362) -- 0:01:23
      272000 -- [-539.684] (-532.351) (-534.752) (-546.013) * [-534.089] (-535.825) (-540.130) (-536.902) -- 0:01:22
      272500 -- (-534.581) (-534.276) (-534.433) [-538.063] * (-539.727) (-538.215) [-532.478] (-538.347) -- 0:01:22
      273000 -- (-537.778) [-536.523] (-536.709) (-543.975) * (-541.820) [-535.835] (-533.758) (-537.280) -- 0:01:22
      273500 -- (-536.140) (-543.951) [-533.910] (-539.631) * [-542.702] (-533.812) (-538.910) (-539.639) -- 0:01:22
      274000 -- (-534.250) [-535.646] (-541.137) (-540.372) * (-540.886) (-536.441) [-538.514] (-540.056) -- 0:01:22
      274500 -- (-533.986) (-534.236) [-535.415] (-535.522) * (-549.161) (-538.042) [-537.331] (-535.810) -- 0:01:24
      275000 -- (-536.289) [-532.791] (-539.205) (-533.835) * [-534.870] (-546.918) (-536.114) (-538.235) -- 0:01:24

      Average standard deviation of split frequencies: 0.005978

      275500 -- (-539.485) (-533.942) [-534.729] (-540.151) * (-541.016) [-536.616] (-538.871) (-537.258) -- 0:01:24
      276000 -- (-533.380) [-535.734] (-538.049) (-533.831) * [-534.511] (-535.490) (-531.627) (-545.047) -- 0:01:23
      276500 -- (-545.826) (-546.168) [-537.995] (-544.116) * [-536.003] (-541.770) (-541.113) (-543.764) -- 0:01:23
      277000 -- (-534.704) [-540.323] (-535.822) (-540.221) * [-533.510] (-538.951) (-533.366) (-538.230) -- 0:01:23
      277500 -- [-537.159] (-535.230) (-541.670) (-537.801) * (-537.325) [-537.529] (-536.657) (-540.391) -- 0:01:23
      278000 -- (-532.607) [-541.227] (-536.325) (-545.144) * (-543.794) [-535.358] (-543.121) (-538.826) -- 0:01:23
      278500 -- (-535.235) [-532.453] (-533.765) (-539.869) * [-535.354] (-534.910) (-538.891) (-544.951) -- 0:01:22
      279000 -- (-543.747) (-535.298) (-533.836) [-535.160] * (-534.557) (-542.373) (-534.715) [-543.344] -- 0:01:22
      279500 -- (-546.974) (-536.001) [-534.376] (-533.012) * [-535.887] (-538.013) (-536.173) (-540.881) -- 0:01:22
      280000 -- (-554.933) (-536.160) (-535.399) [-533.971] * (-536.241) (-533.978) [-536.569] (-537.169) -- 0:01:22

      Average standard deviation of split frequencies: 0.005879

      280500 -- (-539.512) [-535.414] (-532.954) (-538.802) * (-537.360) (-535.953) [-533.200] (-542.305) -- 0:01:22
      281000 -- [-539.769] (-530.914) (-538.156) (-536.025) * (-535.434) (-536.466) (-534.885) [-537.914] -- 0:01:21
      281500 -- (-538.582) (-535.331) (-536.724) [-540.711] * (-535.249) (-532.774) (-536.854) [-538.874] -- 0:01:21
      282000 -- (-540.238) [-538.449] (-534.394) (-540.692) * (-540.043) (-533.482) (-533.416) [-534.704] -- 0:01:21
      282500 -- [-535.026] (-536.398) (-537.175) (-534.945) * (-547.639) [-543.959] (-535.587) (-536.881) -- 0:01:21
      283000 -- (-540.668) (-536.977) (-537.860) [-536.854] * (-539.998) (-539.488) [-539.111] (-537.630) -- 0:01:23
      283500 -- (-538.336) (-538.426) (-543.819) [-537.120] * (-540.541) [-539.469] (-547.437) (-534.991) -- 0:01:23
      284000 -- [-533.994] (-534.845) (-538.973) (-537.366) * (-544.099) [-537.396] (-544.596) (-539.187) -- 0:01:23
      284500 -- (-538.147) (-537.766) [-537.512] (-537.682) * [-535.030] (-531.352) (-542.734) (-540.492) -- 0:01:22
      285000 -- [-537.975] (-539.703) (-539.413) (-540.634) * [-539.746] (-536.530) (-545.274) (-538.223) -- 0:01:22

      Average standard deviation of split frequencies: 0.006593

      285500 -- [-538.004] (-532.320) (-541.451) (-536.547) * (-538.361) [-543.066] (-544.537) (-548.159) -- 0:01:22
      286000 -- (-545.285) (-538.764) [-533.467] (-535.117) * [-548.700] (-537.533) (-542.154) (-540.823) -- 0:01:22
      286500 -- (-539.150) (-542.259) (-543.652) [-536.187] * (-544.296) [-538.614] (-549.050) (-537.157) -- 0:01:22
      287000 -- (-535.502) (-538.380) [-541.231] (-537.360) * (-532.488) [-538.112] (-544.984) (-540.856) -- 0:01:21
      287500 -- (-544.606) (-539.274) (-538.505) [-540.421] * (-535.597) (-537.122) (-543.195) [-537.913] -- 0:01:21
      288000 -- (-538.145) (-539.188) (-542.506) [-539.501] * [-535.736] (-534.605) (-542.269) (-537.148) -- 0:01:21
      288500 -- [-534.429] (-531.831) (-541.279) (-539.516) * (-532.977) [-537.745] (-550.526) (-541.399) -- 0:01:21
      289000 -- (-537.525) (-535.809) [-540.320] (-541.299) * (-546.517) [-533.718] (-547.256) (-541.625) -- 0:01:21
      289500 -- (-537.044) (-546.089) [-541.315] (-538.297) * (-543.879) (-537.205) (-546.865) [-540.614] -- 0:01:20
      290000 -- [-532.053] (-533.537) (-541.551) (-536.914) * (-539.113) [-535.185] (-547.934) (-539.538) -- 0:01:20

      Average standard deviation of split frequencies: 0.007298

      290500 -- [-539.305] (-533.676) (-542.139) (-541.444) * (-535.520) (-545.133) (-543.696) [-536.509] -- 0:01:20
      291000 -- (-535.891) [-533.457] (-539.531) (-529.997) * [-534.902] (-535.531) (-544.999) (-540.957) -- 0:01:20
      291500 -- (-533.437) (-532.361) [-539.924] (-535.029) * (-535.047) [-535.698] (-544.766) (-542.270) -- 0:01:20
      292000 -- (-535.877) [-532.248] (-543.558) (-539.558) * (-532.542) (-536.268) [-543.336] (-537.331) -- 0:01:22
      292500 -- [-535.907] (-532.656) (-538.707) (-540.002) * (-535.985) (-537.115) (-543.334) [-538.484] -- 0:01:22
      293000 -- [-534.243] (-539.816) (-540.443) (-537.297) * [-536.611] (-536.959) (-541.455) (-536.126) -- 0:01:22
      293500 -- (-534.617) [-535.437] (-542.473) (-537.917) * (-538.469) [-535.584] (-538.488) (-535.508) -- 0:01:21
      294000 -- (-533.858) (-541.903) (-542.612) [-540.582] * [-541.964] (-541.223) (-539.343) (-535.976) -- 0:01:21
      294500 -- [-535.397] (-534.627) (-544.330) (-540.862) * [-535.430] (-538.721) (-534.915) (-537.069) -- 0:01:21
      295000 -- [-534.521] (-538.103) (-536.502) (-535.868) * (-537.761) (-540.746) (-541.737) [-540.950] -- 0:01:21

      Average standard deviation of split frequencies: 0.007167

      295500 -- [-535.881] (-534.427) (-542.761) (-537.974) * (-539.755) [-535.159] (-539.865) (-541.098) -- 0:01:21
      296000 -- [-542.801] (-537.861) (-539.942) (-538.464) * [-541.559] (-541.841) (-538.195) (-537.332) -- 0:01:20
      296500 -- (-540.246) (-540.347) [-538.130] (-537.722) * (-537.868) [-534.780] (-538.634) (-536.749) -- 0:01:20
      297000 -- [-536.638] (-538.647) (-536.873) (-539.714) * (-538.259) (-548.173) [-539.690] (-536.423) -- 0:01:20
      297500 -- [-537.355] (-533.609) (-539.301) (-535.645) * (-539.708) (-545.839) (-547.942) [-536.644] -- 0:01:20
      298000 -- (-534.147) (-536.348) (-538.376) [-532.901] * [-539.553] (-544.142) (-539.890) (-535.059) -- 0:01:20
      298500 -- [-533.520] (-535.983) (-536.967) (-539.000) * (-539.805) (-541.704) (-545.578) [-533.341] -- 0:01:19
      299000 -- (-537.222) (-534.791) (-539.151) [-534.597] * (-544.925) [-539.712] (-540.796) (-534.148) -- 0:01:19
      299500 -- (-535.499) (-539.904) [-538.276] (-539.216) * (-540.196) (-538.646) (-543.097) [-538.417] -- 0:01:19
      300000 -- (-538.830) (-542.393) [-548.116] (-532.305) * [-538.654] (-541.631) (-536.834) (-535.943) -- 0:01:19

      Average standard deviation of split frequencies: 0.006271

      300500 -- (-539.735) (-541.602) [-532.941] (-532.225) * (-551.116) [-542.582] (-540.891) (-538.705) -- 0:01:21
      301000 -- (-534.129) [-532.089] (-535.363) (-535.283) * (-539.047) (-543.369) (-536.807) [-539.838] -- 0:01:21
      301500 -- (-546.879) (-540.509) [-544.090] (-539.578) * [-546.028] (-543.081) (-535.688) (-535.628) -- 0:01:21
      302000 -- [-540.227] (-537.395) (-541.351) (-538.609) * [-542.427] (-539.087) (-535.925) (-538.433) -- 0:01:20
      302500 -- [-532.316] (-533.075) (-538.737) (-538.679) * [-543.804] (-536.057) (-535.495) (-543.366) -- 0:01:20
      303000 -- (-532.113) (-538.047) [-541.689] (-534.327) * (-537.294) [-540.493] (-541.364) (-538.466) -- 0:01:20
      303500 -- [-534.473] (-545.274) (-545.557) (-537.480) * (-540.488) (-543.915) [-536.512] (-541.092) -- 0:01:20
      304000 -- (-541.416) (-533.357) [-542.281] (-533.944) * (-542.319) (-546.201) [-534.325] (-538.083) -- 0:01:20
      304500 -- (-535.733) [-534.273] (-539.756) (-532.944) * (-538.487) (-543.928) (-533.720) [-537.959] -- 0:01:19
      305000 -- (-543.588) (-538.844) [-537.874] (-540.356) * [-536.450] (-541.390) (-541.364) (-548.200) -- 0:01:19

      Average standard deviation of split frequencies: 0.006162

      305500 -- (-536.512) (-538.269) (-540.130) [-535.584] * (-536.837) (-541.112) (-547.942) [-535.569] -- 0:01:19
      306000 -- [-536.471] (-533.789) (-537.606) (-532.832) * (-539.972) [-538.937] (-535.834) (-541.782) -- 0:01:19
      306500 -- (-536.837) [-537.756] (-535.278) (-535.371) * [-539.730] (-537.499) (-541.445) (-535.068) -- 0:01:19
      307000 -- (-540.519) (-534.891) (-538.848) [-529.774] * [-541.353] (-539.877) (-539.436) (-538.621) -- 0:01:19
      307500 -- (-536.521) (-538.332) [-538.803] (-544.272) * [-539.200] (-545.969) (-535.993) (-536.120) -- 0:01:18
      308000 -- (-538.673) (-537.862) (-536.297) [-532.870] * [-538.197] (-544.624) (-533.581) (-541.211) -- 0:01:18
      308500 -- [-529.801] (-535.665) (-538.339) (-534.739) * [-540.467] (-541.620) (-535.083) (-549.509) -- 0:01:18
      309000 -- (-536.189) (-536.186) (-536.770) [-539.629] * (-535.276) [-540.738] (-535.712) (-539.899) -- 0:01:18
      309500 -- (-535.558) (-538.724) [-533.416] (-535.352) * (-541.133) (-540.894) (-538.080) [-541.240] -- 0:01:20
      310000 -- (-533.037) [-537.411] (-538.288) (-541.654) * [-542.011] (-534.549) (-538.959) (-540.220) -- 0:01:20

      Average standard deviation of split frequencies: 0.005311

      310500 -- (-542.223) (-544.859) [-533.554] (-543.064) * (-540.237) (-541.978) (-537.785) [-536.568] -- 0:01:19
      311000 -- [-536.469] (-540.267) (-539.313) (-539.703) * [-539.030] (-540.143) (-533.913) (-553.851) -- 0:01:19
      311500 -- (-531.400) (-539.744) (-534.811) [-541.855] * [-538.492] (-553.257) (-538.972) (-545.576) -- 0:01:19
      312000 -- (-539.038) (-532.981) [-539.713] (-536.244) * (-538.135) [-541.514] (-539.208) (-547.101) -- 0:01:19
      312500 -- (-534.551) (-533.897) [-533.581] (-532.959) * (-541.027) [-538.063] (-541.953) (-543.903) -- 0:01:19
      313000 -- (-538.444) (-543.320) (-536.618) [-535.230] * [-538.225] (-536.987) (-538.598) (-553.222) -- 0:01:19
      313500 -- (-537.924) (-544.141) (-537.954) [-535.171] * (-536.737) (-545.653) [-538.153] (-541.777) -- 0:01:18
      314000 -- (-539.578) [-537.944] (-536.018) (-533.140) * (-536.336) (-538.351) [-535.310] (-539.316) -- 0:01:18
      314500 -- [-537.414] (-535.927) (-538.260) (-540.148) * [-535.927] (-539.620) (-541.698) (-544.621) -- 0:01:18
      315000 -- [-536.180] (-542.685) (-538.706) (-544.087) * (-539.042) (-538.403) (-542.154) [-541.249] -- 0:01:18

      Average standard deviation of split frequencies: 0.005967

      315500 -- (-534.942) (-532.365) [-540.458] (-541.830) * [-537.663] (-534.948) (-538.189) (-538.692) -- 0:01:18
      316000 -- [-534.098] (-532.804) (-535.706) (-536.746) * (-541.893) (-539.088) [-540.598] (-538.143) -- 0:01:17
      316500 -- (-537.351) [-542.161] (-539.331) (-543.260) * (-539.131) (-543.360) [-539.036] (-534.869) -- 0:01:17
      317000 -- (-535.066) (-536.782) (-538.983) [-537.728] * (-543.682) (-543.694) [-539.548] (-544.471) -- 0:01:17
      317500 -- (-543.457) (-544.423) [-534.806] (-540.380) * (-534.086) (-537.861) (-539.385) [-541.856] -- 0:01:17
      318000 -- [-536.741] (-536.122) (-537.860) (-535.767) * (-541.882) (-537.854) (-536.077) [-539.649] -- 0:01:19
      318500 -- (-538.959) (-536.097) [-532.821] (-539.898) * (-529.854) [-537.454] (-540.759) (-536.939) -- 0:01:19
      319000 -- [-534.872] (-536.275) (-542.052) (-535.935) * (-536.939) [-534.198] (-552.606) (-533.740) -- 0:01:18
      319500 -- (-535.588) (-539.224) (-534.970) [-533.656] * (-536.741) (-537.097) (-540.647) [-537.473] -- 0:01:18
      320000 -- (-533.473) (-547.408) (-537.407) [-536.040] * (-535.853) (-533.965) (-543.955) [-535.925] -- 0:01:18

      Average standard deviation of split frequencies: 0.005880

      320500 -- (-535.958) (-540.691) (-533.884) [-540.324] * (-533.039) (-545.859) (-540.175) [-538.596] -- 0:01:18
      321000 -- [-535.329] (-536.696) (-538.591) (-536.365) * (-534.924) (-539.288) (-541.887) [-537.966] -- 0:01:18
      321500 -- (-534.181) (-541.788) [-533.974] (-535.954) * [-536.678] (-537.980) (-543.450) (-532.188) -- 0:01:18
      322000 -- (-535.872) [-536.113] (-542.622) (-544.349) * [-534.872] (-539.975) (-545.170) (-541.785) -- 0:01:17
      322500 -- [-534.949] (-536.741) (-538.738) (-537.415) * (-541.392) (-532.866) [-537.665] (-536.458) -- 0:01:17
      323000 -- [-537.310] (-539.453) (-538.825) (-540.625) * (-544.158) (-536.022) [-537.386] (-540.230) -- 0:01:17
      323500 -- [-539.813] (-537.576) (-538.783) (-536.566) * (-542.628) (-538.049) (-537.671) [-533.203] -- 0:01:17
      324000 -- [-533.545] (-541.245) (-540.503) (-535.952) * (-538.315) (-544.577) (-537.804) [-537.306] -- 0:01:17
      324500 -- [-537.974] (-542.308) (-533.141) (-535.929) * (-539.399) (-540.241) [-537.200] (-541.088) -- 0:01:17
      325000 -- (-536.481) [-536.098] (-534.661) (-539.234) * (-539.522) (-537.270) (-533.303) [-532.857] -- 0:01:16

      Average standard deviation of split frequencies: 0.006507

      325500 -- (-536.180) (-539.722) (-538.859) [-532.869] * (-542.228) [-534.575] (-538.104) (-542.025) -- 0:01:16
      326000 -- [-536.271] (-533.527) (-535.472) (-539.743) * (-542.229) (-536.555) (-532.250) [-539.754] -- 0:01:16
      326500 -- (-538.556) [-532.989] (-536.550) (-536.994) * (-537.298) [-536.475] (-540.280) (-543.498) -- 0:01:16
      327000 -- (-539.688) [-543.693] (-535.139) (-532.483) * [-546.810] (-547.326) (-540.064) (-539.424) -- 0:01:18
      327500 -- [-537.306] (-546.586) (-541.260) (-539.345) * (-535.106) [-536.472] (-542.280) (-536.678) -- 0:01:18
      328000 -- (-541.548) [-534.306] (-538.887) (-535.734) * (-544.283) (-539.788) [-541.516] (-534.032) -- 0:01:17
      328500 -- (-541.077) [-536.962] (-539.801) (-533.743) * (-535.205) (-535.861) [-539.046] (-537.347) -- 0:01:17
      329000 -- (-538.124) [-537.348] (-540.159) (-537.033) * (-540.416) [-533.631] (-537.412) (-535.359) -- 0:01:17
      329500 -- (-542.990) (-539.735) [-535.557] (-541.731) * (-544.542) (-534.993) (-541.143) [-535.716] -- 0:01:17
      330000 -- (-543.107) (-540.195) (-540.826) [-530.901] * (-534.857) (-547.758) (-537.192) [-535.408] -- 0:01:17

      Average standard deviation of split frequencies: 0.006415

      330500 -- (-537.958) [-535.034] (-537.080) (-537.442) * [-535.119] (-535.529) (-550.985) (-535.820) -- 0:01:16
      331000 -- (-540.248) [-534.180] (-536.256) (-537.169) * [-535.627] (-539.793) (-535.037) (-541.425) -- 0:01:16
      331500 -- (-540.961) [-534.615] (-532.947) (-540.532) * (-539.052) [-539.299] (-540.724) (-541.877) -- 0:01:16
      332000 -- (-544.655) [-535.909] (-534.695) (-535.109) * (-537.862) (-534.237) (-537.936) [-542.924] -- 0:01:16
      332500 -- (-545.773) (-536.779) [-541.838] (-543.528) * (-546.785) (-535.172) (-545.323) [-535.714] -- 0:01:16
      333000 -- (-545.591) [-536.988] (-542.391) (-534.230) * (-542.103) [-537.291] (-546.769) (-536.205) -- 0:01:16
      333500 -- (-542.734) (-537.015) (-542.597) [-537.830] * (-537.557) (-533.314) [-534.711] (-539.862) -- 0:01:15
      334000 -- (-542.103) (-533.246) [-539.342] (-537.627) * [-534.457] (-539.634) (-540.236) (-547.980) -- 0:01:15
      334500 -- (-539.431) [-536.737] (-539.539) (-537.785) * [-538.265] (-537.834) (-547.861) (-538.387) -- 0:01:15
      335000 -- (-544.705) [-537.632] (-533.681) (-540.680) * (-536.440) (-539.112) [-537.095] (-535.489) -- 0:01:15

      Average standard deviation of split frequencies: 0.007716

      335500 -- (-538.513) (-532.615) [-540.941] (-537.097) * (-534.805) (-540.394) [-535.984] (-540.504) -- 0:01:17
      336000 -- [-540.905] (-538.535) (-533.303) (-539.918) * [-534.844] (-535.397) (-544.509) (-536.085) -- 0:01:17
      336500 -- (-539.756) (-530.789) (-541.022) [-532.608] * [-534.978] (-538.702) (-546.279) (-538.440) -- 0:01:16
      337000 -- (-542.357) (-535.576) [-538.453] (-534.561) * (-537.991) (-536.761) (-547.010) [-534.698] -- 0:01:16
      337500 -- (-538.291) (-544.307) [-538.646] (-547.695) * (-537.942) [-537.689] (-535.693) (-537.981) -- 0:01:16
      338000 -- (-534.203) (-537.874) (-539.986) [-539.754] * [-537.422] (-546.572) (-540.421) (-538.312) -- 0:01:16
      338500 -- (-535.145) [-536.279] (-539.348) (-537.341) * (-543.705) (-536.031) [-541.105] (-535.417) -- 0:01:16
      339000 -- (-537.254) (-535.858) [-537.836] (-536.784) * (-546.882) [-540.442] (-537.129) (-542.217) -- 0:01:16
      339500 -- (-535.847) (-535.505) [-538.806] (-541.029) * (-542.139) (-537.552) [-534.742] (-541.322) -- 0:01:15
      340000 -- (-539.829) (-541.286) [-533.049] (-535.827) * (-537.878) (-531.834) (-540.464) [-540.058] -- 0:01:15

      Average standard deviation of split frequencies: 0.006919

      340500 -- (-541.466) (-536.874) [-537.157] (-537.729) * (-538.332) (-538.815) [-533.977] (-540.698) -- 0:01:15
      341000 -- (-542.558) (-538.991) (-536.044) [-535.617] * (-540.917) (-538.109) (-539.438) [-542.520] -- 0:01:15
      341500 -- (-538.322) (-540.919) (-535.410) [-537.071] * (-544.242) [-533.572] (-537.457) (-546.862) -- 0:01:15
      342000 -- (-535.904) (-540.476) (-538.746) [-533.983] * (-544.390) [-531.263] (-537.427) (-541.196) -- 0:01:15
      342500 -- (-538.047) (-538.398) [-530.438] (-534.474) * (-540.221) (-533.864) [-540.454] (-537.837) -- 0:01:14
      343000 -- [-548.450] (-541.340) (-534.803) (-537.833) * (-537.123) [-532.551] (-540.466) (-540.130) -- 0:01:14
      343500 -- (-538.364) [-534.137] (-536.060) (-534.792) * (-533.862) [-532.610] (-544.772) (-535.786) -- 0:01:14
      344000 -- (-539.846) (-547.637) [-544.317] (-536.160) * (-535.522) [-533.940] (-538.957) (-542.089) -- 0:01:14
      344500 -- (-537.882) [-532.227] (-538.690) (-538.348) * [-537.741] (-547.605) (-536.991) (-543.412) -- 0:01:16
      345000 -- (-545.431) (-536.725) (-537.957) [-539.509] * (-535.873) [-540.484] (-531.463) (-534.829) -- 0:01:15

      Average standard deviation of split frequencies: 0.008175

      345500 -- (-538.252) (-536.001) (-535.222) [-532.206] * (-536.479) (-538.402) (-532.655) [-536.533] -- 0:01:15
      346000 -- [-538.698] (-535.354) (-539.512) (-537.218) * [-534.652] (-536.993) (-537.211) (-533.966) -- 0:01:15
      346500 -- (-532.655) (-541.251) (-541.301) [-538.306] * (-533.825) (-545.307) (-536.602) [-532.818] -- 0:01:15
      347000 -- (-538.032) [-534.762] (-550.630) (-538.722) * (-542.703) [-541.010] (-536.602) (-534.713) -- 0:01:15
      347500 -- (-537.681) [-536.973] (-534.061) (-537.945) * (-535.961) (-540.820) [-538.409] (-532.938) -- 0:01:15
      348000 -- (-540.633) [-535.291] (-536.359) (-539.413) * (-533.352) (-546.685) (-538.782) [-537.044] -- 0:01:14
      348500 -- (-535.408) [-534.859] (-543.253) (-536.877) * (-536.492) (-547.329) (-542.807) [-534.489] -- 0:01:14
      349000 -- (-537.227) [-536.959] (-539.390) (-538.198) * (-537.896) (-546.349) (-538.452) [-532.294] -- 0:01:14
      349500 -- (-532.818) (-547.530) [-542.420] (-538.972) * (-545.470) (-540.991) (-543.248) [-535.352] -- 0:01:14
      350000 -- [-534.192] (-543.532) (-535.142) (-536.351) * (-541.324) [-538.129] (-541.763) (-536.527) -- 0:01:14

      Average standard deviation of split frequencies: 0.007394

      350500 -- [-536.794] (-540.026) (-546.012) (-538.069) * [-535.480] (-542.348) (-537.836) (-539.096) -- 0:01:14
      351000 -- (-540.288) [-534.522] (-537.798) (-534.588) * (-537.181) (-540.435) (-535.678) [-536.394] -- 0:01:13
      351500 -- (-538.941) [-535.169] (-535.428) (-532.576) * (-549.305) [-533.297] (-536.188) (-543.143) -- 0:01:13
      352000 -- [-531.227] (-543.609) (-535.999) (-532.171) * [-537.327] (-541.574) (-551.715) (-536.022) -- 0:01:13
      352500 -- [-535.944] (-538.814) (-541.396) (-543.747) * (-535.749) (-537.992) (-539.595) [-532.531] -- 0:01:13
      353000 -- [-537.144] (-539.052) (-539.027) (-533.943) * [-537.391] (-534.257) (-542.934) (-536.117) -- 0:01:15
      353500 -- [-533.635] (-536.910) (-535.404) (-537.224) * [-533.116] (-534.455) (-532.536) (-539.334) -- 0:01:14
      354000 -- (-535.379) (-537.323) [-535.531] (-534.794) * (-539.882) (-539.914) [-533.294] (-542.857) -- 0:01:14
      354500 -- (-537.524) [-536.466] (-536.335) (-532.564) * (-538.118) [-535.510] (-533.131) (-539.566) -- 0:01:14
      355000 -- (-540.656) [-537.761] (-531.393) (-537.647) * (-534.613) (-533.605) (-537.833) [-535.043] -- 0:01:14

      Average standard deviation of split frequencies: 0.007283

      355500 -- (-536.542) (-536.959) (-535.219) [-535.205] * (-542.289) (-539.823) [-534.786] (-541.319) -- 0:01:14
      356000 -- (-535.235) [-531.942] (-536.018) (-546.886) * (-543.348) (-532.706) (-533.653) [-536.666] -- 0:01:14
      356500 -- (-532.955) (-535.338) [-535.781] (-541.690) * [-536.650] (-535.464) (-537.084) (-539.408) -- 0:01:14
      357000 -- [-536.179] (-535.714) (-536.124) (-535.594) * (-533.269) (-539.295) (-541.408) [-535.050] -- 0:01:13
      357500 -- (-537.597) [-533.954] (-538.758) (-535.992) * [-539.044] (-540.780) (-534.745) (-541.524) -- 0:01:13
      358000 -- (-536.363) (-534.642) (-535.120) [-541.198] * (-538.103) (-537.423) (-533.609) [-536.982] -- 0:01:13
      358500 -- (-537.493) (-535.135) [-535.577] (-539.539) * (-538.707) [-535.347] (-538.050) (-539.140) -- 0:01:13
      359000 -- (-532.179) [-534.330] (-535.925) (-539.134) * (-537.057) (-536.597) [-533.181] (-544.345) -- 0:01:13
      359500 -- (-542.403) [-534.392] (-538.304) (-548.342) * (-544.165) (-536.101) [-533.047] (-535.740) -- 0:01:13
      360000 -- (-534.079) [-531.712] (-538.189) (-539.743) * (-538.520) (-538.929) (-535.477) [-536.827] -- 0:01:12

      Average standard deviation of split frequencies: 0.006535

      360500 -- (-538.153) [-538.209] (-538.030) (-534.995) * (-537.782) [-535.059] (-549.790) (-543.813) -- 0:01:12
      361000 -- (-536.711) (-541.267) [-532.503] (-541.892) * (-542.412) (-540.893) (-538.557) [-535.633] -- 0:01:12
      361500 -- (-537.936) (-531.841) (-538.234) [-538.847] * (-545.159) (-537.236) [-541.268] (-537.150) -- 0:01:12
      362000 -- (-535.811) (-533.806) (-541.711) [-537.120] * (-536.868) (-535.737) (-539.964) [-536.390] -- 0:01:14
      362500 -- (-534.159) (-536.914) [-538.055] (-538.369) * (-539.007) [-540.986] (-537.139) (-531.492) -- 0:01:13
      363000 -- [-538.672] (-536.603) (-535.625) (-539.566) * (-538.977) (-542.790) (-541.662) [-536.380] -- 0:01:13
      363500 -- (-536.883) (-544.583) [-534.356] (-535.710) * (-538.630) (-539.139) (-541.369) [-537.286] -- 0:01:13
      364000 -- (-535.507) (-544.422) [-535.832] (-535.556) * [-539.463] (-537.316) (-538.608) (-537.080) -- 0:01:13
      364500 -- (-535.839) [-538.454] (-540.204) (-535.780) * [-535.640] (-533.549) (-544.829) (-533.482) -- 0:01:13
      365000 -- (-534.853) (-535.493) (-536.204) [-537.513] * (-540.563) (-538.574) [-534.343] (-535.644) -- 0:01:13

      Average standard deviation of split frequencies: 0.007084

      365500 -- (-539.251) (-540.854) (-533.350) [-534.375] * (-536.188) [-535.154] (-541.486) (-540.516) -- 0:01:12
      366000 -- [-540.815] (-541.179) (-544.463) (-535.189) * [-535.449] (-543.788) (-535.367) (-537.587) -- 0:01:12
      366500 -- [-535.653] (-538.853) (-538.638) (-536.447) * (-538.890) (-544.360) [-540.209] (-545.149) -- 0:01:12
      367000 -- [-538.257] (-540.721) (-543.087) (-537.628) * (-536.343) (-535.236) [-538.551] (-540.781) -- 0:01:12
      367500 -- (-547.231) (-537.591) [-536.206] (-541.966) * (-539.082) [-535.571] (-537.425) (-533.266) -- 0:01:12
      368000 -- (-537.713) (-537.526) [-534.495] (-539.185) * (-536.596) [-534.406] (-544.661) (-536.628) -- 0:01:12
      368500 -- [-536.757] (-535.878) (-540.395) (-543.574) * [-538.448] (-535.111) (-535.225) (-541.808) -- 0:01:11
      369000 -- (-545.145) (-531.356) [-535.503] (-536.797) * [-541.463] (-538.694) (-532.839) (-541.696) -- 0:01:11
      369500 -- (-532.931) (-540.519) [-534.049] (-546.420) * (-537.508) (-537.787) [-534.368] (-539.805) -- 0:01:11
      370000 -- (-538.595) (-535.617) [-532.265] (-536.836) * (-545.162) (-536.624) (-540.082) [-536.573] -- 0:01:11

      Average standard deviation of split frequencies: 0.006995

      370500 -- (-536.238) (-537.838) [-534.943] (-537.602) * [-533.893] (-539.697) (-540.664) (-538.707) -- 0:01:13
      371000 -- (-535.998) (-541.767) (-539.368) [-537.350] * (-545.321) [-532.746] (-545.309) (-537.343) -- 0:01:12
      371500 -- (-538.081) (-541.050) [-541.122] (-540.201) * [-538.716] (-540.463) (-534.249) (-534.438) -- 0:01:12
      372000 -- [-543.071] (-536.466) (-536.929) (-538.327) * [-533.230] (-538.215) (-535.719) (-536.551) -- 0:01:12
      372500 -- (-540.360) [-536.019] (-536.707) (-539.640) * [-534.632] (-538.112) (-540.351) (-535.247) -- 0:01:12
      373000 -- (-537.428) [-532.976] (-538.587) (-541.573) * (-535.884) (-535.266) [-537.282] (-536.184) -- 0:01:12
      373500 -- (-540.343) (-536.941) (-538.228) [-538.491] * (-542.121) (-536.277) (-540.254) [-533.144] -- 0:01:12
      374000 -- (-542.047) (-537.011) (-542.348) [-539.873] * (-535.873) (-547.036) (-543.251) [-542.403] -- 0:01:11
      374500 -- (-540.218) (-536.527) [-537.693] (-536.589) * (-538.439) (-532.928) [-536.996] (-534.951) -- 0:01:11
      375000 -- (-542.083) [-536.618] (-539.888) (-535.691) * (-534.605) (-530.759) (-543.273) [-535.899] -- 0:01:11

      Average standard deviation of split frequencies: 0.006896

      375500 -- (-536.705) (-532.386) [-536.296] (-536.133) * (-538.394) [-531.683] (-541.735) (-538.160) -- 0:01:11
      376000 -- (-543.524) (-534.831) [-536.043] (-544.563) * (-537.478) [-532.398] (-548.080) (-535.848) -- 0:01:11
      376500 -- [-540.180] (-532.651) (-540.239) (-536.589) * (-541.500) (-536.840) (-540.078) [-544.314] -- 0:01:11
      377000 -- (-544.171) (-538.970) (-537.747) [-535.257] * [-538.482] (-546.498) (-545.157) (-538.047) -- 0:01:11
      377500 -- (-535.678) (-541.611) [-535.402] (-533.437) * [-539.671] (-536.157) (-538.646) (-535.045) -- 0:01:10
      378000 -- (-542.967) (-535.901) [-534.469] (-537.245) * [-534.184] (-541.563) (-539.571) (-534.773) -- 0:01:10
      378500 -- (-533.913) (-543.223) (-534.613) [-533.806] * (-534.208) (-533.467) (-541.147) [-537.611] -- 0:01:10
      379000 -- (-539.337) (-540.288) (-540.177) [-535.923] * (-537.373) [-539.311] (-543.480) (-541.339) -- 0:01:12
      379500 -- (-541.101) (-544.592) [-538.035] (-538.100) * (-532.034) (-535.949) (-541.541) [-536.665] -- 0:01:11
      380000 -- (-534.849) (-538.598) (-539.005) [-534.853] * (-539.549) (-532.033) [-535.304] (-537.640) -- 0:01:11

      Average standard deviation of split frequencies: 0.006811

      380500 -- (-543.014) [-535.984] (-533.693) (-529.886) * (-536.817) [-538.712] (-538.695) (-540.224) -- 0:01:11
      381000 -- (-539.363) [-539.042] (-533.841) (-537.955) * (-532.527) (-541.436) [-538.812] (-539.891) -- 0:01:11
      381500 -- (-536.344) (-538.903) (-536.271) [-539.194] * (-541.952) [-533.780] (-535.473) (-539.479) -- 0:01:11
      382000 -- (-540.483) (-540.505) (-537.058) [-538.427] * (-531.707) (-536.292) [-535.704] (-541.453) -- 0:01:11
      382500 -- (-539.687) [-533.260] (-534.252) (-539.309) * (-533.041) [-533.223] (-542.909) (-540.206) -- 0:01:11
      383000 -- (-533.854) (-539.609) (-533.228) [-537.392] * (-542.564) [-531.633] (-536.961) (-542.427) -- 0:01:10
      383500 -- (-537.060) [-537.923] (-535.081) (-538.075) * [-541.838] (-534.085) (-537.033) (-541.766) -- 0:01:10
      384000 -- (-542.261) [-535.959] (-538.852) (-531.780) * (-538.714) (-537.451) [-536.332] (-538.556) -- 0:01:10
      384500 -- (-545.784) (-538.113) [-535.257] (-533.764) * (-540.255) (-536.619) (-537.291) [-538.710] -- 0:01:10
      385000 -- [-540.462] (-539.224) (-532.453) (-542.157) * (-535.588) [-535.397] (-539.701) (-535.215) -- 0:01:10

      Average standard deviation of split frequencies: 0.005496

      385500 -- (-541.966) [-536.898] (-533.265) (-533.893) * (-544.664) [-531.247] (-545.414) (-536.805) -- 0:01:10
      386000 -- (-538.197) [-535.573] (-536.657) (-533.813) * (-543.826) (-536.607) [-541.241] (-540.042) -- 0:01:09
      386500 -- (-543.751) (-536.559) (-537.595) [-539.639] * [-535.304] (-538.807) (-544.548) (-540.809) -- 0:01:09
      387000 -- (-542.008) (-539.715) [-534.569] (-543.706) * (-539.127) [-533.609] (-536.132) (-538.394) -- 0:01:09
      387500 -- (-545.580) (-549.741) [-531.890] (-540.215) * (-539.014) [-534.448] (-541.350) (-548.695) -- 0:01:09
      388000 -- (-545.789) [-534.613] (-537.073) (-537.710) * [-535.178] (-539.571) (-542.020) (-541.877) -- 0:01:10
      388500 -- (-546.343) (-547.151) (-537.765) [-538.410] * (-537.128) [-536.340] (-534.620) (-531.575) -- 0:01:10
      389000 -- (-542.039) [-538.651] (-533.285) (-539.482) * [-536.077] (-540.906) (-542.998) (-539.805) -- 0:01:10
      389500 -- (-536.860) [-532.182] (-539.851) (-543.292) * (-536.831) (-535.573) [-532.696] (-536.022) -- 0:01:10
      390000 -- [-539.119] (-534.921) (-533.323) (-539.526) * (-537.643) (-532.065) (-539.887) [-535.433] -- 0:01:10

      Average standard deviation of split frequencies: 0.004827

      390500 -- (-539.990) (-544.194) [-534.159] (-538.284) * (-536.516) (-538.794) [-536.347] (-537.392) -- 0:01:10
      391000 -- (-535.062) (-539.585) [-534.397] (-532.610) * (-534.748) (-544.325) [-539.037] (-543.904) -- 0:01:10
      391500 -- (-535.707) (-540.649) [-531.046] (-535.589) * (-541.376) (-550.127) (-547.268) [-536.775] -- 0:01:09
      392000 -- (-535.230) [-539.082] (-535.160) (-534.420) * [-533.711] (-536.422) (-538.792) (-533.557) -- 0:01:09
      392500 -- (-535.859) (-542.830) [-533.441] (-537.533) * (-542.708) (-536.805) (-543.584) [-537.723] -- 0:01:09
      393000 -- (-534.242) (-538.871) [-534.250] (-536.604) * (-532.224) [-541.117] (-542.412) (-541.666) -- 0:01:09
      393500 -- [-537.462] (-534.707) (-551.353) (-534.736) * (-540.099) [-534.860] (-544.357) (-538.049) -- 0:01:09
      394000 -- (-541.135) [-539.611] (-537.599) (-534.399) * [-533.177] (-537.006) (-543.900) (-541.353) -- 0:01:09
      394500 -- (-544.892) [-532.709] (-532.541) (-535.600) * [-537.942] (-532.593) (-541.354) (-544.962) -- 0:01:09
      395000 -- (-538.857) (-534.098) [-536.406] (-535.337) * (-541.318) (-537.562) (-538.690) [-542.550] -- 0:01:08

      Average standard deviation of split frequencies: 0.004166

      395500 -- [-536.340] (-533.661) (-543.370) (-541.985) * (-546.194) (-533.392) (-542.111) [-534.084] -- 0:01:08
      396000 -- [-534.087] (-533.369) (-535.142) (-539.899) * (-537.553) (-540.290) [-536.632] (-535.285) -- 0:01:08
      396500 -- (-535.867) [-534.061] (-535.414) (-543.175) * (-541.884) (-539.413) (-536.467) [-534.772] -- 0:01:10
      397000 -- [-537.359] (-534.349) (-533.132) (-534.432) * [-534.916] (-534.080) (-536.660) (-535.695) -- 0:01:09
      397500 -- [-534.194] (-537.536) (-537.144) (-541.585) * (-540.400) (-537.355) [-537.617] (-541.946) -- 0:01:09
      398000 -- (-535.334) [-534.073] (-549.376) (-541.004) * (-537.162) (-535.704) (-543.760) [-537.816] -- 0:01:09
      398500 -- [-535.808] (-540.841) (-539.530) (-539.786) * (-534.481) [-536.661] (-536.836) (-544.924) -- 0:01:09
      399000 -- (-534.048) (-534.565) [-533.170] (-535.578) * (-547.832) [-533.593] (-538.916) (-539.222) -- 0:01:09
      399500 -- (-530.910) [-534.922] (-538.038) (-534.907) * (-536.843) (-543.259) [-534.620] (-534.000) -- 0:01:09
      400000 -- [-534.126] (-533.949) (-537.179) (-535.011) * (-540.685) [-538.766] (-539.137) (-537.734) -- 0:01:09

      Average standard deviation of split frequencies: 0.004706

      400500 -- (-541.253) (-539.081) (-534.880) [-534.383] * (-533.861) [-539.032] (-540.847) (-545.089) -- 0:01:08
      401000 -- (-538.419) [-537.631] (-535.505) (-536.507) * (-533.063) [-534.388] (-545.347) (-539.023) -- 0:01:08
      401500 -- (-533.218) [-537.815] (-532.263) (-537.791) * (-539.172) [-534.134] (-537.543) (-544.718) -- 0:01:08
      402000 -- [-539.088] (-542.179) (-535.803) (-533.812) * [-542.477] (-535.385) (-550.481) (-536.900) -- 0:01:08
      402500 -- [-534.770] (-540.632) (-534.874) (-544.848) * (-537.984) (-544.068) [-540.762] (-535.535) -- 0:01:08
      403000 -- (-539.576) (-535.635) [-533.703] (-538.686) * (-537.656) [-540.110] (-541.379) (-541.148) -- 0:01:08
      403500 -- (-539.447) (-536.979) (-539.207) [-535.245] * (-538.591) [-532.750] (-538.706) (-535.819) -- 0:01:08
      404000 -- (-545.280) [-534.693] (-537.279) (-541.861) * (-537.189) [-532.026] (-537.173) (-531.505) -- 0:01:07
      404500 -- (-539.000) (-532.300) [-536.490] (-538.048) * (-540.024) [-536.867] (-535.607) (-538.691) -- 0:01:07
      405000 -- (-544.307) [-533.138] (-541.851) (-539.941) * (-542.598) [-536.420] (-542.923) (-535.143) -- 0:01:09

      Average standard deviation of split frequencies: 0.005225

      405500 -- (-540.885) (-539.146) [-536.134] (-536.876) * (-540.775) (-535.747) (-539.007) [-538.012] -- 0:01:08
      406000 -- [-535.234] (-541.587) (-535.979) (-545.608) * (-541.994) [-537.552] (-540.417) (-540.866) -- 0:01:08
      406500 -- [-536.486] (-541.328) (-533.452) (-537.028) * [-538.276] (-532.124) (-538.259) (-534.000) -- 0:01:08
      407000 -- [-540.446] (-538.975) (-534.823) (-544.955) * (-535.894) [-535.907] (-541.035) (-533.534) -- 0:01:08
      407500 -- (-535.573) (-539.505) [-539.313] (-539.294) * (-537.632) (-540.200) (-542.428) [-532.503] -- 0:01:08
      408000 -- [-538.299] (-541.073) (-542.946) (-543.005) * [-536.682] (-539.567) (-532.917) (-538.021) -- 0:01:08
      408500 -- (-541.243) (-539.275) [-540.382] (-539.956) * (-533.853) [-535.783] (-538.131) (-550.751) -- 0:01:08
      409000 -- (-538.252) (-537.313) (-539.996) [-533.560] * (-538.084) (-535.701) [-535.420] (-537.426) -- 0:01:07
      409500 -- (-539.947) (-538.187) [-533.500] (-536.211) * (-539.469) [-534.716] (-540.892) (-535.014) -- 0:01:07
      410000 -- (-542.317) [-542.382] (-538.551) (-542.968) * (-536.304) [-536.989] (-532.142) (-545.387) -- 0:01:07

      Average standard deviation of split frequencies: 0.005740

      410500 -- [-540.431] (-537.850) (-534.805) (-545.462) * (-532.048) [-543.158] (-538.780) (-540.363) -- 0:01:07
      411000 -- (-538.713) (-545.166) (-539.333) [-541.515] * (-533.587) [-538.619] (-544.780) (-532.835) -- 0:01:07
      411500 -- (-539.437) (-548.984) [-533.847] (-546.429) * (-534.843) [-536.885] (-539.590) (-536.781) -- 0:01:07
      412000 -- (-540.935) [-537.594] (-533.856) (-545.434) * (-533.890) (-543.010) (-541.640) [-538.813] -- 0:01:07
      412500 -- (-537.253) (-538.831) [-535.175] (-545.512) * (-536.782) (-535.439) (-543.461) [-535.117] -- 0:01:06
      413000 -- (-538.166) (-536.408) (-535.755) [-538.422] * [-536.293] (-544.421) (-540.607) (-540.226) -- 0:01:06
      413500 -- (-534.122) [-542.680] (-535.321) (-554.397) * (-539.889) [-540.330] (-539.619) (-536.639) -- 0:01:06
      414000 -- (-542.980) (-540.401) [-532.460] (-549.967) * [-541.218] (-542.023) (-536.349) (-534.761) -- 0:01:07
      414500 -- [-536.217] (-539.818) (-534.064) (-543.427) * (-543.664) [-537.264] (-534.259) (-538.188) -- 0:01:07
      415000 -- (-546.026) (-547.021) [-533.765] (-535.722) * (-539.808) [-540.521] (-534.134) (-539.529) -- 0:01:07

      Average standard deviation of split frequencies: 0.005099

      415500 -- (-541.295) (-546.619) (-537.031) [-536.939] * (-537.939) (-540.599) [-536.401] (-546.003) -- 0:01:07
      416000 -- (-536.630) (-541.388) (-538.278) [-540.725] * (-537.983) (-535.619) [-539.730] (-536.844) -- 0:01:07
      416500 -- (-535.097) (-554.393) (-541.432) [-535.731] * [-534.436] (-543.806) (-539.879) (-534.690) -- 0:01:07
      417000 -- [-536.738] (-543.635) (-544.177) (-539.509) * (-541.798) [-536.975] (-538.618) (-535.718) -- 0:01:07
      417500 -- (-538.691) (-538.504) [-539.103] (-544.854) * [-534.662] (-538.223) (-536.208) (-540.687) -- 0:01:06
      418000 -- (-537.919) [-540.190] (-534.986) (-542.108) * [-536.095] (-532.869) (-536.255) (-546.253) -- 0:01:06
      418500 -- [-539.435] (-538.387) (-537.628) (-538.384) * [-537.273] (-543.673) (-551.151) (-533.237) -- 0:01:06
      419000 -- (-536.265) (-541.627) [-540.974] (-543.491) * [-540.547] (-534.794) (-540.964) (-537.055) -- 0:01:06
      419500 -- (-531.607) (-542.325) [-539.932] (-542.458) * (-535.534) (-541.121) (-533.479) [-535.605] -- 0:01:06
      420000 -- (-532.845) (-536.489) [-541.811] (-541.045) * [-534.948] (-534.853) (-545.539) (-537.062) -- 0:01:06

      Average standard deviation of split frequencies: 0.005043

      420500 -- [-537.944] (-542.016) (-536.977) (-539.201) * [-532.415] (-534.272) (-546.516) (-534.078) -- 0:01:06
      421000 -- [-538.064] (-542.611) (-537.180) (-534.701) * (-541.361) (-535.086) (-540.764) [-535.654] -- 0:01:06
      421500 -- (-535.252) [-545.638] (-537.095) (-536.777) * [-537.262] (-536.776) (-538.932) (-540.337) -- 0:01:05
      422000 -- (-535.710) (-540.843) (-540.674) [-533.669] * [-535.689] (-540.943) (-543.842) (-537.579) -- 0:01:05
      422500 -- (-536.381) (-537.652) [-536.578] (-535.271) * [-536.850] (-539.587) (-536.886) (-542.310) -- 0:01:06
      423000 -- (-534.835) (-540.408) (-541.430) [-541.333] * (-532.290) (-534.655) [-534.458] (-541.099) -- 0:01:06
      423500 -- (-535.162) (-539.971) [-541.105] (-538.145) * (-532.406) (-537.299) [-534.620] (-537.791) -- 0:01:06
      424000 -- [-531.056] (-537.712) (-534.123) (-537.951) * (-530.539) [-534.803] (-535.615) (-537.367) -- 0:01:06
      424500 -- (-539.649) (-543.815) [-532.204] (-541.244) * (-537.187) [-532.335] (-538.003) (-537.808) -- 0:01:06
      425000 -- (-548.239) (-536.061) [-540.500] (-541.213) * (-532.802) [-538.738] (-539.077) (-535.448) -- 0:01:06

      Average standard deviation of split frequencies: 0.004980

      425500 -- [-539.476] (-539.460) (-535.995) (-541.432) * (-533.545) (-534.818) (-539.215) [-536.144] -- 0:01:06
      426000 -- [-534.607] (-535.185) (-534.307) (-544.121) * (-541.414) (-534.657) [-540.569] (-538.442) -- 0:01:06
      426500 -- [-535.594] (-541.173) (-538.037) (-543.828) * [-535.360] (-534.815) (-545.032) (-540.610) -- 0:01:05
      427000 -- (-535.113) (-536.330) [-542.906] (-546.620) * [-537.255] (-539.435) (-540.741) (-538.940) -- 0:01:05
      427500 -- [-533.105] (-537.892) (-536.855) (-540.183) * (-535.791) (-537.525) [-540.855] (-546.043) -- 0:01:05
      428000 -- (-538.324) (-532.361) (-532.811) [-543.041] * [-537.583] (-537.769) (-533.061) (-536.433) -- 0:01:05
      428500 -- [-535.419] (-534.967) (-536.830) (-544.601) * (-538.647) (-539.771) (-539.339) [-542.841] -- 0:01:05
      429000 -- [-534.645] (-539.659) (-537.772) (-545.181) * (-538.173) [-532.624] (-536.043) (-540.719) -- 0:01:05
      429500 -- (-538.023) (-547.076) (-536.375) [-539.432] * (-543.295) (-538.665) [-534.468] (-537.297) -- 0:01:05
      430000 -- (-535.704) (-544.369) [-537.856] (-538.265) * [-534.316] (-537.674) (-540.070) (-544.509) -- 0:01:04

      Average standard deviation of split frequencies: 0.004926

      430500 -- [-535.716] (-533.385) (-538.245) (-542.790) * (-534.267) (-534.949) (-539.262) [-538.324] -- 0:01:04
      431000 -- (-536.832) [-533.510] (-538.248) (-541.063) * (-537.719) (-537.200) (-538.558) [-540.612] -- 0:01:04
      431500 -- [-539.487] (-532.224) (-541.085) (-543.810) * (-536.301) [-536.289] (-538.299) (-541.606) -- 0:01:05
      432000 -- [-543.028] (-539.043) (-537.101) (-535.995) * (-535.415) [-533.175] (-531.800) (-539.402) -- 0:01:05
      432500 -- (-540.878) (-534.801) (-541.291) [-535.847] * (-543.896) (-543.974) [-535.533] (-536.675) -- 0:01:05
      433000 -- (-543.943) (-539.138) (-539.625) [-539.539] * (-536.215) (-542.362) [-534.635] (-544.784) -- 0:01:05
      433500 -- [-534.456] (-535.442) (-533.709) (-541.942) * (-537.914) (-537.525) [-534.249] (-536.104) -- 0:01:05
      434000 -- (-541.257) (-537.207) (-545.701) [-538.435] * (-541.489) (-535.942) [-537.079] (-550.442) -- 0:01:05
      434500 -- (-540.344) (-532.658) [-537.799] (-542.255) * (-532.629) (-541.030) [-535.850] (-550.356) -- 0:01:05
      435000 -- (-536.773) [-530.967] (-539.789) (-539.890) * (-538.664) (-536.474) [-535.833] (-540.228) -- 0:01:04

      Average standard deviation of split frequencies: 0.003244

      435500 -- (-547.583) (-534.998) [-535.700] (-538.488) * (-539.228) [-538.644] (-539.879) (-536.339) -- 0:01:04
      436000 -- (-539.585) [-536.823] (-537.179) (-541.724) * (-545.135) (-534.298) (-539.598) [-535.056] -- 0:01:04
      436500 -- (-544.859) (-533.999) (-533.088) [-534.553] * (-544.492) (-535.639) [-537.251] (-538.433) -- 0:01:04
      437000 -- (-544.680) [-540.576] (-539.504) (-535.777) * [-535.482] (-542.526) (-536.403) (-544.540) -- 0:01:04
      437500 -- (-541.164) [-533.864] (-543.177) (-540.560) * [-539.183] (-540.421) (-535.964) (-544.538) -- 0:01:04
      438000 -- (-546.418) (-539.185) (-537.100) [-537.344] * (-537.791) (-538.834) [-541.902] (-548.802) -- 0:01:04
      438500 -- (-542.196) (-534.728) (-538.755) [-533.344] * (-541.421) (-536.700) (-547.886) [-544.491] -- 0:01:04
      439000 -- (-535.487) [-538.248] (-540.305) (-536.433) * (-536.838) (-538.337) (-536.415) [-542.491] -- 0:01:03
      439500 -- (-538.918) (-535.362) (-545.205) [-544.012] * (-542.114) (-541.256) [-535.282] (-541.800) -- 0:01:03
      440000 -- (-534.027) (-533.342) [-532.156] (-534.257) * (-543.980) (-544.504) [-537.419] (-548.722) -- 0:01:04

      Average standard deviation of split frequencies: 0.002674

      440500 -- (-547.441) [-534.374] (-538.046) (-538.133) * (-534.626) [-538.709] (-538.143) (-539.724) -- 0:01:04
      441000 -- (-542.875) [-534.587] (-542.554) (-532.092) * (-538.587) (-541.840) [-537.053] (-539.927) -- 0:01:04
      441500 -- (-535.817) (-535.565) [-532.376] (-536.669) * [-538.574] (-537.986) (-534.766) (-538.828) -- 0:01:04
      442000 -- [-537.119] (-536.453) (-537.561) (-536.065) * (-537.325) [-532.212] (-540.700) (-536.573) -- 0:01:04
      442500 -- (-539.961) (-537.580) (-535.420) [-542.482] * (-533.815) (-537.883) [-536.487] (-536.917) -- 0:01:04
      443000 -- (-539.563) (-535.529) [-531.456] (-536.899) * (-539.272) [-533.923] (-534.660) (-539.157) -- 0:01:04
      443500 -- (-540.514) [-531.743] (-534.659) (-539.325) * (-532.015) (-534.062) (-550.049) [-533.529] -- 0:01:03
      444000 -- (-543.069) [-536.686] (-535.771) (-535.989) * (-536.277) [-537.933] (-533.206) (-539.335) -- 0:01:03
      444500 -- (-538.129) (-533.792) [-531.342] (-542.015) * (-536.397) (-536.377) [-537.183] (-538.947) -- 0:01:03
      445000 -- (-534.587) (-539.885) [-532.657] (-536.651) * (-538.631) (-537.609) (-538.502) [-537.131] -- 0:01:03

      Average standard deviation of split frequencies: 0.002642

      445500 -- (-539.300) (-536.262) [-535.202] (-537.041) * (-543.495) (-536.632) [-528.984] (-542.669) -- 0:01:03
      446000 -- (-540.532) (-534.717) [-536.100] (-537.594) * (-538.493) (-538.847) (-538.424) [-535.785] -- 0:01:03
      446500 -- (-546.560) [-534.409] (-531.208) (-540.456) * (-541.682) (-538.517) [-531.383] (-540.042) -- 0:01:03
      447000 -- (-539.268) [-535.294] (-549.089) (-543.418) * (-546.120) (-530.887) (-541.022) [-537.678] -- 0:01:03
      447500 -- (-538.676) (-537.738) (-542.768) [-540.763] * (-534.020) (-534.612) (-545.009) [-542.341] -- 0:01:02
      448000 -- [-539.526] (-546.204) (-533.394) (-547.416) * (-536.040) (-535.076) (-539.024) [-539.002] -- 0:01:02
      448500 -- (-536.118) (-542.574) (-534.903) [-534.852] * (-537.891) [-531.242] (-543.976) (-536.862) -- 0:01:03
      449000 -- (-541.220) (-539.707) (-541.831) [-535.637] * [-534.235] (-534.997) (-533.486) (-537.010) -- 0:01:03
      449500 -- (-538.494) (-535.662) [-536.610] (-539.384) * (-541.937) [-540.287] (-535.636) (-536.666) -- 0:01:03
      450000 -- [-538.071] (-543.711) (-539.058) (-537.679) * [-537.074] (-538.861) (-537.955) (-549.636) -- 0:01:03

      Average standard deviation of split frequencies: 0.003138

      450500 -- (-535.193) (-543.885) (-542.532) [-534.815] * (-532.819) [-532.768] (-536.511) (-540.072) -- 0:01:03
      451000 -- [-533.347] (-545.575) (-535.006) (-535.233) * [-535.973] (-542.549) (-533.277) (-536.100) -- 0:01:03
      451500 -- (-535.724) (-541.438) (-539.072) [-532.861] * [-538.561] (-545.385) (-534.635) (-538.190) -- 0:01:03
      452000 -- (-537.408) (-532.924) [-534.787] (-535.415) * [-535.493] (-538.141) (-534.129) (-537.798) -- 0:01:03
      452500 -- (-547.375) (-541.584) [-537.602] (-535.101) * [-534.693] (-541.014) (-533.778) (-539.375) -- 0:01:02
      453000 -- [-531.549] (-536.021) (-530.701) (-536.670) * (-542.198) (-545.361) (-543.732) [-540.633] -- 0:01:02
      453500 -- (-534.926) (-540.766) (-537.123) [-538.962] * (-540.946) (-552.918) (-540.896) [-535.268] -- 0:01:02
      454000 -- (-536.288) (-540.158) [-532.957] (-539.297) * (-538.580) (-542.873) [-533.212] (-538.864) -- 0:01:02
      454500 -- (-537.251) (-536.207) [-535.981] (-531.633) * [-543.786] (-536.419) (-535.072) (-538.836) -- 0:01:02
      455000 -- (-539.804) [-538.122] (-534.885) (-535.790) * (-544.223) (-538.429) (-532.673) [-532.472] -- 0:01:02

      Average standard deviation of split frequencies: 0.003101

      455500 -- (-536.794) (-536.371) [-541.061] (-539.740) * (-544.266) (-539.232) [-533.932] (-534.252) -- 0:01:02
      456000 -- (-533.394) [-537.255] (-535.784) (-541.047) * (-539.426) (-538.441) (-538.852) [-538.345] -- 0:01:02
      456500 -- (-536.887) (-540.161) [-532.703] (-538.048) * (-536.026) (-544.989) [-538.771] (-538.015) -- 0:01:01
      457000 -- [-537.245] (-539.697) (-531.665) (-541.385) * [-536.909] (-543.526) (-537.178) (-540.696) -- 0:01:01
      457500 -- [-530.858] (-544.804) (-538.422) (-541.802) * [-541.252] (-538.631) (-539.321) (-534.651) -- 0:01:02
      458000 -- [-535.400] (-537.553) (-539.611) (-534.903) * (-535.435) (-540.615) (-540.062) [-536.516] -- 0:01:02
      458500 -- [-537.217] (-538.995) (-539.536) (-549.463) * (-537.509) (-544.050) (-537.305) [-537.746] -- 0:01:02
      459000 -- (-540.291) (-545.871) (-536.190) [-533.842] * [-540.980] (-536.707) (-536.510) (-541.391) -- 0:01:02
      459500 -- (-542.013) (-537.675) [-532.628] (-540.351) * (-543.753) (-538.464) (-542.223) [-539.850] -- 0:01:02
      460000 -- (-544.355) (-539.065) [-532.160] (-540.199) * [-535.888] (-538.211) (-535.536) (-539.266) -- 0:01:02

      Average standard deviation of split frequencies: 0.003582

      460500 -- (-533.247) (-538.666) [-534.046] (-544.489) * (-537.339) (-537.334) (-540.313) [-534.352] -- 0:01:02
      461000 -- [-535.314] (-538.176) (-539.422) (-538.405) * [-537.357] (-538.998) (-535.662) (-545.887) -- 0:01:01
      461500 -- (-534.172) (-539.069) [-539.439] (-546.675) * [-538.421] (-536.642) (-542.284) (-538.526) -- 0:01:01
      462000 -- (-536.827) (-542.566) [-531.521] (-540.619) * (-541.105) [-537.441] (-547.270) (-543.801) -- 0:01:01
      462500 -- (-536.704) [-535.936] (-536.797) (-538.205) * (-537.576) [-539.791] (-543.469) (-538.155) -- 0:01:01
      463000 -- (-532.785) (-533.458) [-533.820] (-547.950) * (-533.483) (-544.595) (-539.268) [-539.125] -- 0:01:01
      463500 -- [-530.607] (-532.881) (-545.717) (-539.502) * (-534.480) (-543.407) (-539.908) [-540.165] -- 0:01:01
      464000 -- [-534.006] (-536.530) (-537.514) (-542.991) * (-536.031) (-544.724) (-538.542) [-540.682] -- 0:01:01
      464500 -- (-535.290) (-538.424) [-535.210] (-542.628) * (-540.497) (-538.063) (-535.831) [-536.909] -- 0:01:01
      465000 -- (-540.829) (-541.012) [-533.993] (-538.753) * (-538.213) [-536.198] (-539.218) (-534.933) -- 0:01:00

      Average standard deviation of split frequencies: 0.003035

      465500 -- [-533.159] (-534.381) (-537.193) (-534.983) * (-547.096) (-546.115) (-535.741) [-540.236] -- 0:01:00
      466000 -- (-541.960) (-536.283) (-542.996) [-537.925] * (-543.378) (-544.916) [-536.773] (-538.293) -- 0:01:01
      466500 -- (-533.763) [-538.331] (-540.028) (-536.061) * (-541.984) (-536.810) [-535.698] (-536.612) -- 0:01:01
      467000 -- (-535.647) (-537.760) (-538.642) [-539.270] * (-545.151) (-534.866) (-539.564) [-533.507] -- 0:01:01
      467500 -- (-535.724) (-547.406) [-536.669] (-540.646) * (-543.698) [-536.751] (-538.723) (-534.148) -- 0:01:01
      468000 -- [-536.185] (-547.618) (-539.652) (-537.449) * (-548.268) (-537.669) (-542.825) [-538.088] -- 0:01:01
      468500 -- [-530.461] (-539.733) (-538.962) (-540.076) * (-545.856) (-543.438) [-535.879] (-542.719) -- 0:01:01
      469000 -- (-535.143) (-540.367) (-538.135) [-532.500] * (-541.688) (-542.195) [-531.975] (-530.679) -- 0:01:01
      469500 -- [-537.607] (-538.417) (-541.359) (-537.149) * (-546.775) (-545.576) (-534.761) [-531.963] -- 0:01:01
      470000 -- (-537.975) [-536.180] (-538.513) (-537.868) * (-554.886) (-535.456) [-537.600] (-542.276) -- 0:01:00

      Average standard deviation of split frequencies: 0.004006

      470500 -- (-533.720) [-543.467] (-542.796) (-535.492) * (-550.969) (-535.818) (-536.260) [-536.680] -- 0:01:00
      471000 -- (-532.840) (-540.089) [-534.734] (-531.455) * (-545.409) [-536.070] (-542.397) (-535.715) -- 0:01:00
      471500 -- (-540.014) [-538.138] (-535.105) (-538.207) * [-539.056] (-537.780) (-542.918) (-547.908) -- 0:01:00
      472000 -- (-543.166) (-543.426) [-531.494] (-534.118) * (-540.938) [-534.204] (-535.633) (-545.659) -- 0:01:00
      472500 -- [-537.608] (-536.689) (-537.890) (-538.220) * (-546.593) [-541.439] (-538.939) (-543.494) -- 0:01:00
      473000 -- (-539.194) [-535.679] (-535.600) (-534.806) * [-545.592] (-541.609) (-538.343) (-540.259) -- 0:01:00
      473500 -- [-535.737] (-543.815) (-536.948) (-543.943) * (-541.362) [-538.962] (-547.963) (-535.784) -- 0:01:00
      474000 -- (-537.797) [-537.935] (-532.605) (-535.724) * (-536.128) (-537.897) [-533.056] (-541.870) -- 0:00:59
      474500 -- (-544.899) (-546.096) (-539.343) [-535.532] * [-535.404] (-539.128) (-542.193) (-538.713) -- 0:00:59
      475000 -- (-543.502) [-548.197] (-541.064) (-534.100) * (-540.985) (-539.712) [-537.801] (-541.083) -- 0:01:00

      Average standard deviation of split frequencies: 0.002971

      475500 -- (-542.172) (-538.923) [-537.892] (-541.360) * (-546.140) (-542.599) (-537.126) [-535.785] -- 0:01:00
      476000 -- (-535.494) (-530.851) [-537.593] (-540.666) * (-541.035) (-537.707) [-534.098] (-537.817) -- 0:01:00
      476500 -- (-538.873) [-539.784] (-537.475) (-541.662) * (-537.897) (-535.779) [-538.490] (-533.623) -- 0:01:00
      477000 -- (-531.252) [-531.903] (-540.995) (-538.634) * (-534.255) [-535.282] (-538.524) (-537.393) -- 0:01:00
      477500 -- (-538.278) (-537.380) [-537.167] (-542.442) * (-541.330) (-544.859) [-536.361] (-536.646) -- 0:01:00
      478000 -- (-542.767) (-539.583) [-536.749] (-538.001) * (-540.515) (-541.191) [-537.118] (-541.478) -- 0:01:00
      478500 -- (-540.924) [-539.464] (-538.516) (-540.653) * (-540.806) (-542.344) (-538.881) [-536.557] -- 0:00:59
      479000 -- (-533.339) [-536.377] (-533.988) (-538.265) * (-532.495) [-533.163] (-545.122) (-531.933) -- 0:00:59
      479500 -- (-541.670) (-534.888) [-541.173] (-536.460) * (-537.872) (-539.491) [-534.522] (-535.422) -- 0:00:59
      480000 -- (-549.345) [-535.407] (-545.346) (-537.348) * (-532.569) (-537.716) (-536.730) [-533.176] -- 0:00:59

      Average standard deviation of split frequencies: 0.002452

      480500 -- (-535.624) [-538.015] (-536.060) (-537.850) * [-534.776] (-537.043) (-538.081) (-534.181) -- 0:00:59
      481000 -- (-540.179) (-541.594) (-541.362) [-532.900] * (-533.366) [-538.650] (-540.521) (-538.268) -- 0:00:59
      481500 -- (-538.551) (-535.668) (-539.841) [-534.434] * (-534.651) (-538.681) [-535.022] (-534.391) -- 0:00:59
      482000 -- [-539.799] (-537.490) (-538.227) (-535.687) * [-533.697] (-532.681) (-538.964) (-535.473) -- 0:00:59
      482500 -- (-544.746) [-536.845] (-536.956) (-533.492) * (-535.809) [-537.711] (-539.229) (-542.778) -- 0:00:58
      483000 -- [-540.020] (-540.537) (-538.690) (-538.799) * (-541.003) (-537.369) (-535.688) [-534.838] -- 0:00:58
      483500 -- (-535.926) (-537.349) (-539.620) [-539.738] * (-538.515) (-542.583) (-532.912) [-538.226] -- 0:00:59
      484000 -- (-532.203) (-536.619) [-534.859] (-539.203) * (-536.799) [-540.290] (-538.476) (-541.388) -- 0:00:59
      484500 -- [-538.973] (-542.921) (-540.587) (-530.817) * (-536.369) (-543.281) [-545.262] (-536.450) -- 0:00:59
      485000 -- [-536.678] (-539.394) (-539.071) (-534.203) * (-536.259) [-536.133] (-534.635) (-537.298) -- 0:00:59

      Average standard deviation of split frequencies: 0.002425

      485500 -- (-545.248) (-537.633) (-533.882) [-532.424] * (-547.607) [-546.021] (-534.595) (-534.441) -- 0:00:59
      486000 -- (-534.731) [-543.871] (-537.357) (-538.188) * (-535.897) (-541.292) (-535.687) [-537.278] -- 0:00:59
      486500 -- (-546.140) (-544.082) [-532.964] (-533.047) * (-546.296) [-535.691] (-544.115) (-534.663) -- 0:00:59
      487000 -- (-534.662) (-538.825) [-536.890] (-538.287) * (-538.393) (-534.381) [-534.755] (-535.981) -- 0:00:58
      487500 -- (-543.271) (-539.671) (-534.352) [-535.062] * (-546.146) [-532.757] (-537.910) (-538.705) -- 0:00:58
      488000 -- (-540.971) (-534.218) [-539.022] (-536.236) * (-536.948) [-537.877] (-536.538) (-545.806) -- 0:00:58
      488500 -- (-542.257) (-537.406) [-535.943] (-537.607) * (-544.828) [-532.847] (-538.133) (-535.263) -- 0:00:58
      489000 -- (-541.041) (-532.654) [-537.197] (-535.602) * (-542.673) (-538.755) [-536.458] (-536.668) -- 0:00:58
      489500 -- (-538.010) (-539.702) [-530.069] (-531.985) * (-540.920) (-537.749) [-538.931] (-540.357) -- 0:00:58
      490000 -- (-539.210) (-541.850) [-538.028] (-536.554) * (-538.566) [-533.912] (-550.903) (-535.160) -- 0:00:58

      Average standard deviation of split frequencies: 0.002402

      490500 -- (-543.447) [-539.799] (-534.644) (-536.497) * (-540.165) (-536.003) [-536.319] (-534.866) -- 0:00:58
      491000 -- [-535.813] (-539.686) (-548.495) (-541.044) * (-537.299) (-534.008) (-538.047) [-534.707] -- 0:00:58
      491500 -- (-538.915) (-538.915) [-532.650] (-533.147) * (-540.299) (-534.326) [-538.504] (-535.804) -- 0:00:57
      492000 -- (-539.202) (-539.243) (-537.961) [-540.970] * [-539.163] (-538.796) (-545.581) (-538.722) -- 0:00:58
      492500 -- (-541.277) (-538.986) (-536.626) [-534.825] * (-541.641) (-536.249) (-539.641) [-538.977] -- 0:00:58
      493000 -- (-535.878) (-537.835) (-537.373) [-531.868] * (-539.625) (-532.372) [-535.923] (-534.511) -- 0:00:58
      493500 -- (-533.808) (-539.020) [-535.952] (-532.942) * [-537.048] (-533.754) (-541.937) (-539.612) -- 0:00:58
      494000 -- [-536.628] (-541.678) (-534.593) (-537.245) * (-537.832) [-534.649] (-540.245) (-539.358) -- 0:00:58
      494500 -- (-536.557) [-541.283] (-539.248) (-535.072) * (-533.840) (-535.312) (-544.119) [-534.153] -- 0:00:58
      495000 -- (-542.028) [-537.204] (-544.857) (-535.061) * [-536.722] (-542.137) (-535.969) (-536.175) -- 0:00:58

      Average standard deviation of split frequencies: 0.002376

      495500 -- (-532.162) (-541.483) [-534.816] (-533.422) * (-538.426) (-537.598) (-537.577) [-535.047] -- 0:00:58
      496000 -- (-535.727) (-532.934) (-542.519) [-534.958] * (-536.631) [-541.654] (-544.050) (-535.090) -- 0:00:57
      496500 -- (-536.320) (-552.135) (-540.405) [-539.189] * [-536.310] (-537.886) (-536.198) (-534.262) -- 0:00:57
      497000 -- (-538.185) (-536.610) [-534.261] (-548.188) * [-537.528] (-531.524) (-541.916) (-534.433) -- 0:00:57
      497500 -- (-538.311) [-539.358] (-539.999) (-539.210) * (-541.391) (-537.641) [-545.511] (-534.334) -- 0:00:57
      498000 -- (-545.895) (-536.067) [-536.915] (-549.298) * (-539.664) (-537.927) [-534.805] (-548.511) -- 0:00:57
      498500 -- [-534.340] (-532.179) (-535.864) (-544.706) * (-533.663) [-533.658] (-539.133) (-538.167) -- 0:00:57
      499000 -- (-537.204) (-533.388) [-535.294] (-545.473) * (-533.527) (-544.217) (-538.952) [-538.893] -- 0:00:57
      499500 -- (-538.624) [-537.988] (-540.730) (-540.265) * (-532.924) [-538.469] (-537.606) (-536.324) -- 0:00:57
      500000 -- [-537.329] (-535.751) (-543.556) (-539.268) * (-537.625) (-536.788) (-538.313) [-537.316] -- 0:00:57

      Average standard deviation of split frequencies: 0.002354

      500500 -- (-536.779) [-536.118] (-534.574) (-533.418) * (-539.795) (-537.440) (-538.193) [-536.324] -- 0:00:56
      501000 -- (-537.647) [-539.632] (-543.619) (-538.732) * (-537.878) (-543.503) [-537.018] (-537.532) -- 0:00:57
      501500 -- (-545.179) [-536.921] (-540.521) (-537.027) * [-532.177] (-539.409) (-538.217) (-538.541) -- 0:00:57
      502000 -- [-537.321] (-537.222) (-534.724) (-545.370) * (-535.795) (-534.148) [-534.811] (-536.303) -- 0:00:57
      502500 -- (-542.786) [-536.540] (-539.300) (-542.265) * (-538.848) (-537.182) (-532.412) [-535.570] -- 0:00:57
      503000 -- (-540.842) (-538.019) (-536.828) [-538.690] * (-535.671) (-535.430) (-537.652) [-537.164] -- 0:00:57
      503500 -- [-533.437] (-543.012) (-536.220) (-530.317) * (-541.087) (-533.619) [-533.790] (-537.897) -- 0:00:57
      504000 -- [-532.375] (-541.967) (-533.433) (-548.901) * (-535.860) (-535.401) (-535.477) [-535.711] -- 0:00:57
      504500 -- (-541.565) (-533.320) (-542.598) [-540.639] * (-534.243) (-536.567) [-532.983] (-534.877) -- 0:00:56
      505000 -- (-538.168) (-531.447) [-540.474] (-537.116) * (-534.570) (-539.493) (-535.994) [-529.469] -- 0:00:56

      Average standard deviation of split frequencies: 0.002795

      505500 -- [-536.613] (-537.197) (-538.681) (-535.604) * (-535.925) [-540.114] (-532.511) (-540.649) -- 0:00:56
      506000 -- (-535.182) (-534.274) (-530.580) [-536.667] * [-539.979] (-541.180) (-538.615) (-538.374) -- 0:00:56
      506500 -- (-532.307) (-534.402) [-533.253] (-531.250) * (-537.923) [-539.194] (-532.656) (-533.540) -- 0:00:56
      507000 -- (-533.212) (-536.510) (-538.677) [-536.626] * (-538.548) [-540.550] (-537.958) (-534.332) -- 0:00:56
      507500 -- (-536.156) (-532.696) (-539.071) [-540.805] * [-535.562] (-546.534) (-537.942) (-539.076) -- 0:00:56
      508000 -- [-533.811] (-541.538) (-542.611) (-537.007) * (-535.340) [-540.265] (-539.644) (-543.944) -- 0:00:56
      508500 -- [-539.915] (-537.513) (-541.172) (-536.030) * (-540.056) (-544.490) (-540.473) [-535.693] -- 0:00:56
      509000 -- (-537.023) [-535.089] (-542.122) (-539.575) * (-538.188) (-539.971) [-541.367] (-541.468) -- 0:00:55
      509500 -- (-536.268) (-543.584) (-544.046) [-538.436] * (-536.572) [-541.083] (-536.422) (-537.332) -- 0:00:56
      510000 -- [-535.724] (-534.850) (-540.360) (-535.386) * [-534.049] (-537.773) (-538.456) (-542.029) -- 0:00:56

      Average standard deviation of split frequencies: 0.002769

      510500 -- (-545.223) [-536.194] (-539.622) (-542.213) * (-538.849) (-540.205) (-534.707) [-537.823] -- 0:00:56
      511000 -- (-536.511) (-539.885) (-543.226) [-540.801] * (-539.189) (-540.581) (-546.337) [-536.576] -- 0:00:56
      511500 -- [-538.242] (-533.114) (-536.000) (-538.277) * (-547.520) (-542.856) (-543.632) [-532.171] -- 0:00:56
      512000 -- (-539.702) [-537.065] (-539.329) (-541.839) * (-538.807) (-539.021) (-541.828) [-536.978] -- 0:00:56
      512500 -- (-532.519) (-537.908) [-540.485] (-538.297) * (-537.067) (-544.985) (-544.318) [-533.390] -- 0:00:56
      513000 -- (-540.645) [-537.729] (-539.751) (-540.141) * (-540.214) (-541.368) [-539.032] (-542.409) -- 0:00:56
      513500 -- (-549.427) [-533.524] (-539.778) (-538.565) * (-540.314) (-538.834) (-542.411) [-540.163] -- 0:00:55
      514000 -- (-536.712) [-537.698] (-555.616) (-538.276) * [-541.352] (-538.939) (-539.551) (-541.121) -- 0:00:55
      514500 -- (-539.629) [-539.252] (-545.658) (-537.292) * [-541.418] (-539.077) (-537.208) (-533.570) -- 0:00:55
      515000 -- (-536.771) (-534.589) (-539.443) [-533.086] * [-537.258] (-542.594) (-544.949) (-537.187) -- 0:00:55

      Average standard deviation of split frequencies: 0.002741

      515500 -- (-541.479) (-534.960) (-535.896) [-538.782] * (-538.936) (-537.396) (-542.850) [-540.478] -- 0:00:55
      516000 -- (-543.770) (-536.343) [-541.011] (-541.809) * (-544.637) (-535.550) (-548.065) [-534.349] -- 0:00:55
      516500 -- (-535.357) (-534.300) [-537.925] (-551.482) * (-540.735) [-535.024] (-538.153) (-534.626) -- 0:00:55
      517000 -- (-542.215) [-536.580] (-539.490) (-547.233) * (-536.635) (-539.005) (-543.732) [-533.973] -- 0:00:55
      517500 -- (-540.273) (-540.760) [-536.798] (-538.872) * (-541.955) (-536.009) (-538.150) [-531.995] -- 0:00:55
      518000 -- [-536.958] (-540.823) (-537.538) (-544.984) * (-534.216) (-541.545) (-544.360) [-532.845] -- 0:00:54
      518500 -- (-539.942) (-542.891) [-540.546] (-542.018) * (-536.023) (-539.729) (-544.723) [-537.621] -- 0:00:55
      519000 -- (-533.826) (-536.227) (-540.922) [-543.058] * (-537.482) (-544.196) [-537.199] (-539.649) -- 0:00:55
      519500 -- (-540.096) (-547.921) (-535.263) [-536.981] * (-539.941) (-540.170) [-537.725] (-544.960) -- 0:00:55
      520000 -- [-533.244] (-537.544) (-539.122) (-539.885) * (-541.045) (-536.683) [-534.903] (-536.534) -- 0:00:55

      Average standard deviation of split frequencies: 0.002716

      520500 -- (-536.137) [-540.681] (-539.787) (-543.464) * (-534.853) (-540.351) (-531.339) [-537.823] -- 0:00:55
      521000 -- (-546.727) (-536.646) [-542.232] (-544.104) * (-539.957) (-541.345) [-536.065] (-533.920) -- 0:00:55
      521500 -- (-544.002) (-537.233) (-540.583) [-540.855] * (-538.480) (-536.751) [-540.714] (-537.985) -- 0:00:55
      522000 -- [-540.423] (-537.731) (-540.915) (-537.442) * (-542.871) (-543.659) [-537.875] (-532.911) -- 0:00:54
      522500 -- [-534.724] (-543.244) (-546.964) (-543.221) * [-533.059] (-541.753) (-540.573) (-537.092) -- 0:00:54
      523000 -- (-537.025) (-540.277) (-545.811) [-537.792] * (-532.937) (-542.841) [-536.795] (-536.319) -- 0:00:54
      523500 -- (-537.180) [-542.727] (-544.948) (-538.895) * [-545.897] (-540.395) (-539.136) (-536.100) -- 0:00:54
      524000 -- [-538.488] (-547.787) (-544.829) (-536.135) * (-539.065) [-538.016] (-534.938) (-547.060) -- 0:00:54
      524500 -- [-540.364] (-539.111) (-539.831) (-538.750) * (-536.751) (-542.800) [-541.386] (-536.409) -- 0:00:54
      525000 -- (-546.565) (-539.854) (-538.174) [-541.618] * (-542.632) (-539.488) (-537.545) [-535.275] -- 0:00:54

      Average standard deviation of split frequencies: 0.002689

      525500 -- (-536.036) [-534.671] (-542.861) (-544.600) * (-536.081) (-539.161) [-536.077] (-533.614) -- 0:00:54
      526000 -- (-545.866) [-537.262] (-539.003) (-545.427) * (-532.848) (-536.907) [-541.245] (-538.998) -- 0:00:54
      526500 -- (-538.739) (-538.266) [-539.112] (-542.592) * (-535.816) (-538.973) [-535.978] (-544.239) -- 0:00:53
      527000 -- (-535.897) (-541.913) [-539.227] (-539.881) * (-543.420) [-536.844] (-537.864) (-544.560) -- 0:00:54
      527500 -- (-532.352) (-544.546) [-538.633] (-538.817) * (-536.385) (-536.625) (-535.004) [-543.487] -- 0:00:54
      528000 -- (-538.890) (-538.564) (-538.039) [-538.586] * (-533.916) (-544.071) (-535.338) [-536.882] -- 0:00:54
      528500 -- (-542.823) (-546.222) (-549.916) [-533.995] * (-540.955) [-534.526] (-533.356) (-534.985) -- 0:00:54
      529000 -- [-540.916] (-541.663) (-536.316) (-541.306) * (-535.612) [-540.119] (-536.284) (-538.526) -- 0:00:54
      529500 -- (-541.478) (-537.167) (-548.575) [-545.693] * (-538.539) (-540.927) (-539.435) [-537.913] -- 0:00:54
      530000 -- (-542.318) (-537.223) (-541.433) [-544.191] * (-535.871) (-538.468) [-543.586] (-535.968) -- 0:00:54

      Average standard deviation of split frequencies: 0.003553

      530500 -- [-536.243] (-535.831) (-537.683) (-542.045) * (-540.083) (-543.429) [-542.559] (-544.671) -- 0:00:53
      531000 -- (-538.003) [-537.035] (-541.879) (-541.716) * (-536.684) (-543.389) [-534.003] (-536.058) -- 0:00:53
      531500 -- [-531.535] (-540.404) (-540.672) (-534.113) * (-538.321) (-535.637) (-533.951) [-536.161] -- 0:00:53
      532000 -- (-537.892) (-539.824) [-538.538] (-535.407) * [-538.086] (-538.640) (-537.461) (-536.200) -- 0:00:53
      532500 -- [-537.931] (-543.579) (-533.498) (-536.583) * (-534.116) (-546.203) [-532.361] (-532.161) -- 0:00:53
      533000 -- [-533.948] (-534.731) (-537.164) (-541.658) * [-536.437] (-546.897) (-536.422) (-534.367) -- 0:00:53
      533500 -- (-538.087) (-536.227) (-535.890) [-537.925] * (-541.409) (-543.342) (-535.796) [-535.699] -- 0:00:53
      534000 -- (-534.118) [-540.717] (-538.070) (-538.618) * (-543.511) (-540.324) (-534.466) [-539.154] -- 0:00:53
      534500 -- (-537.345) [-535.730] (-534.642) (-543.256) * (-547.974) (-540.998) (-540.766) [-537.353] -- 0:00:53
      535000 -- (-543.352) (-545.813) [-538.340] (-542.860) * (-542.307) (-541.180) [-543.146] (-539.357) -- 0:00:53

      Average standard deviation of split frequencies: 0.002638

      535500 -- (-540.846) (-538.040) (-544.253) [-533.470] * (-551.476) (-539.280) (-541.376) [-536.032] -- 0:00:53
      536000 -- (-538.954) (-536.945) [-531.876] (-537.175) * [-538.055] (-538.619) (-535.960) (-537.412) -- 0:00:53
      536500 -- (-538.364) [-535.689] (-533.917) (-536.330) * (-544.837) (-541.957) [-539.252] (-545.547) -- 0:00:53
      537000 -- [-535.285] (-544.434) (-539.302) (-538.531) * (-542.578) (-541.838) [-536.679] (-541.193) -- 0:00:53
      537500 -- (-538.874) (-539.369) [-536.946] (-536.663) * (-539.874) (-543.387) [-536.438] (-547.673) -- 0:00:53
      538000 -- (-542.564) (-540.834) (-539.920) [-539.143] * (-540.859) (-540.521) [-538.213] (-545.094) -- 0:00:53
      538500 -- (-545.372) (-544.955) (-538.623) [-538.307] * (-542.154) [-534.347] (-535.946) (-547.889) -- 0:00:53
      539000 -- (-545.700) (-547.000) [-536.838] (-535.549) * (-539.948) [-540.074] (-545.253) (-544.766) -- 0:00:53
      539500 -- (-540.992) (-537.819) [-541.113] (-535.891) * (-541.529) (-538.252) (-537.780) [-536.767] -- 0:00:52
      540000 -- (-540.415) (-539.602) (-537.164) [-551.697] * (-545.630) (-542.700) [-534.615] (-536.061) -- 0:00:52

      Average standard deviation of split frequencies: 0.003052

      540500 -- (-539.561) (-539.734) (-543.225) [-543.678] * [-547.528] (-536.191) (-537.893) (-543.090) -- 0:00:52
      541000 -- (-538.815) (-536.386) [-532.425] (-539.360) * [-540.926] (-544.899) (-540.852) (-536.233) -- 0:00:52
      541500 -- (-537.664) (-542.409) [-538.654] (-538.607) * (-548.812) (-540.886) [-535.769] (-542.182) -- 0:00:52
      542000 -- (-537.288) [-537.105] (-542.739) (-539.694) * (-540.492) (-537.995) [-534.806] (-540.527) -- 0:00:52
      542500 -- (-536.559) (-547.262) [-535.837] (-537.039) * (-537.351) [-539.692] (-534.494) (-536.560) -- 0:00:52
      543000 -- [-540.118] (-537.297) (-537.812) (-538.890) * [-548.480] (-542.424) (-536.252) (-539.314) -- 0:00:52
      543500 -- (-539.639) [-536.689] (-542.224) (-538.098) * [-541.218] (-534.619) (-535.531) (-542.293) -- 0:00:52
      544000 -- (-538.040) (-544.845) (-537.856) [-538.460] * (-538.326) [-533.191] (-537.785) (-539.281) -- 0:00:51
      544500 -- [-538.109] (-535.198) (-542.911) (-536.530) * (-539.233) (-542.086) [-534.002] (-544.505) -- 0:00:52
      545000 -- (-532.145) [-538.817] (-537.828) (-541.024) * (-539.971) (-540.441) [-538.768] (-544.570) -- 0:00:52

      Average standard deviation of split frequencies: 0.002158

      545500 -- [-531.953] (-537.528) (-542.035) (-531.000) * [-544.271] (-550.515) (-533.222) (-539.975) -- 0:00:52
      546000 -- [-535.053] (-537.186) (-535.446) (-539.664) * (-544.115) (-544.509) [-535.404] (-536.509) -- 0:00:52
      546500 -- (-534.624) (-540.730) (-534.100) [-536.472] * (-540.367) (-540.678) (-539.547) [-534.260] -- 0:00:52
      547000 -- (-535.400) (-542.459) (-538.430) [-538.753] * (-535.588) (-538.658) (-537.807) [-540.721] -- 0:00:52
      547500 -- (-542.369) [-533.767] (-543.264) (-535.142) * (-537.316) [-535.704] (-532.082) (-544.989) -- 0:00:52
      548000 -- (-536.927) (-539.002) (-544.762) [-531.499] * (-537.298) (-535.082) [-533.622] (-533.814) -- 0:00:51
      548500 -- [-539.241] (-535.005) (-541.672) (-537.763) * (-536.075) (-544.739) [-536.593] (-534.407) -- 0:00:51
      549000 -- [-540.755] (-536.232) (-542.327) (-535.771) * [-533.890] (-540.854) (-539.279) (-533.795) -- 0:00:51
      549500 -- (-533.968) (-539.986) [-536.465] (-534.912) * (-536.591) (-545.548) (-537.666) [-534.820] -- 0:00:51
      550000 -- (-539.131) [-535.673] (-538.609) (-536.587) * (-538.323) (-540.829) [-536.997] (-537.567) -- 0:00:51

      Average standard deviation of split frequencies: 0.002568

      550500 -- [-534.392] (-534.645) (-545.443) (-533.893) * [-537.570] (-534.238) (-537.795) (-543.927) -- 0:00:51
      551000 -- (-545.694) (-539.447) (-535.940) [-539.477] * [-537.668] (-535.013) (-536.901) (-534.969) -- 0:00:51
      551500 -- (-539.245) (-537.979) (-534.413) [-542.040] * [-534.222] (-537.132) (-532.418) (-535.407) -- 0:00:51
      552000 -- (-540.910) (-538.952) [-534.734] (-541.283) * (-531.028) (-542.846) (-534.178) [-536.859] -- 0:00:51
      552500 -- (-543.862) [-539.985] (-535.402) (-545.228) * (-537.788) (-536.183) (-535.646) [-538.177] -- 0:00:51
      553000 -- (-539.035) (-544.256) [-540.021] (-535.933) * (-535.986) [-536.589] (-537.962) (-541.263) -- 0:00:51
      553500 -- (-539.256) (-536.265) [-535.047] (-538.545) * [-531.674] (-534.095) (-536.650) (-541.597) -- 0:00:51
      554000 -- (-540.122) [-532.467] (-538.436) (-538.508) * (-544.544) [-536.816] (-537.907) (-538.916) -- 0:00:51
      554500 -- (-541.709) (-536.998) [-541.604] (-538.350) * (-537.364) (-537.843) (-538.946) [-543.410] -- 0:00:51
      555000 -- (-540.695) (-537.938) [-536.062] (-542.347) * [-539.875] (-541.556) (-541.174) (-538.260) -- 0:00:51

      Average standard deviation of split frequencies: 0.002120

      555500 -- (-539.943) (-534.278) [-540.648] (-548.005) * (-538.743) (-535.988) [-532.697] (-536.364) -- 0:00:51
      556000 -- (-540.792) (-541.048) (-536.028) [-535.276] * (-533.233) (-538.422) [-532.836] (-541.511) -- 0:00:51
      556500 -- (-541.928) [-534.544] (-543.294) (-541.940) * (-548.357) [-535.530] (-535.740) (-536.898) -- 0:00:51
      557000 -- [-535.265] (-535.745) (-536.315) (-536.342) * (-537.300) [-540.878] (-534.016) (-535.294) -- 0:00:50
      557500 -- (-534.485) [-539.018] (-534.858) (-549.247) * [-537.150] (-536.198) (-535.830) (-543.339) -- 0:00:50
      558000 -- (-530.013) [-532.698] (-535.301) (-538.852) * [-536.117] (-539.055) (-535.913) (-540.108) -- 0:00:50
      558500 -- (-542.658) [-531.710] (-533.358) (-535.513) * [-531.983] (-551.409) (-537.392) (-545.133) -- 0:00:50
      559000 -- (-540.963) (-537.972) (-533.633) [-545.349] * (-538.617) [-538.943] (-534.431) (-540.303) -- 0:00:50
      559500 -- [-532.715] (-531.252) (-532.634) (-540.397) * (-535.659) [-537.221] (-532.788) (-536.270) -- 0:00:50
      560000 -- (-539.760) [-535.273] (-536.780) (-538.863) * (-533.083) (-540.904) (-542.453) [-531.838] -- 0:00:50

      Average standard deviation of split frequencies: 0.002522

      560500 -- (-536.292) (-537.981) [-533.880] (-541.866) * (-532.918) (-540.354) (-535.768) [-533.957] -- 0:00:50
      561000 -- (-536.232) [-533.901] (-535.789) (-540.719) * (-535.200) [-543.660] (-534.138) (-542.545) -- 0:00:50
      561500 -- (-534.729) [-539.347] (-533.516) (-539.890) * (-535.244) (-537.206) (-534.559) [-535.685] -- 0:00:50
      562000 -- [-536.144] (-529.355) (-539.098) (-548.068) * (-534.825) (-537.835) (-538.314) [-538.522] -- 0:00:50
      562500 -- (-539.266) (-537.857) (-536.179) [-538.296] * (-534.691) [-535.612] (-536.941) (-542.848) -- 0:00:50
      563000 -- (-540.630) [-532.898] (-537.263) (-535.049) * [-535.875] (-550.128) (-543.230) (-543.393) -- 0:00:50
      563500 -- (-539.025) (-535.630) (-539.721) [-533.384] * (-536.778) (-534.107) [-535.906] (-545.790) -- 0:00:50
      564000 -- (-537.283) (-537.625) (-534.813) [-541.622] * (-538.310) [-534.066] (-539.167) (-536.446) -- 0:00:50
      564500 -- (-537.189) [-536.586] (-539.837) (-540.613) * [-535.387] (-536.134) (-540.069) (-538.417) -- 0:00:50
      565000 -- (-531.874) (-535.893) [-534.952] (-537.688) * (-535.600) [-537.188] (-539.328) (-533.619) -- 0:00:50

      Average standard deviation of split frequencies: 0.002915

      565500 -- (-540.463) (-534.314) [-538.917] (-540.234) * [-532.378] (-531.805) (-543.888) (-542.684) -- 0:00:49
      566000 -- (-538.260) (-531.970) [-540.279] (-543.034) * (-537.672) [-531.818] (-541.607) (-536.179) -- 0:00:49
      566500 -- [-534.370] (-536.575) (-543.246) (-537.152) * (-538.036) [-535.205] (-551.162) (-548.120) -- 0:00:49
      567000 -- (-532.238) [-536.508] (-537.688) (-545.175) * [-539.096] (-537.824) (-549.941) (-542.531) -- 0:00:49
      567500 -- (-533.025) (-542.248) (-539.883) [-544.276] * (-535.478) (-540.048) [-539.672] (-540.326) -- 0:00:49
      568000 -- [-533.929] (-539.578) (-541.612) (-540.760) * (-537.328) [-538.531] (-542.621) (-545.462) -- 0:00:49
      568500 -- (-534.634) (-537.297) [-535.994] (-544.419) * [-532.706] (-539.015) (-542.081) (-539.989) -- 0:00:49
      569000 -- [-539.331] (-540.913) (-541.952) (-540.654) * (-534.823) (-542.729) [-537.590] (-540.279) -- 0:00:49
      569500 -- (-539.399) (-532.132) [-542.259] (-544.605) * [-535.317] (-538.559) (-538.413) (-538.832) -- 0:00:49
      570000 -- (-539.362) (-538.140) [-534.594] (-543.276) * [-535.709] (-539.257) (-530.585) (-539.370) -- 0:00:49

      Average standard deviation of split frequencies: 0.002478

      570500 -- (-539.855) (-535.355) [-533.587] (-539.976) * [-531.140] (-540.148) (-536.935) (-535.038) -- 0:00:49
      571000 -- (-541.771) (-531.512) (-535.847) [-540.362] * (-532.112) [-540.816] (-538.157) (-538.290) -- 0:00:49
      571500 -- [-533.952] (-542.866) (-537.735) (-543.710) * (-536.250) (-535.783) [-534.191] (-538.446) -- 0:00:49
      572000 -- (-537.517) (-539.639) [-540.603] (-538.860) * (-537.240) (-536.058) [-533.333] (-541.261) -- 0:00:49
      572500 -- (-547.782) (-535.828) (-541.447) [-539.277] * (-538.047) (-537.298) (-539.131) [-546.544] -- 0:00:49
      573000 -- [-533.797] (-539.427) (-536.785) (-541.193) * (-544.094) (-532.709) (-540.701) [-534.204] -- 0:00:49
      573500 -- [-532.377] (-536.042) (-545.152) (-538.910) * (-545.641) (-539.952) (-539.764) [-539.499] -- 0:00:49
      574000 -- (-542.400) [-535.267] (-540.985) (-542.900) * (-549.282) (-544.408) [-532.875] (-532.773) -- 0:00:48
      574500 -- (-538.224) (-535.544) [-540.496] (-540.624) * [-538.597] (-535.264) (-534.952) (-539.966) -- 0:00:48
      575000 -- (-536.674) (-542.383) [-532.167] (-536.701) * (-548.241) (-531.573) [-532.074] (-540.883) -- 0:00:48

      Average standard deviation of split frequencies: 0.002455

      575500 -- [-545.604] (-540.184) (-534.991) (-537.583) * (-554.296) [-532.778] (-535.611) (-537.622) -- 0:00:48
      576000 -- (-533.001) (-537.505) (-538.825) [-544.931] * (-542.925) (-538.448) [-534.443] (-539.493) -- 0:00:48
      576500 -- (-532.751) [-534.103] (-543.255) (-539.869) * (-546.674) (-537.962) (-534.555) [-534.611] -- 0:00:48
      577000 -- (-540.731) (-539.467) [-536.563] (-542.469) * (-547.450) [-536.405] (-543.916) (-535.976) -- 0:00:48
      577500 -- (-534.756) [-538.383] (-536.600) (-546.428) * (-540.169) [-538.527] (-539.290) (-537.818) -- 0:00:48
      578000 -- (-535.143) (-540.120) [-538.250] (-547.857) * (-540.856) [-540.009] (-536.251) (-541.145) -- 0:00:48
      578500 -- (-534.507) (-534.941) [-536.422] (-547.090) * (-550.598) [-533.346] (-537.956) (-535.880) -- 0:00:48
      579000 -- (-541.041) (-539.973) (-537.935) [-535.205] * (-542.603) (-537.354) [-537.358] (-536.441) -- 0:00:48
      579500 -- (-536.540) (-547.913) (-537.084) [-537.408] * (-536.361) (-540.350) (-538.873) [-535.307] -- 0:00:48
      580000 -- [-537.114] (-540.850) (-531.844) (-539.730) * (-535.720) (-538.693) (-544.792) [-537.967] -- 0:00:48

      Average standard deviation of split frequencies: 0.002435

      580500 -- (-539.956) [-537.929] (-542.978) (-535.837) * (-547.840) (-543.222) (-537.487) [-534.562] -- 0:00:48
      581000 -- [-538.294] (-547.234) (-537.666) (-539.542) * (-541.734) (-541.901) [-531.982] (-535.741) -- 0:00:48
      581500 -- (-546.134) (-544.354) (-540.745) [-537.575] * (-544.442) (-543.728) [-535.640] (-537.292) -- 0:00:48
      582000 -- (-537.894) (-541.164) (-534.757) [-534.184] * (-539.559) (-536.639) [-532.393] (-538.992) -- 0:00:48
      582500 -- [-531.240] (-543.304) (-538.904) (-537.909) * (-540.782) (-537.559) [-531.208] (-540.543) -- 0:00:48
      583000 -- (-536.912) [-540.665] (-545.649) (-546.679) * (-541.714) [-536.952] (-551.342) (-539.633) -- 0:00:47
      583500 -- (-533.239) (-548.245) [-536.030] (-534.999) * (-538.269) (-543.299) (-539.187) [-542.874] -- 0:00:47
      584000 -- (-536.171) [-540.219] (-534.166) (-539.680) * (-533.514) (-535.543) [-532.914] (-539.109) -- 0:00:47
      584500 -- [-531.781] (-542.023) (-539.508) (-539.160) * (-542.300) [-532.388] (-535.317) (-542.443) -- 0:00:47
      585000 -- (-536.088) [-540.673] (-539.351) (-541.877) * [-540.996] (-540.125) (-535.191) (-539.778) -- 0:00:47

      Average standard deviation of split frequencies: 0.002413

      585500 -- [-531.626] (-536.048) (-537.357) (-546.609) * (-544.299) (-543.021) [-537.463] (-552.897) -- 0:00:47
      586000 -- (-538.348) [-535.125] (-534.656) (-546.502) * (-536.974) [-536.598] (-534.405) (-548.882) -- 0:00:47
      586500 -- (-536.267) [-539.559] (-531.830) (-548.045) * (-540.359) (-537.512) [-538.583] (-536.941) -- 0:00:47
      587000 -- (-534.309) (-546.740) [-536.449] (-546.424) * (-536.531) (-537.084) (-540.989) [-541.249] -- 0:00:47
      587500 -- (-554.035) [-538.434] (-538.059) (-542.362) * (-533.299) [-537.636] (-544.085) (-542.741) -- 0:00:47
      588000 -- [-537.143] (-532.396) (-536.540) (-534.407) * [-536.918] (-547.319) (-544.707) (-537.434) -- 0:00:47
      588500 -- (-542.842) (-533.771) [-534.848] (-541.307) * (-539.070) [-540.020] (-546.778) (-541.590) -- 0:00:47
      589000 -- (-532.133) (-535.711) [-536.443] (-546.528) * (-535.000) (-537.889) (-540.482) [-540.280] -- 0:00:47
      589500 -- (-539.896) [-534.651] (-538.988) (-539.798) * [-538.676] (-538.039) (-538.207) (-539.511) -- 0:00:47
      590000 -- [-536.395] (-536.965) (-541.142) (-535.089) * (-539.915) [-536.279] (-544.625) (-544.333) -- 0:00:47

      Average standard deviation of split frequencies: 0.002394

      590500 -- [-535.826] (-531.074) (-544.786) (-538.324) * [-535.390] (-540.848) (-546.816) (-544.461) -- 0:00:47
      591000 -- (-537.684) [-534.027] (-534.373) (-533.951) * (-538.535) (-538.105) [-543.447] (-540.215) -- 0:00:47
      591500 -- (-541.101) (-537.822) (-535.221) [-542.129] * [-536.851] (-542.165) (-542.074) (-541.082) -- 0:00:46
      592000 -- (-544.227) (-537.984) (-533.397) [-536.915] * [-542.799] (-537.324) (-537.416) (-541.784) -- 0:00:46
      592500 -- (-541.705) [-537.116] (-531.133) (-541.508) * (-538.087) (-539.142) [-546.711] (-536.977) -- 0:00:46
      593000 -- (-543.551) (-533.235) (-536.583) [-536.105] * [-537.627] (-534.220) (-541.133) (-536.400) -- 0:00:46
      593500 -- (-543.125) (-534.388) (-539.633) [-534.464] * (-535.147) (-538.123) (-546.569) [-539.220] -- 0:00:46
      594000 -- (-545.111) [-536.136] (-536.197) (-538.596) * (-536.320) [-535.058] (-536.663) (-549.838) -- 0:00:46
      594500 -- (-533.819) (-533.688) (-536.100) [-537.543] * (-535.834) (-537.270) (-542.473) [-540.152] -- 0:00:46
      595000 -- (-538.109) [-538.949] (-536.266) (-538.297) * (-535.029) [-540.053] (-534.429) (-548.847) -- 0:00:46

      Average standard deviation of split frequencies: 0.001977

      595500 -- (-535.974) [-533.486] (-535.705) (-545.598) * [-536.621] (-538.768) (-533.090) (-537.442) -- 0:00:46
      596000 -- (-537.321) [-537.068] (-537.882) (-538.702) * (-539.892) [-534.025] (-539.351) (-540.923) -- 0:00:46
      596500 -- [-532.880] (-536.631) (-535.430) (-544.336) * (-542.327) (-541.138) [-536.926] (-540.426) -- 0:00:46
      597000 -- (-536.254) (-540.797) (-531.617) [-539.740] * (-536.000) (-537.032) (-535.449) [-537.099] -- 0:00:46
      597500 -- (-548.584) (-538.411) [-535.492] (-538.246) * (-539.966) [-542.967] (-536.443) (-537.684) -- 0:00:46
      598000 -- (-542.249) (-544.103) [-542.188] (-540.702) * (-538.305) (-541.733) [-536.962] (-542.378) -- 0:00:46
      598500 -- [-538.036] (-539.203) (-547.776) (-542.713) * (-543.177) [-534.571] (-534.419) (-540.599) -- 0:00:46
      599000 -- [-532.439] (-541.157) (-542.463) (-535.853) * (-539.269) (-537.533) (-537.036) [-536.800] -- 0:00:46
      599500 -- (-536.807) (-536.901) (-543.654) [-535.651] * (-535.668) (-536.677) [-535.516] (-543.042) -- 0:00:46
      600000 -- (-541.622) [-535.331] (-541.129) (-540.731) * (-536.867) (-537.647) (-532.726) [-533.652] -- 0:00:46

      Average standard deviation of split frequencies: 0.001962

      600500 -- (-531.181) [-535.613] (-538.231) (-540.245) * (-540.161) [-536.670] (-533.940) (-534.785) -- 0:00:45
      601000 -- (-537.297) (-538.665) [-540.845] (-534.147) * (-534.982) [-534.331] (-537.854) (-534.416) -- 0:00:45
      601500 -- (-532.892) (-532.027) (-540.864) [-539.308] * (-534.636) (-538.532) [-531.874] (-534.554) -- 0:00:45
      602000 -- (-536.452) [-535.398] (-535.085) (-540.959) * (-537.665) [-533.113] (-535.314) (-537.981) -- 0:00:45
      602500 -- (-538.289) [-533.974] (-539.700) (-538.624) * (-534.699) (-537.746) [-536.138] (-540.066) -- 0:00:45
      603000 -- (-535.976) [-536.967] (-534.027) (-544.743) * (-538.470) [-534.743] (-537.605) (-543.241) -- 0:00:45
      603500 -- (-537.376) (-536.092) [-535.903] (-543.328) * [-532.029] (-534.005) (-535.511) (-542.081) -- 0:00:45
      604000 -- (-540.354) [-536.811] (-540.203) (-553.520) * [-537.144] (-541.934) (-540.580) (-538.168) -- 0:00:45
      604500 -- (-535.895) [-536.688] (-536.797) (-536.826) * (-541.529) (-535.845) (-538.809) [-537.048] -- 0:00:45
      605000 -- (-537.876) (-532.661) [-540.690] (-542.154) * (-539.604) [-534.571] (-535.845) (-535.775) -- 0:00:45

      Average standard deviation of split frequencies: 0.001167

      605500 -- [-534.267] (-538.416) (-537.152) (-546.013) * (-541.715) (-541.909) (-539.356) [-537.557] -- 0:00:45
      606000 -- (-535.324) [-536.273] (-537.596) (-546.728) * (-539.560) [-538.472] (-536.024) (-541.230) -- 0:00:45
      606500 -- (-537.778) (-537.736) [-538.623] (-547.198) * (-532.541) (-538.915) (-543.137) [-540.045] -- 0:00:45
      607000 -- [-533.648] (-543.151) (-543.162) (-548.021) * (-536.271) [-544.757] (-536.953) (-541.196) -- 0:00:45
      607500 -- (-539.660) [-539.341] (-540.736) (-539.906) * (-536.581) [-532.569] (-535.301) (-536.209) -- 0:00:45
      608000 -- [-534.549] (-542.322) (-538.729) (-534.925) * [-533.711] (-535.652) (-545.145) (-538.069) -- 0:00:45
      608500 -- (-533.624) [-537.078] (-541.101) (-537.263) * (-534.404) [-537.479] (-538.054) (-534.745) -- 0:00:45
      609000 -- [-536.311] (-536.767) (-542.078) (-534.948) * (-539.622) (-541.263) (-537.514) [-535.249] -- 0:00:44
      609500 -- (-535.073) (-535.124) [-532.528] (-546.323) * [-541.304] (-539.658) (-538.256) (-539.512) -- 0:00:44
      610000 -- (-540.352) [-537.653] (-544.553) (-537.265) * (-539.228) (-532.392) (-544.300) [-536.278] -- 0:00:44

      Average standard deviation of split frequencies: 0.001158

      610500 -- (-536.851) (-536.020) [-535.272] (-535.232) * [-535.849] (-533.588) (-535.398) (-542.674) -- 0:00:44
      611000 -- (-541.827) (-532.630) (-534.488) [-532.969] * [-536.496] (-537.429) (-539.926) (-533.750) -- 0:00:44
      611500 -- (-544.054) (-538.978) [-532.014] (-534.423) * (-545.195) (-532.596) [-535.851] (-532.437) -- 0:00:44
      612000 -- (-547.192) [-540.703] (-535.994) (-536.290) * (-548.146) (-536.971) (-541.927) [-531.710] -- 0:00:44
      612500 -- [-540.055] (-537.332) (-535.396) (-533.691) * (-536.689) (-540.204) (-534.775) [-535.951] -- 0:00:44
      613000 -- (-536.039) [-538.796] (-535.622) (-531.881) * (-539.871) (-540.401) (-538.895) [-536.566] -- 0:00:44
      613500 -- (-541.039) (-539.179) (-536.689) [-534.898] * (-535.941) (-538.714) (-537.921) [-539.249] -- 0:00:44
      614000 -- (-544.382) (-539.935) (-538.281) [-534.398] * [-536.710] (-535.714) (-549.654) (-538.935) -- 0:00:44
      614500 -- (-547.593) [-535.531] (-542.049) (-533.686) * [-538.295] (-534.421) (-541.486) (-539.582) -- 0:00:44
      615000 -- (-537.112) (-540.204) [-540.219] (-547.137) * (-539.867) (-541.675) [-540.494] (-534.735) -- 0:00:44

      Average standard deviation of split frequencies: 0.002296

      615500 -- (-534.769) (-536.388) (-541.198) [-535.530] * (-535.210) [-540.815] (-534.526) (-534.864) -- 0:00:44
      616000 -- [-533.142] (-538.560) (-538.207) (-539.219) * (-533.019) [-539.204] (-540.845) (-535.852) -- 0:00:44
      616500 -- (-535.141) (-539.913) [-535.572] (-539.702) * (-538.009) (-538.899) (-538.400) [-537.829] -- 0:00:44
      617000 -- [-536.698] (-534.532) (-539.388) (-537.273) * (-547.698) (-539.966) [-534.234] (-535.961) -- 0:00:44
      617500 -- (-539.987) (-533.152) [-534.180] (-542.998) * (-538.801) (-537.753) [-542.047] (-540.929) -- 0:00:43
      618000 -- (-533.984) (-538.827) [-535.629] (-536.511) * [-535.771] (-532.652) (-550.310) (-538.072) -- 0:00:43
      618500 -- (-541.415) (-539.120) [-538.058] (-539.939) * (-537.359) (-535.485) [-543.738] (-538.637) -- 0:00:43
      619000 -- [-535.078] (-540.384) (-537.523) (-535.330) * (-540.627) [-540.341] (-542.679) (-536.914) -- 0:00:43
      619500 -- (-539.720) (-540.311) [-532.098] (-534.882) * (-542.287) [-531.880] (-543.984) (-537.997) -- 0:00:43
      620000 -- (-545.242) (-540.053) (-534.621) [-533.741] * (-541.661) [-537.585] (-543.997) (-542.765) -- 0:00:43

      Average standard deviation of split frequencies: 0.001899

      620500 -- (-542.068) [-532.577] (-534.093) (-535.405) * (-545.293) [-533.291] (-544.034) (-539.075) -- 0:00:43
      621000 -- [-537.210] (-543.139) (-540.134) (-535.406) * (-544.557) [-530.614] (-543.877) (-538.593) -- 0:00:43
      621500 -- (-542.639) (-538.080) [-537.991] (-534.363) * (-546.874) (-532.392) (-545.166) [-536.285] -- 0:00:43
      622000 -- (-537.385) [-536.096] (-546.537) (-536.575) * (-546.322) [-537.510] (-545.581) (-538.158) -- 0:00:43
      622500 -- (-541.919) (-536.147) (-537.757) [-538.599] * (-539.041) [-533.927] (-541.709) (-540.620) -- 0:00:43
      623000 -- [-536.305] (-536.306) (-539.779) (-540.293) * [-534.807] (-532.244) (-545.460) (-538.099) -- 0:00:43
      623500 -- [-539.909] (-539.561) (-538.232) (-549.047) * (-540.443) [-540.261] (-544.518) (-547.402) -- 0:00:43
      624000 -- (-539.928) [-536.707] (-537.784) (-535.797) * (-539.065) [-541.159] (-544.262) (-543.303) -- 0:00:43
      624500 -- (-535.255) [-537.783] (-543.794) (-540.997) * (-539.361) (-535.118) (-543.992) [-535.807] -- 0:00:43
      625000 -- (-533.133) (-537.360) [-539.960] (-537.846) * (-538.258) [-531.347] (-539.767) (-537.867) -- 0:00:43

      Average standard deviation of split frequencies: 0.002259

      625500 -- (-535.979) [-538.509] (-537.591) (-537.313) * (-534.248) (-539.589) (-546.411) [-536.640] -- 0:00:43
      626000 -- (-538.831) (-538.242) (-546.548) [-536.923] * [-531.578] (-540.140) (-540.174) (-531.822) -- 0:00:43
      626500 -- (-538.617) (-538.509) (-537.094) [-535.914] * (-535.366) [-540.005] (-536.953) (-531.414) -- 0:00:42
      627000 -- [-541.739] (-542.284) (-538.062) (-539.568) * (-534.076) (-537.855) (-538.118) [-538.122] -- 0:00:42
      627500 -- [-540.105] (-541.076) (-543.560) (-533.409) * (-548.664) (-540.020) (-540.180) [-537.086] -- 0:00:42
      628000 -- (-542.115) [-542.923] (-539.706) (-533.090) * (-537.108) (-542.070) (-537.707) [-535.881] -- 0:00:42
      628500 -- (-533.034) (-540.936) [-539.780] (-534.340) * (-534.730) [-536.835] (-536.608) (-534.497) -- 0:00:42
      629000 -- (-533.904) (-542.453) (-541.910) [-534.812] * (-540.108) (-534.935) (-546.327) [-541.422] -- 0:00:42
      629500 -- [-535.801] (-542.236) (-538.957) (-536.893) * [-537.444] (-544.371) (-537.336) (-544.269) -- 0:00:42
      630000 -- (-539.145) (-534.209) [-539.694] (-536.531) * (-536.715) [-534.561] (-534.877) (-544.181) -- 0:00:42

      Average standard deviation of split frequencies: 0.002990

      630500 -- (-537.479) [-531.248] (-543.193) (-548.291) * (-534.938) (-536.330) (-536.279) [-540.774] -- 0:00:42
      631000 -- [-538.558] (-537.670) (-539.004) (-540.222) * (-538.664) (-537.659) (-537.951) [-536.664] -- 0:00:42
      631500 -- (-535.123) (-532.012) [-539.035] (-538.054) * (-538.783) (-538.939) (-533.381) [-534.640] -- 0:00:42
      632000 -- (-537.298) (-537.203) (-536.956) [-537.529] * (-535.475) [-531.894] (-540.886) (-538.785) -- 0:00:42
      632500 -- (-533.155) [-532.681] (-541.083) (-538.456) * (-535.409) (-537.716) [-540.781] (-536.321) -- 0:00:42
      633000 -- [-538.131] (-537.975) (-538.037) (-537.273) * (-542.141) (-535.967) (-539.811) [-536.749] -- 0:00:42
      633500 -- (-538.047) [-532.022] (-540.881) (-536.210) * [-533.927] (-540.076) (-534.452) (-535.495) -- 0:00:42
      634000 -- [-537.458] (-539.018) (-537.750) (-547.668) * [-541.661] (-539.792) (-537.284) (-538.314) -- 0:00:42
      634500 -- [-536.378] (-533.446) (-535.307) (-538.700) * (-543.483) (-544.917) (-540.576) [-534.911] -- 0:00:42
      635000 -- (-539.286) [-532.739] (-540.953) (-540.639) * [-537.534] (-537.052) (-538.896) (-534.610) -- 0:00:41

      Average standard deviation of split frequencies: 0.002965

      635500 -- (-538.459) [-538.845] (-540.655) (-539.624) * (-536.371) (-535.745) (-536.259) [-533.935] -- 0:00:41
      636000 -- [-533.797] (-535.458) (-538.231) (-545.631) * (-533.988) (-534.179) [-534.117] (-537.246) -- 0:00:41
      636500 -- (-534.483) (-537.459) [-535.021] (-544.020) * [-540.398] (-538.383) (-536.948) (-541.953) -- 0:00:41
      637000 -- (-545.124) [-540.442] (-536.893) (-547.694) * [-534.697] (-539.216) (-536.667) (-534.431) -- 0:00:41
      637500 -- [-536.856] (-541.665) (-545.361) (-545.511) * (-538.580) (-532.913) (-536.196) [-532.606] -- 0:00:41
      638000 -- (-538.486) (-548.974) (-537.945) [-538.345] * [-534.676] (-534.697) (-536.392) (-539.600) -- 0:00:41
      638500 -- (-538.380) (-536.809) (-540.674) [-543.361] * (-533.786) [-535.839] (-539.214) (-538.476) -- 0:00:41
      639000 -- (-540.709) (-546.813) [-537.697] (-543.631) * (-533.470) [-535.854] (-533.940) (-538.732) -- 0:00:41
      639500 -- (-537.790) [-539.288] (-531.220) (-541.891) * [-537.207] (-536.455) (-535.137) (-534.608) -- 0:00:41
      640000 -- (-535.904) (-539.231) [-535.041] (-542.574) * (-532.050) (-536.075) (-534.744) [-533.331] -- 0:00:41

      Average standard deviation of split frequencies: 0.003311

      640500 -- (-538.132) (-538.682) (-535.321) [-548.157] * (-537.889) (-533.425) [-532.645] (-539.469) -- 0:00:41
      641000 -- (-536.752) [-538.304] (-539.795) (-542.000) * (-540.741) [-537.506] (-537.721) (-535.378) -- 0:00:41
      641500 -- (-535.008) [-540.423] (-534.617) (-547.497) * [-533.798] (-538.000) (-535.721) (-543.100) -- 0:00:41
      642000 -- (-535.843) (-543.787) (-538.879) [-540.832] * (-538.579) (-540.394) [-535.521] (-537.731) -- 0:00:41
      642500 -- (-540.997) [-545.534] (-538.870) (-541.507) * (-539.014) (-541.045) (-540.653) [-536.293] -- 0:00:41
      643000 -- (-541.207) [-539.241] (-531.206) (-545.797) * (-532.668) (-539.885) (-537.863) [-539.490] -- 0:00:41
      643500 -- [-543.631] (-534.428) (-537.592) (-550.082) * [-534.631] (-536.624) (-534.867) (-544.277) -- 0:00:40
      644000 -- (-541.196) [-538.512] (-540.666) (-540.005) * (-542.398) (-540.349) [-535.927] (-538.181) -- 0:00:40
      644500 -- [-535.508] (-537.303) (-536.469) (-553.037) * (-531.568) (-541.628) (-535.298) [-538.313] -- 0:00:40
      645000 -- [-537.662] (-538.208) (-539.293) (-543.023) * (-535.994) (-549.606) [-534.410] (-542.045) -- 0:00:40

      Average standard deviation of split frequencies: 0.003284

      645500 -- (-531.674) (-544.663) [-538.809] (-541.572) * [-537.979] (-546.622) (-532.318) (-549.143) -- 0:00:40
      646000 -- (-539.290) [-537.416] (-532.322) (-536.864) * (-536.899) [-538.292] (-537.983) (-536.790) -- 0:00:40
      646500 -- (-536.202) (-536.520) [-536.360] (-541.021) * (-539.604) (-541.874) (-534.145) [-539.186] -- 0:00:40
      647000 -- (-539.756) [-538.585] (-543.512) (-542.901) * (-532.290) (-543.037) [-536.754] (-548.897) -- 0:00:40
      647500 -- (-531.293) [-538.640] (-540.144) (-542.328) * (-537.279) (-541.605) (-537.449) [-535.218] -- 0:00:40
      648000 -- (-535.788) [-539.621] (-542.133) (-544.155) * (-534.986) (-541.224) (-534.865) [-538.629] -- 0:00:40
      648500 -- (-537.561) [-536.470] (-534.806) (-545.282) * (-537.009) (-540.781) [-532.322] (-538.773) -- 0:00:40
      649000 -- [-538.595] (-537.892) (-545.036) (-542.033) * (-543.956) (-542.050) [-539.019] (-538.483) -- 0:00:40
      649500 -- [-540.231] (-541.420) (-540.156) (-543.127) * (-532.991) (-544.302) [-542.873] (-536.817) -- 0:00:40
      650000 -- (-543.720) [-539.117] (-535.681) (-543.161) * (-539.272) (-539.005) (-539.792) [-541.245] -- 0:00:40

      Average standard deviation of split frequencies: 0.003622

      650500 -- (-535.350) (-544.633) [-535.628] (-546.083) * (-537.791) [-545.291] (-542.515) (-539.083) -- 0:00:40
      651000 -- [-538.010] (-537.562) (-539.429) (-544.639) * [-530.999] (-536.998) (-549.474) (-537.424) -- 0:00:40
      651500 -- (-536.028) (-533.511) (-541.156) [-540.477] * (-537.485) [-540.562] (-538.130) (-539.100) -- 0:00:40
      652000 -- (-540.368) (-538.005) (-531.024) [-538.630] * (-540.858) (-535.270) (-537.579) [-538.462] -- 0:00:40
      652500 -- (-540.135) (-539.004) (-536.566) [-534.329] * (-534.321) (-542.452) [-534.194] (-545.102) -- 0:00:39
      653000 -- (-539.779) (-539.789) (-537.137) [-532.841] * [-539.551] (-538.627) (-538.043) (-537.369) -- 0:00:39
      653500 -- (-536.895) (-536.373) (-543.394) [-534.402] * (-537.813) (-547.085) [-536.128] (-535.075) -- 0:00:39
      654000 -- (-539.141) [-536.074] (-544.118) (-534.115) * (-543.319) (-536.101) [-532.914] (-532.421) -- 0:00:39
      654500 -- (-539.684) [-541.728] (-533.644) (-535.731) * (-537.112) (-539.418) [-531.519] (-532.099) -- 0:00:39
      655000 -- (-543.571) [-537.864] (-542.943) (-532.520) * (-536.483) [-539.762] (-536.420) (-542.668) -- 0:00:39

      Average standard deviation of split frequencies: 0.003952

      655500 -- (-537.499) (-542.157) [-536.929] (-549.117) * (-539.164) [-538.585] (-537.957) (-539.433) -- 0:00:39
      656000 -- (-539.951) (-538.000) (-536.400) [-538.879] * (-535.624) (-540.115) (-535.009) [-536.801] -- 0:00:39
      656500 -- (-533.548) (-532.996) (-537.327) [-535.330] * (-537.602) (-541.484) [-537.625] (-538.352) -- 0:00:39
      657000 -- (-539.506) (-533.734) [-539.704] (-537.097) * (-537.762) (-542.271) [-534.030] (-538.438) -- 0:00:39
      657500 -- (-540.218) (-533.483) [-538.078] (-537.476) * (-539.172) [-544.242] (-533.997) (-543.456) -- 0:00:39
      658000 -- (-543.469) (-541.630) (-543.692) [-536.971] * [-534.238] (-534.557) (-533.302) (-534.978) -- 0:00:39
      658500 -- (-540.444) (-536.090) (-548.057) [-537.871] * (-533.477) (-541.447) [-532.746] (-537.901) -- 0:00:39
      659000 -- (-539.990) [-538.643] (-542.339) (-537.501) * (-533.181) [-539.381] (-535.447) (-539.451) -- 0:00:39
      659500 -- (-543.833) (-531.724) (-541.232) [-537.552] * (-539.957) (-543.619) [-530.713] (-537.807) -- 0:00:39
      660000 -- [-540.150] (-543.968) (-536.965) (-549.901) * (-539.699) (-545.835) (-538.329) [-538.678] -- 0:00:39

      Average standard deviation of split frequencies: 0.003924

      660500 -- (-536.077) [-532.559] (-537.935) (-538.358) * (-540.814) (-539.405) (-532.975) [-535.049] -- 0:00:39
      661000 -- [-537.394] (-534.711) (-540.191) (-540.429) * (-544.162) (-542.067) [-535.333] (-542.320) -- 0:00:38
      661500 -- [-533.153] (-532.572) (-539.557) (-540.030) * (-544.284) [-539.198] (-543.602) (-553.997) -- 0:00:38
      662000 -- [-533.871] (-539.701) (-540.224) (-542.180) * [-535.773] (-540.927) (-533.926) (-547.007) -- 0:00:38
      662500 -- (-535.963) (-540.536) (-537.065) [-534.391] * (-536.572) (-546.739) [-535.349] (-537.654) -- 0:00:38
      663000 -- (-534.549) (-537.108) [-535.325] (-540.170) * (-544.106) (-535.371) [-532.852] (-538.531) -- 0:00:38
      663500 -- (-538.720) (-543.042) (-543.214) [-537.501] * (-536.964) [-543.905] (-538.297) (-544.001) -- 0:00:38
      664000 -- (-539.506) (-534.576) (-541.051) [-538.484] * (-548.957) (-538.824) (-543.583) [-538.088] -- 0:00:38
      664500 -- (-545.417) [-537.891] (-545.487) (-539.895) * (-544.960) (-542.459) (-537.315) [-534.216] -- 0:00:38
      665000 -- (-542.193) [-533.551] (-542.990) (-535.237) * (-545.014) (-540.450) [-540.263] (-541.938) -- 0:00:38

      Average standard deviation of split frequencies: 0.003893

      665500 -- (-543.452) (-536.388) [-539.686] (-533.536) * (-541.349) (-541.220) (-534.403) [-540.925] -- 0:00:38
      666000 -- (-536.914) [-535.511] (-534.822) (-549.166) * (-538.479) (-537.578) (-532.891) [-538.443] -- 0:00:38
      666500 -- (-538.864) (-539.514) (-544.353) [-533.123] * (-535.290) (-534.001) (-536.838) [-534.610] -- 0:00:38
      667000 -- (-538.279) [-534.960] (-545.379) (-539.639) * (-538.910) (-533.903) [-536.432] (-537.401) -- 0:00:38
      667500 -- (-537.430) [-531.788] (-544.626) (-548.031) * (-535.756) (-538.765) (-540.497) [-535.002] -- 0:00:38
      668000 -- (-539.360) (-536.443) [-540.147] (-535.088) * (-545.594) (-545.012) (-538.345) [-534.292] -- 0:00:38
      668500 -- [-532.691] (-530.779) (-538.358) (-540.330) * (-538.709) [-542.105] (-542.573) (-534.772) -- 0:00:38
      669000 -- (-539.494) [-535.573] (-536.325) (-545.004) * (-538.778) [-538.720] (-538.801) (-537.192) -- 0:00:38
      669500 -- (-535.602) (-540.471) (-536.792) [-541.810] * (-539.753) (-540.012) [-542.510] (-537.493) -- 0:00:38
      670000 -- [-535.319] (-539.013) (-542.983) (-547.489) * (-537.431) (-543.465) [-541.110] (-538.771) -- 0:00:37

      Average standard deviation of split frequencies: 0.003866

      670500 -- [-535.467] (-532.612) (-538.657) (-540.493) * (-544.111) [-533.649] (-546.428) (-539.276) -- 0:00:37
      671000 -- [-531.029] (-533.841) (-541.039) (-537.875) * (-541.691) [-535.482] (-540.514) (-540.572) -- 0:00:37
      671500 -- (-536.678) [-536.643] (-540.516) (-537.490) * (-541.244) [-538.458] (-540.466) (-535.101) -- 0:00:37
      672000 -- (-540.760) (-537.593) [-538.408] (-541.878) * [-536.473] (-540.696) (-540.182) (-535.223) -- 0:00:37
      672500 -- [-537.597] (-534.133) (-542.031) (-540.114) * (-536.234) (-537.644) (-544.115) [-536.707] -- 0:00:37
      673000 -- (-541.671) [-535.145] (-543.285) (-540.369) * (-544.149) (-534.103) [-541.969] (-541.548) -- 0:00:37
      673500 -- (-533.971) [-544.465] (-542.285) (-541.535) * (-543.349) [-535.281] (-537.564) (-540.106) -- 0:00:37
      674000 -- (-541.162) (-538.168) [-540.322] (-542.105) * [-541.652] (-538.808) (-541.777) (-537.064) -- 0:00:37
      674500 -- (-540.484) [-535.894] (-541.340) (-537.697) * (-552.319) [-537.366] (-546.080) (-537.301) -- 0:00:37
      675000 -- [-545.496] (-534.084) (-546.646) (-541.179) * (-533.327) [-532.943] (-547.457) (-536.757) -- 0:00:37

      Average standard deviation of split frequencies: 0.004184

      675500 -- (-545.432) [-538.498] (-539.818) (-549.566) * (-533.739) (-535.884) [-541.814] (-538.625) -- 0:00:37
      676000 -- (-535.403) [-534.137] (-539.995) (-538.846) * (-536.601) [-537.722] (-535.865) (-542.723) -- 0:00:37
      676500 -- (-537.223) (-535.072) (-537.698) [-535.478] * (-535.273) (-533.140) [-538.656] (-539.827) -- 0:00:37
      677000 -- [-536.367] (-536.849) (-542.458) (-536.183) * (-538.188) [-531.183] (-533.385) (-545.770) -- 0:00:37
      677500 -- (-537.834) (-541.932) [-538.262] (-543.913) * [-532.721] (-531.116) (-536.221) (-541.771) -- 0:00:37
      678000 -- [-534.232] (-538.487) (-542.648) (-549.891) * (-539.089) (-535.987) (-537.087) [-544.779] -- 0:00:37
      678500 -- (-539.539) [-534.412] (-541.105) (-535.868) * (-539.245) [-533.265] (-541.677) (-549.011) -- 0:00:36
      679000 -- (-539.908) (-535.232) (-543.905) [-537.594] * (-532.712) (-537.044) [-533.232] (-544.203) -- 0:00:36
      679500 -- (-534.481) [-539.477] (-540.949) (-546.092) * [-535.736] (-533.823) (-533.314) (-542.926) -- 0:00:36
      680000 -- (-542.077) (-536.526) (-537.922) [-536.025] * (-540.492) (-536.783) (-539.941) [-538.861] -- 0:00:36

      Average standard deviation of split frequencies: 0.005887

      680500 -- [-533.074] (-541.483) (-540.136) (-536.657) * (-539.825) (-534.898) [-539.159] (-538.096) -- 0:00:36
      681000 -- (-538.040) (-538.872) [-538.201] (-541.437) * [-536.791] (-537.297) (-544.139) (-535.205) -- 0:00:36
      681500 -- (-534.208) (-532.550) [-535.121] (-535.407) * (-537.756) (-537.133) [-536.917] (-531.520) -- 0:00:36
      682000 -- (-534.557) (-533.234) [-534.828] (-531.489) * [-531.374] (-531.400) (-543.811) (-531.010) -- 0:00:36
      682500 -- (-544.203) (-539.070) (-537.403) [-534.285] * (-539.141) [-536.773] (-537.311) (-536.074) -- 0:00:36
      683000 -- (-535.460) (-535.109) [-539.954] (-532.348) * [-535.342] (-536.835) (-541.633) (-540.001) -- 0:00:36
      683500 -- (-539.306) (-535.749) [-539.109] (-536.213) * [-536.888] (-541.083) (-542.530) (-535.109) -- 0:00:36
      684000 -- (-535.724) [-537.480] (-542.909) (-543.922) * (-533.978) (-539.332) (-547.178) [-538.779] -- 0:00:36
      684500 -- (-533.999) [-535.922] (-547.195) (-536.527) * (-532.758) (-532.120) [-538.678] (-538.149) -- 0:00:36
      685000 -- (-541.086) (-539.566) [-541.486] (-542.459) * [-532.662] (-541.976) (-544.104) (-535.793) -- 0:00:36

      Average standard deviation of split frequencies: 0.006528

      685500 -- (-536.491) (-539.482) [-541.656] (-542.919) * [-535.812] (-540.264) (-540.280) (-531.627) -- 0:00:36
      686000 -- (-536.287) (-538.855) (-538.795) [-536.067] * (-539.177) (-542.087) (-539.755) [-535.214] -- 0:00:36
      686500 -- (-537.716) (-537.891) [-539.754] (-539.917) * (-537.225) (-538.362) [-540.322] (-544.823) -- 0:00:36
      687000 -- (-538.066) (-540.356) [-542.116] (-539.177) * (-536.616) (-538.154) (-544.376) [-540.758] -- 0:00:35
      687500 -- (-539.862) (-544.965) (-535.668) [-539.249] * (-546.889) (-533.257) (-545.125) [-535.925] -- 0:00:35
      688000 -- [-544.742] (-539.372) (-535.400) (-542.679) * (-534.136) (-533.941) (-544.330) [-537.741] -- 0:00:35
      688500 -- (-536.139) (-544.217) [-538.959] (-542.057) * (-540.191) [-538.597] (-546.816) (-540.204) -- 0:00:35
      689000 -- (-538.468) [-535.223] (-534.775) (-543.322) * (-536.547) [-538.371] (-546.859) (-534.997) -- 0:00:35
      689500 -- [-535.926] (-537.251) (-536.164) (-537.812) * [-537.747] (-541.656) (-543.721) (-539.257) -- 0:00:35
      690000 -- (-543.378) [-539.868] (-543.549) (-543.093) * (-541.493) (-543.621) [-536.531] (-532.963) -- 0:00:35

      Average standard deviation of split frequencies: 0.006143

      690500 -- (-549.028) [-535.814] (-536.981) (-546.345) * (-540.317) (-536.657) [-540.742] (-537.964) -- 0:00:35
      691000 -- (-544.624) [-533.798] (-539.111) (-539.269) * (-537.893) (-540.580) (-542.489) [-536.861] -- 0:00:35
      691500 -- (-540.640) [-543.273] (-533.246) (-536.436) * (-547.872) (-542.571) (-541.292) [-539.180] -- 0:00:35
      692000 -- (-549.991) (-536.051) [-536.581] (-538.656) * [-545.499] (-542.182) (-535.291) (-533.741) -- 0:00:35
      692500 -- (-538.296) (-540.485) (-536.051) [-539.996] * [-534.763] (-538.899) (-543.383) (-536.096) -- 0:00:35
      693000 -- (-536.919) (-542.804) [-539.737] (-532.274) * (-536.831) (-535.347) (-539.347) [-533.966] -- 0:00:35
      693500 -- (-537.878) [-538.075] (-538.344) (-540.207) * (-538.006) [-534.742] (-544.094) (-540.503) -- 0:00:35
      694000 -- (-536.081) [-540.122] (-535.383) (-531.536) * (-532.770) (-535.464) [-542.190] (-538.340) -- 0:00:35
      694500 -- (-531.129) [-535.626] (-533.427) (-542.782) * [-543.714] (-537.888) (-542.075) (-536.004) -- 0:00:35
      695000 -- (-539.482) [-538.165] (-543.882) (-535.161) * (-543.548) (-531.321) (-546.993) [-535.261] -- 0:00:35

      Average standard deviation of split frequencies: 0.006096

      695500 -- (-542.404) [-541.004] (-539.959) (-541.137) * [-536.248] (-532.930) (-533.932) (-540.170) -- 0:00:35
      696000 -- [-537.287] (-541.373) (-540.601) (-541.805) * (-539.357) [-540.454] (-540.721) (-534.999) -- 0:00:34
      696500 -- (-533.464) [-539.240] (-534.226) (-543.544) * [-534.169] (-533.401) (-543.603) (-537.373) -- 0:00:34
      697000 -- (-537.951) (-535.416) (-538.895) [-537.954] * (-534.803) (-538.421) (-535.425) [-531.534] -- 0:00:34
      697500 -- (-543.910) [-540.774] (-538.799) (-545.945) * (-536.987) (-534.960) (-532.036) [-540.192] -- 0:00:34
      698000 -- [-539.314] (-535.626) (-536.993) (-544.660) * (-542.501) (-535.106) [-539.193] (-534.242) -- 0:00:34
      698500 -- (-539.790) (-539.277) (-536.177) [-538.714] * (-534.977) (-538.532) [-538.870] (-539.863) -- 0:00:34
      699000 -- (-539.706) (-540.127) (-535.295) [-539.313] * [-534.669] (-538.009) (-545.706) (-541.370) -- 0:00:34
      699500 -- (-537.449) [-533.086] (-538.382) (-537.807) * (-537.754) (-542.886) [-534.727] (-538.334) -- 0:00:34
      700000 -- [-534.594] (-538.646) (-535.242) (-537.907) * [-536.694] (-542.057) (-539.190) (-537.776) -- 0:00:34

      Average standard deviation of split frequencies: 0.006055

      700500 -- [-534.075] (-539.318) (-534.768) (-540.792) * (-546.625) [-534.192] (-535.921) (-538.364) -- 0:00:34
      701000 -- [-534.095] (-535.204) (-541.101) (-542.575) * (-537.916) [-533.961] (-541.914) (-538.436) -- 0:00:34
      701500 -- (-535.229) (-532.144) [-537.545] (-534.560) * (-535.832) (-534.307) (-532.834) [-535.719] -- 0:00:34
      702000 -- (-544.970) [-534.155] (-543.790) (-533.576) * (-541.398) [-533.147] (-533.891) (-540.178) -- 0:00:34
      702500 -- (-543.337) (-532.698) (-545.965) [-537.960] * (-541.006) (-536.567) (-536.083) [-536.976] -- 0:00:34
      703000 -- (-540.055) (-537.013) [-541.623] (-540.803) * (-539.642) (-539.838) (-533.592) [-538.146] -- 0:00:34
      703500 -- (-534.600) [-536.019] (-549.602) (-537.826) * [-534.770] (-537.400) (-535.142) (-539.970) -- 0:00:34
      704000 -- (-533.899) (-536.088) (-541.048) [-546.948] * [-536.598] (-541.557) (-538.514) (-535.970) -- 0:00:34
      704500 -- (-532.764) (-539.425) (-540.753) [-545.834] * (-543.763) (-536.624) (-531.738) [-539.205] -- 0:00:33
      705000 -- (-541.339) [-537.378] (-535.507) (-535.297) * [-535.076] (-540.112) (-541.781) (-543.293) -- 0:00:33

      Average standard deviation of split frequencies: 0.006343

      705500 -- (-538.745) [-538.088] (-530.040) (-546.386) * (-536.655) (-542.005) (-536.180) [-536.379] -- 0:00:33
      706000 -- [-534.102] (-539.040) (-534.669) (-545.225) * (-537.194) (-541.331) [-533.265] (-538.494) -- 0:00:33
      706500 -- (-533.295) (-541.348) (-536.652) [-543.227] * (-540.711) (-540.080) [-539.777] (-541.274) -- 0:00:33
      707000 -- (-538.788) [-532.344] (-546.166) (-544.029) * [-534.253] (-540.322) (-540.724) (-537.407) -- 0:00:33
      707500 -- (-540.100) [-538.408] (-535.556) (-534.737) * (-539.022) (-536.915) [-540.370] (-540.146) -- 0:00:33
      708000 -- (-539.549) (-544.242) (-537.105) [-539.043] * (-535.824) (-548.544) [-534.607] (-543.466) -- 0:00:33
      708500 -- (-532.124) [-539.151] (-536.738) (-536.981) * (-537.542) (-536.202) [-540.440] (-534.679) -- 0:00:33
      709000 -- (-548.983) [-533.900] (-535.352) (-540.629) * (-538.415) (-542.684) [-536.345] (-534.929) -- 0:00:33
      709500 -- [-537.362] (-530.792) (-535.121) (-534.764) * [-534.018] (-541.579) (-538.829) (-540.524) -- 0:00:33
      710000 -- (-535.733) (-534.832) [-538.502] (-536.741) * (-533.576) [-538.633] (-546.159) (-537.406) -- 0:00:33

      Average standard deviation of split frequencies: 0.006302

      710500 -- (-536.524) (-536.041) (-539.629) [-539.089] * (-537.024) (-536.363) [-539.129] (-534.105) -- 0:00:33
      711000 -- (-538.298) (-544.874) (-531.608) [-534.962] * (-538.586) (-533.254) [-537.524] (-548.332) -- 0:00:33
      711500 -- (-538.871) [-530.875] (-542.720) (-544.555) * (-537.122) (-537.350) [-542.471] (-541.873) -- 0:00:33
      712000 -- [-533.720] (-535.601) (-538.601) (-544.135) * [-538.517] (-534.619) (-547.799) (-536.212) -- 0:00:33
      712500 -- [-539.153] (-538.931) (-538.196) (-540.280) * (-534.315) [-537.575] (-542.899) (-536.099) -- 0:00:33
      713000 -- [-542.616] (-538.004) (-539.261) (-540.688) * (-544.602) (-534.483) [-541.819] (-536.345) -- 0:00:33
      713500 -- [-541.616] (-541.927) (-539.998) (-538.344) * [-533.677] (-532.287) (-538.020) (-532.858) -- 0:00:32
      714000 -- (-538.063) (-540.220) [-535.151] (-546.347) * [-536.969] (-535.010) (-539.798) (-532.260) -- 0:00:32
      714500 -- [-537.650] (-537.250) (-537.650) (-537.422) * (-540.984) (-540.724) (-544.217) [-535.608] -- 0:00:32
      715000 -- (-536.415) (-542.408) (-536.082) [-542.253] * (-535.890) (-540.541) [-541.963] (-534.988) -- 0:00:32

      Average standard deviation of split frequencies: 0.006255

      715500 -- (-544.109) (-536.681) [-540.722] (-538.107) * (-537.131) (-532.198) [-537.244] (-539.180) -- 0:00:32
      716000 -- (-546.156) (-534.119) [-535.086] (-543.145) * (-542.665) (-532.694) [-542.378] (-536.780) -- 0:00:32
      716500 -- (-539.393) [-534.144] (-537.084) (-536.628) * [-537.221] (-533.522) (-546.686) (-544.675) -- 0:00:32
      717000 -- (-532.810) (-541.275) [-535.484] (-536.074) * (-542.812) (-534.610) [-540.307] (-538.909) -- 0:00:32
      717500 -- (-537.673) (-537.653) [-534.938] (-538.274) * (-535.448) [-541.887] (-534.391) (-536.379) -- 0:00:32
      718000 -- (-542.102) (-541.809) [-536.017] (-541.984) * [-530.967] (-532.701) (-536.469) (-538.711) -- 0:00:32
      718500 -- (-538.776) (-538.805) [-541.205] (-535.491) * (-539.610) (-537.102) [-536.985] (-537.359) -- 0:00:32
      719000 -- (-540.457) [-541.920] (-536.142) (-540.214) * [-532.827] (-534.344) (-536.833) (-540.740) -- 0:00:32
      719500 -- (-537.376) [-540.982] (-533.424) (-539.408) * (-535.639) [-533.862] (-534.421) (-540.716) -- 0:00:32
      720000 -- (-538.655) (-540.979) [-534.445] (-539.156) * (-540.022) (-538.204) [-535.265] (-536.296) -- 0:00:32

      Average standard deviation of split frequencies: 0.005887

      720500 -- (-539.349) (-534.913) (-543.025) [-536.015] * (-537.272) (-535.042) [-535.537] (-535.546) -- 0:00:32
      721000 -- (-534.913) (-539.424) [-536.649] (-546.814) * (-537.645) (-544.029) [-530.926] (-534.115) -- 0:00:32
      721500 -- (-535.530) (-539.480) [-537.073] (-539.237) * (-531.525) (-541.921) [-534.149] (-536.462) -- 0:00:32
      722000 -- [-532.984] (-544.954) (-549.651) (-538.114) * (-538.604) (-534.491) (-534.629) [-538.335] -- 0:00:31
      722500 -- (-539.439) (-545.423) (-539.198) [-532.311] * [-540.802] (-540.196) (-538.433) (-533.207) -- 0:00:31
      723000 -- [-536.419] (-543.564) (-539.735) (-536.124) * (-540.060) [-542.963] (-542.493) (-535.339) -- 0:00:31
      723500 -- (-537.396) [-540.800] (-535.088) (-535.127) * (-536.909) (-546.288) (-538.502) [-542.959] -- 0:00:31
      724000 -- (-542.607) (-544.429) (-536.165) [-531.655] * (-538.827) (-538.349) [-534.259] (-539.286) -- 0:00:31
      724500 -- [-549.147] (-544.797) (-531.635) (-534.406) * (-541.675) [-536.556] (-541.886) (-533.762) -- 0:00:31
      725000 -- (-537.480) (-548.183) [-538.954] (-534.655) * (-539.984) [-537.720] (-537.164) (-536.843) -- 0:00:31

      Average standard deviation of split frequencies: 0.005844

      725500 -- (-549.756) (-541.731) [-534.488] (-535.983) * (-532.872) (-538.047) [-535.373] (-539.691) -- 0:00:31
      726000 -- [-534.161] (-540.725) (-540.220) (-538.446) * [-532.284] (-546.986) (-536.140) (-540.702) -- 0:00:31
      726500 -- [-537.999] (-536.444) (-540.164) (-545.133) * (-534.949) (-542.607) [-539.679] (-544.964) -- 0:00:31
      727000 -- (-538.678) (-539.793) [-533.820] (-543.289) * (-534.529) [-539.096] (-543.649) (-539.496) -- 0:00:31
      727500 -- (-540.602) [-538.560] (-535.500) (-535.599) * [-535.972] (-536.742) (-543.919) (-540.026) -- 0:00:31
      728000 -- (-540.466) [-537.991] (-541.044) (-543.274) * [-538.568] (-537.195) (-537.552) (-539.594) -- 0:00:31
      728500 -- (-546.561) (-540.312) (-541.029) [-539.948] * [-532.217] (-535.747) (-540.755) (-539.455) -- 0:00:31
      729000 -- (-534.824) (-539.192) (-533.385) [-535.460] * [-541.004] (-536.828) (-538.581) (-539.445) -- 0:00:31
      729500 -- (-545.386) (-534.413) [-534.294] (-532.999) * [-532.851] (-538.777) (-538.724) (-540.153) -- 0:00:31
      730000 -- [-538.700] (-539.901) (-537.764) (-536.201) * [-535.491] (-533.008) (-539.594) (-537.444) -- 0:00:31

      Average standard deviation of split frequencies: 0.005807

      730500 -- (-539.949) (-543.480) [-539.288] (-536.711) * (-542.663) (-535.664) (-545.906) [-541.016] -- 0:00:30
      731000 -- (-535.234) [-539.503] (-535.760) (-535.773) * (-544.457) [-532.921] (-547.161) (-541.833) -- 0:00:30
      731500 -- [-532.901] (-531.079) (-542.676) (-539.992) * (-540.966) (-536.441) (-535.675) [-536.903] -- 0:00:30
      732000 -- (-537.803) (-537.741) (-536.534) [-533.597] * (-540.504) [-534.901] (-543.969) (-539.406) -- 0:00:30
      732500 -- [-536.227] (-533.846) (-537.957) (-538.303) * (-532.404) [-539.611] (-534.410) (-542.373) -- 0:00:30
      733000 -- [-538.963] (-538.086) (-541.019) (-542.421) * (-534.210) [-533.107] (-546.421) (-539.501) -- 0:00:30
      733500 -- (-531.837) [-535.491] (-536.719) (-540.507) * [-533.583] (-534.660) (-547.705) (-537.338) -- 0:00:30
      734000 -- (-533.126) [-536.942] (-536.455) (-530.866) * (-533.262) [-530.218] (-554.105) (-535.291) -- 0:00:30
      734500 -- (-539.185) (-535.410) (-538.088) [-533.516] * [-533.538] (-536.197) (-533.452) (-538.011) -- 0:00:30
      735000 -- [-533.542] (-534.201) (-536.850) (-536.655) * (-535.328) (-535.653) (-536.338) [-534.214] -- 0:00:30

      Average standard deviation of split frequencies: 0.005764

      735500 -- (-535.172) (-539.043) (-534.310) [-540.688] * (-542.486) [-532.487] (-536.262) (-539.462) -- 0:00:30
      736000 -- (-540.002) [-534.074] (-540.699) (-538.697) * (-537.725) (-541.002) [-535.878] (-550.691) -- 0:00:30
      736500 -- (-533.605) [-535.016] (-541.863) (-535.278) * (-541.498) [-536.482] (-538.958) (-539.648) -- 0:00:30
      737000 -- (-535.248) [-533.121] (-538.739) (-536.748) * [-540.165] (-537.238) (-537.529) (-543.627) -- 0:00:30
      737500 -- (-545.063) (-536.092) (-535.549) [-534.802] * (-533.237) (-534.596) [-537.022] (-538.620) -- 0:00:30
      738000 -- [-532.790] (-536.050) (-535.367) (-534.146) * [-533.429] (-538.790) (-537.827) (-534.842) -- 0:00:30
      738500 -- [-536.128] (-533.528) (-532.523) (-536.808) * (-536.819) (-535.659) (-544.942) [-535.446] -- 0:00:30
      739000 -- [-539.334] (-539.496) (-533.114) (-534.311) * (-544.155) [-534.890] (-535.700) (-536.971) -- 0:00:30
      739500 -- (-537.208) (-535.626) (-538.835) [-540.501] * [-534.489] (-531.389) (-542.658) (-537.191) -- 0:00:29
      740000 -- (-537.228) (-542.346) [-532.196] (-535.115) * (-535.042) [-531.978] (-543.860) (-539.060) -- 0:00:29

      Average standard deviation of split frequencies: 0.005728

      740500 -- (-540.828) (-537.160) [-537.460] (-538.341) * (-534.475) (-537.364) [-537.700] (-536.480) -- 0:00:29
      741000 -- (-536.985) (-542.422) (-539.855) [-545.202] * (-541.841) (-538.266) [-539.497] (-536.118) -- 0:00:29
      741500 -- (-541.484) (-533.325) (-534.489) [-536.175] * [-541.006] (-539.193) (-538.451) (-541.409) -- 0:00:29
      742000 -- (-539.225) (-535.032) [-541.136] (-536.739) * (-543.823) [-539.240] (-534.467) (-533.577) -- 0:00:29
      742500 -- [-534.654] (-537.675) (-543.399) (-541.385) * (-535.530) (-531.705) [-531.093] (-536.318) -- 0:00:29
      743000 -- (-536.085) (-540.930) [-536.971] (-538.150) * (-541.247) (-538.841) [-530.567] (-532.835) -- 0:00:29
      743500 -- (-537.582) (-534.786) [-539.965] (-541.011) * (-541.222) [-533.563] (-537.248) (-534.164) -- 0:00:29
      744000 -- (-543.026) (-543.825) [-538.114] (-542.889) * (-543.640) (-538.093) [-539.203] (-541.622) -- 0:00:29
      744500 -- (-537.299) (-539.053) [-533.941] (-539.593) * (-537.815) [-533.906] (-536.187) (-541.391) -- 0:00:29
      745000 -- (-539.457) (-533.565) (-537.067) [-539.517] * [-539.679] (-535.304) (-534.890) (-540.152) -- 0:00:29

      Average standard deviation of split frequencies: 0.005371

      745500 -- (-540.144) [-536.910] (-536.589) (-540.922) * [-535.967] (-536.642) (-538.458) (-537.091) -- 0:00:29
      746000 -- (-542.998) (-538.507) [-536.321] (-537.207) * [-539.837] (-544.426) (-535.115) (-534.869) -- 0:00:29
      746500 -- (-542.854) (-535.926) (-536.179) [-539.309] * [-534.474] (-534.227) (-538.938) (-535.591) -- 0:00:29
      747000 -- (-540.539) [-535.867] (-535.009) (-538.023) * (-536.104) (-535.015) (-545.209) [-533.900] -- 0:00:29
      747500 -- (-547.683) [-535.062] (-547.718) (-538.041) * (-539.819) [-539.669] (-544.610) (-538.613) -- 0:00:29
      748000 -- (-542.217) (-535.765) (-542.831) [-535.908] * (-537.705) [-536.931] (-542.000) (-537.038) -- 0:00:28
      748500 -- [-536.494] (-542.316) (-539.738) (-536.729) * (-543.508) (-539.524) [-537.974] (-537.290) -- 0:00:28
      749000 -- (-537.072) (-538.823) (-540.419) [-539.094] * (-542.241) [-533.107] (-539.232) (-538.343) -- 0:00:28
      749500 -- (-535.331) (-546.222) (-539.728) [-534.614] * [-535.522] (-533.801) (-544.628) (-537.979) -- 0:00:28
      750000 -- (-538.543) [-537.807] (-543.510) (-538.332) * (-543.419) [-536.794] (-538.790) (-537.059) -- 0:00:28

      Average standard deviation of split frequencies: 0.005338

      750500 -- (-534.773) [-537.236] (-539.616) (-542.431) * [-536.427] (-534.356) (-543.760) (-539.860) -- 0:00:28
      751000 -- (-535.601) [-537.232] (-541.695) (-541.668) * (-539.166) [-539.000] (-538.778) (-538.762) -- 0:00:28
      751500 -- (-538.563) (-541.031) [-541.293] (-535.233) * (-543.198) (-544.869) [-538.783] (-538.196) -- 0:00:28
      752000 -- (-544.457) (-535.531) [-542.665] (-538.691) * (-542.751) (-549.056) [-533.961] (-538.491) -- 0:00:28
      752500 -- [-539.426] (-530.740) (-538.597) (-539.433) * [-535.218] (-538.499) (-540.308) (-539.361) -- 0:00:28
      753000 -- (-541.058) (-533.860) (-539.905) [-537.747] * [-538.722] (-539.554) (-531.663) (-541.383) -- 0:00:28
      753500 -- (-538.682) [-534.044] (-542.003) (-535.528) * (-537.072) (-533.616) [-532.837] (-545.120) -- 0:00:28
      754000 -- (-545.459) [-536.805] (-540.284) (-540.442) * (-539.892) (-534.592) [-535.764] (-539.826) -- 0:00:28
      754500 -- (-542.347) (-532.613) [-535.508] (-541.278) * [-533.770] (-541.491) (-536.562) (-535.621) -- 0:00:28
      755000 -- (-536.892) (-535.409) [-533.310] (-535.792) * [-536.401] (-542.116) (-538.198) (-538.719) -- 0:00:28

      Average standard deviation of split frequencies: 0.005300

      755500 -- (-544.634) [-535.514] (-538.695) (-542.043) * (-531.954) (-535.326) (-538.825) [-531.552] -- 0:00:28
      756000 -- (-542.300) (-539.341) (-536.762) [-539.637] * (-534.039) [-530.476] (-546.198) (-536.752) -- 0:00:28
      756500 -- (-538.082) [-535.878] (-544.080) (-536.307) * (-533.613) (-537.215) [-545.182] (-539.346) -- 0:00:28
      757000 -- (-540.332) (-535.662) [-544.472] (-533.577) * (-545.588) [-535.797] (-542.283) (-534.856) -- 0:00:27
      757500 -- (-545.097) [-535.269] (-538.382) (-533.710) * (-534.059) (-543.031) (-546.028) [-533.671] -- 0:00:27
      758000 -- (-538.972) [-541.874] (-540.676) (-535.760) * [-534.072] (-540.018) (-547.520) (-539.917) -- 0:00:27
      758500 -- (-540.762) (-535.087) (-544.626) [-532.915] * [-534.161] (-540.873) (-541.793) (-547.479) -- 0:00:27
      759000 -- (-538.982) (-537.180) (-551.688) [-534.206] * [-538.636] (-535.635) (-537.824) (-534.970) -- 0:00:27
      759500 -- (-537.036) [-542.488] (-537.866) (-541.275) * [-534.887] (-549.037) (-541.744) (-541.473) -- 0:00:27
      760000 -- (-534.023) (-533.137) [-536.564] (-545.358) * (-535.725) [-539.463] (-545.701) (-538.111) -- 0:00:27

      Average standard deviation of split frequencies: 0.004958

      760500 -- [-534.053] (-537.714) (-541.613) (-539.568) * (-531.401) (-535.991) [-544.910] (-544.511) -- 0:00:27
      761000 -- (-536.918) [-535.013] (-538.851) (-537.959) * [-537.805] (-533.460) (-547.786) (-538.552) -- 0:00:27
      761500 -- [-532.197] (-538.540) (-541.560) (-546.429) * (-535.762) [-542.290] (-536.449) (-548.209) -- 0:00:27
      762000 -- (-533.840) [-534.955] (-542.650) (-539.008) * (-543.478) [-537.573] (-538.080) (-533.962) -- 0:00:27
      762500 -- (-544.885) (-539.211) [-541.753] (-534.680) * (-541.451) (-532.554) (-538.924) [-537.033] -- 0:00:27
      763000 -- (-538.983) (-539.482) [-537.331] (-540.414) * [-539.456] (-542.157) (-541.364) (-538.428) -- 0:00:27
      763500 -- (-537.517) (-540.402) (-540.514) [-537.985] * [-531.490] (-533.596) (-544.270) (-543.166) -- 0:00:27
      764000 -- (-532.967) (-539.031) [-537.865] (-533.707) * (-540.209) [-543.210] (-553.580) (-538.562) -- 0:00:27
      764500 -- (-534.581) (-538.093) (-538.111) [-534.124] * (-537.363) [-543.252] (-541.599) (-539.851) -- 0:00:27
      765000 -- (-534.356) [-538.949] (-545.519) (-533.909) * (-538.262) [-538.585] (-544.681) (-542.258) -- 0:00:27

      Average standard deviation of split frequencies: 0.004923

      765500 -- (-541.337) (-545.079) (-540.393) [-535.135] * (-536.889) (-535.953) [-533.905] (-538.004) -- 0:00:26
      766000 -- (-531.679) (-534.065) (-539.925) [-534.871] * [-537.233] (-540.045) (-544.576) (-533.929) -- 0:00:26
      766500 -- [-530.403] (-537.771) (-534.329) (-541.812) * [-533.423] (-537.916) (-543.120) (-542.454) -- 0:00:26
      767000 -- (-537.214) [-537.509] (-534.661) (-541.400) * [-536.164] (-537.218) (-543.240) (-534.453) -- 0:00:26
      767500 -- [-533.275] (-537.046) (-547.965) (-539.633) * [-536.547] (-535.729) (-544.078) (-535.572) -- 0:00:26
      768000 -- (-533.970) (-539.692) (-538.546) [-543.927] * (-534.490) (-535.713) (-540.360) [-534.005] -- 0:00:26
      768500 -- [-532.386] (-543.662) (-539.794) (-535.486) * (-548.478) (-541.294) (-545.558) [-535.908] -- 0:00:26
      769000 -- [-539.191] (-539.833) (-537.429) (-536.120) * [-533.821] (-540.693) (-545.665) (-542.698) -- 0:00:26
      769500 -- (-533.963) (-537.308) (-540.688) [-538.050] * (-538.369) (-540.201) (-539.395) [-535.901] -- 0:00:26
      770000 -- [-537.991] (-538.066) (-536.859) (-540.759) * (-540.749) (-540.342) [-537.144] (-535.744) -- 0:00:26

      Average standard deviation of split frequencies: 0.004893

      770500 -- [-535.564] (-532.378) (-544.566) (-536.510) * (-538.297) (-538.219) (-534.181) [-535.144] -- 0:00:26
      771000 -- (-532.789) [-534.135] (-539.747) (-548.805) * [-542.911] (-540.183) (-540.132) (-534.276) -- 0:00:26
      771500 -- (-536.581) [-538.583] (-539.819) (-537.450) * (-539.821) (-545.850) (-541.024) [-533.758] -- 0:00:26
      772000 -- (-533.825) [-541.647] (-538.757) (-537.912) * (-541.774) (-540.770) [-543.901] (-536.153) -- 0:00:26
      772500 -- (-534.300) [-536.170] (-539.163) (-535.780) * (-540.229) [-537.950] (-547.273) (-536.382) -- 0:00:26
      773000 -- [-536.012] (-542.984) (-544.908) (-536.471) * (-540.294) (-541.756) (-542.125) [-532.775] -- 0:00:26
      773500 -- (-535.345) (-537.089) [-536.811] (-538.899) * (-537.029) (-544.880) (-539.316) [-537.018] -- 0:00:26
      774000 -- (-544.199) [-537.412] (-539.171) (-540.782) * (-542.115) (-541.505) (-540.197) [-540.087] -- 0:00:25
      774500 -- (-541.217) (-543.162) (-536.121) [-531.792] * [-531.415] (-549.961) (-543.550) (-540.580) -- 0:00:25
      775000 -- (-540.371) (-537.709) [-535.552] (-535.883) * (-538.833) (-532.950) (-537.827) [-535.694] -- 0:00:25

      Average standard deviation of split frequencies: 0.005467

      775500 -- (-542.189) [-539.935] (-537.760) (-536.708) * (-542.249) (-546.325) (-547.525) [-541.430] -- 0:00:25
      776000 -- (-541.556) [-533.474] (-535.895) (-533.859) * [-534.884] (-547.091) (-542.011) (-541.849) -- 0:00:25
      776500 -- (-536.279) (-540.604) [-536.543] (-540.452) * (-536.792) (-536.466) (-538.709) [-540.698] -- 0:00:25
      777000 -- (-537.264) [-538.097] (-530.606) (-544.453) * [-537.253] (-538.138) (-538.597) (-540.219) -- 0:00:25
      777500 -- [-534.088] (-542.516) (-538.671) (-543.775) * [-534.567] (-537.251) (-548.521) (-544.224) -- 0:00:25
      778000 -- (-542.175) (-535.272) (-535.277) [-535.330] * (-536.139) [-537.563] (-541.461) (-549.940) -- 0:00:25
      778500 -- (-546.528) (-535.809) (-535.845) [-539.511] * [-535.768] (-535.662) (-547.646) (-537.389) -- 0:00:25
      779000 -- (-538.431) (-543.017) (-535.594) [-535.046] * (-536.787) [-538.392] (-538.135) (-542.450) -- 0:00:25
      779500 -- (-540.726) [-536.989] (-532.206) (-540.753) * (-535.653) (-540.810) (-536.992) [-539.889] -- 0:00:25
      780000 -- (-534.161) (-534.443) (-539.746) [-531.933] * (-538.161) (-539.137) [-539.951] (-539.335) -- 0:00:25

      Average standard deviation of split frequencies: 0.005737

      780500 -- [-543.063] (-540.137) (-545.746) (-537.291) * (-541.274) (-535.543) (-539.686) [-539.789] -- 0:00:25
      781000 -- (-549.072) [-540.377] (-535.020) (-537.062) * [-538.373] (-531.947) (-537.022) (-535.089) -- 0:00:25
      781500 -- (-534.437) (-539.900) (-537.209) [-534.396] * (-540.553) (-542.199) (-540.910) [-534.978] -- 0:00:25
      782000 -- [-538.832] (-535.505) (-538.212) (-534.424) * (-536.475) (-543.392) [-540.230] (-540.094) -- 0:00:25
      782500 -- (-548.687) (-535.097) [-538.569] (-540.004) * (-540.556) (-534.115) (-539.233) [-535.749] -- 0:00:25
      783000 -- (-540.125) [-537.242] (-545.128) (-538.965) * (-539.427) (-532.495) (-534.482) [-532.780] -- 0:00:24
      783500 -- (-547.617) (-535.696) (-541.256) [-537.438] * (-540.746) (-537.040) (-536.575) [-535.917] -- 0:00:24
      784000 -- (-542.405) (-533.335) [-544.713] (-536.753) * (-557.198) (-538.233) (-533.521) [-532.718] -- 0:00:24
      784500 -- (-543.693) [-536.251] (-536.034) (-536.763) * [-541.709] (-532.810) (-536.407) (-535.895) -- 0:00:24
      785000 -- (-538.067) (-538.580) (-538.222) [-538.250] * (-539.010) (-534.703) [-535.545] (-541.914) -- 0:00:24

      Average standard deviation of split frequencies: 0.005998

      785500 -- (-541.699) [-533.511] (-539.004) (-546.740) * (-534.524) (-542.438) [-538.221] (-537.127) -- 0:00:24
      786000 -- (-539.694) (-540.376) (-539.917) [-535.545] * (-538.392) (-542.948) [-538.404] (-534.890) -- 0:00:24
      786500 -- (-533.227) (-541.470) [-535.747] (-540.116) * (-534.647) (-541.751) [-537.455] (-541.411) -- 0:00:24
      787000 -- (-535.490) [-538.223] (-535.368) (-538.783) * (-547.933) (-539.307) [-536.904] (-532.876) -- 0:00:24
      787500 -- (-535.194) (-534.201) (-545.063) [-538.909] * (-538.508) [-537.220] (-537.000) (-533.155) -- 0:00:24
      788000 -- [-540.507] (-535.102) (-535.896) (-535.338) * (-542.211) (-537.460) [-535.853] (-536.364) -- 0:00:24
      788500 -- [-535.703] (-538.567) (-537.719) (-542.140) * (-538.766) [-534.735] (-543.868) (-536.274) -- 0:00:24
      789000 -- [-533.626] (-542.858) (-535.946) (-540.423) * (-537.230) (-536.451) [-536.414] (-541.635) -- 0:00:24
      789500 -- (-543.105) (-535.374) (-534.426) [-535.779] * (-535.557) (-536.464) [-533.874] (-537.195) -- 0:00:24
      790000 -- (-539.401) (-538.179) (-540.484) [-539.552] * (-541.384) [-540.433] (-534.015) (-537.853) -- 0:00:24

      Average standard deviation of split frequencies: 0.006260

      790500 -- (-532.055) (-539.590) (-542.720) [-535.827] * (-543.828) [-533.719] (-536.667) (-540.680) -- 0:00:24
      791000 -- (-535.227) (-540.675) (-542.238) [-534.535] * (-545.318) [-537.938] (-537.529) (-535.252) -- 0:00:24
      791500 -- (-540.599) (-536.464) (-542.170) [-532.740] * (-538.975) [-539.544] (-537.463) (-540.099) -- 0:00:23
      792000 -- (-541.667) (-537.078) (-538.044) [-538.077] * [-539.253] (-533.368) (-535.784) (-545.626) -- 0:00:23
      792500 -- (-540.824) [-538.683] (-537.940) (-537.706) * (-540.838) [-534.698] (-532.992) (-535.350) -- 0:00:23
      793000 -- (-536.784) [-538.712] (-544.127) (-532.665) * (-537.859) (-538.440) [-540.173] (-540.097) -- 0:00:23
      793500 -- (-535.268) (-544.201) (-534.193) [-533.274] * [-542.142] (-536.091) (-536.748) (-543.074) -- 0:00:23
      794000 -- (-535.605) [-540.763] (-542.548) (-537.924) * (-542.995) [-540.655] (-542.964) (-541.247) -- 0:00:23
      794500 -- [-538.889] (-534.645) (-539.757) (-540.262) * (-536.306) (-532.262) (-537.912) [-540.146] -- 0:00:23
      795000 -- [-535.768] (-538.017) (-542.775) (-534.352) * (-538.243) [-534.848] (-539.336) (-546.182) -- 0:00:23

      Average standard deviation of split frequencies: 0.006810

      795500 -- (-534.634) [-537.159] (-539.231) (-536.994) * (-547.470) [-531.133] (-537.007) (-533.429) -- 0:00:23
      796000 -- (-538.305) [-542.491] (-540.127) (-535.420) * (-538.586) (-534.305) [-536.889] (-534.938) -- 0:00:23
      796500 -- (-540.557) (-540.054) (-536.859) [-539.024] * (-541.393) [-535.311] (-538.128) (-532.117) -- 0:00:23
      797000 -- [-543.859] (-533.709) (-536.429) (-537.069) * [-536.392] (-536.625) (-541.850) (-542.562) -- 0:00:23
      797500 -- (-538.874) (-541.410) (-536.183) [-536.136] * [-534.539] (-537.102) (-543.043) (-540.731) -- 0:00:23
      798000 -- (-534.410) (-541.133) (-534.686) [-540.869] * (-541.917) (-537.137) [-538.406] (-536.331) -- 0:00:23
      798500 -- (-541.446) (-539.696) (-538.339) [-534.452] * (-536.269) (-535.232) [-537.849] (-539.582) -- 0:00:23
      799000 -- (-533.834) (-533.459) [-537.617] (-539.866) * (-536.031) (-540.126) (-537.054) [-539.537] -- 0:00:23
      799500 -- (-543.427) (-537.271) [-534.737] (-536.172) * (-538.852) (-539.876) (-536.306) [-533.216] -- 0:00:23
      800000 -- (-533.447) (-534.004) (-539.463) [-533.287] * [-536.266] (-538.315) (-546.302) (-535.160) -- 0:00:23

      Average standard deviation of split frequencies: 0.006771

      800500 -- (-535.857) (-535.523) (-539.534) [-538.096] * (-537.322) (-535.318) [-538.794] (-536.177) -- 0:00:22
      801000 -- [-533.098] (-538.695) (-546.045) (-537.404) * (-538.589) (-537.508) [-534.412] (-543.112) -- 0:00:22
      801500 -- (-532.311) (-548.177) (-547.034) [-539.742] * [-540.919] (-531.788) (-536.912) (-539.001) -- 0:00:22
      802000 -- [-536.776] (-542.035) (-539.111) (-541.511) * (-540.843) (-534.062) (-532.152) [-537.308] -- 0:00:22
      802500 -- [-538.885] (-537.596) (-544.510) (-538.934) * (-544.588) [-536.855] (-539.829) (-535.606) -- 0:00:22
      803000 -- [-538.368] (-543.248) (-537.255) (-535.767) * (-538.999) (-538.249) (-535.768) [-535.030] -- 0:00:22
      803500 -- (-544.795) [-538.324] (-534.926) (-540.838) * [-535.376] (-535.690) (-534.831) (-534.933) -- 0:00:22
      804000 -- (-542.281) [-537.823] (-534.492) (-538.643) * (-542.414) (-535.952) (-538.474) [-538.004] -- 0:00:22
      804500 -- (-540.775) [-537.768] (-539.335) (-543.773) * (-538.650) (-540.122) [-533.192] (-534.335) -- 0:00:22
      805000 -- [-540.346] (-538.500) (-540.210) (-534.272) * [-538.478] (-539.854) (-536.097) (-541.273) -- 0:00:22

      Average standard deviation of split frequencies: 0.006726

      805500 -- [-535.587] (-542.115) (-536.399) (-534.496) * [-537.145] (-540.469) (-534.941) (-541.387) -- 0:00:22
      806000 -- (-534.302) (-535.738) (-538.857) [-536.676] * (-542.463) [-532.404] (-536.481) (-540.326) -- 0:00:22
      806500 -- (-537.813) (-540.248) (-544.171) [-535.547] * (-538.162) (-537.740) [-538.109] (-536.707) -- 0:00:22
      807000 -- [-535.739] (-541.204) (-543.521) (-536.794) * [-536.115] (-542.648) (-538.616) (-539.015) -- 0:00:22
      807500 -- (-539.791) (-539.529) (-543.403) [-532.983] * (-541.273) [-536.848] (-537.456) (-536.850) -- 0:00:22
      808000 -- (-540.659) (-538.905) (-546.126) [-539.166] * (-543.260) [-533.589] (-538.355) (-534.957) -- 0:00:22
      808500 -- (-538.878) [-533.795] (-544.958) (-546.713) * [-544.128] (-531.604) (-535.361) (-538.604) -- 0:00:22
      809000 -- (-539.439) (-534.468) (-540.248) [-534.911] * [-539.964] (-538.211) (-541.070) (-535.851) -- 0:00:21
      809500 -- (-538.564) (-541.088) (-546.346) [-532.136] * (-538.353) (-533.543) (-538.506) [-533.782] -- 0:00:21
      810000 -- (-537.100) [-539.587] (-552.027) (-534.909) * [-537.127] (-543.284) (-538.006) (-535.867) -- 0:00:21

      Average standard deviation of split frequencies: 0.006978

      810500 -- (-538.510) (-533.313) (-547.425) [-545.796] * (-537.608) [-537.374] (-532.898) (-538.620) -- 0:00:21
      811000 -- [-538.845] (-533.440) (-547.835) (-541.174) * (-533.432) (-537.596) (-534.502) [-532.379] -- 0:00:21
      811500 -- (-547.845) (-535.423) (-542.015) [-537.967] * (-540.338) (-534.176) [-537.052] (-538.724) -- 0:00:21
      812000 -- (-537.880) (-536.655) [-540.080] (-538.074) * (-544.254) [-533.668] (-544.620) (-537.153) -- 0:00:21
      812500 -- (-539.950) [-534.281] (-538.640) (-541.856) * (-538.284) (-543.283) (-540.456) [-543.906] -- 0:00:21
      813000 -- (-536.045) [-537.224] (-536.496) (-536.949) * (-539.100) [-530.634] (-546.563) (-540.332) -- 0:00:21
      813500 -- (-539.070) [-535.237] (-541.353) (-540.808) * (-539.140) (-536.184) (-545.392) [-532.106] -- 0:00:21
      814000 -- (-531.848) [-537.231] (-541.748) (-531.960) * [-540.564] (-536.515) (-544.856) (-537.761) -- 0:00:21
      814500 -- (-536.041) (-541.005) (-532.300) [-536.750] * (-544.230) (-534.952) [-536.631] (-538.646) -- 0:00:21
      815000 -- (-534.620) (-536.586) [-541.029] (-541.257) * (-548.300) (-534.287) (-540.816) [-543.864] -- 0:00:21

      Average standard deviation of split frequencies: 0.006932

      815500 -- (-532.936) [-534.296] (-538.544) (-541.007) * (-539.787) (-531.742) [-539.369] (-536.900) -- 0:00:21
      816000 -- (-541.636) (-540.183) (-546.601) [-539.046] * (-539.706) [-533.945] (-544.593) (-539.515) -- 0:00:21
      816500 -- (-541.970) [-537.983] (-546.510) (-534.375) * (-538.442) (-533.655) (-542.230) [-534.876] -- 0:00:21
      817000 -- [-535.234] (-534.597) (-541.729) (-531.934) * (-540.975) (-536.820) (-535.052) [-534.962] -- 0:00:21
      817500 -- (-537.284) (-535.809) (-535.663) [-534.281] * (-536.348) (-541.894) (-536.772) [-531.530] -- 0:00:20
      818000 -- (-540.010) (-541.460) [-538.641] (-537.916) * (-536.121) [-535.064] (-538.715) (-542.335) -- 0:00:20
      818500 -- (-535.239) (-535.804) [-533.036] (-533.367) * [-539.265] (-534.790) (-539.826) (-541.887) -- 0:00:20
      819000 -- (-542.899) [-535.131] (-540.030) (-540.962) * (-533.721) [-538.654] (-539.242) (-535.446) -- 0:00:20
      819500 -- [-533.984] (-537.564) (-536.910) (-537.023) * (-540.264) (-533.659) [-538.945] (-542.530) -- 0:00:20
      820000 -- (-535.505) (-535.803) [-536.550] (-536.248) * (-536.183) [-535.609] (-541.230) (-538.375) -- 0:00:20

      Average standard deviation of split frequencies: 0.007180

      820500 -- (-535.826) (-541.306) [-534.085] (-540.435) * (-537.232) (-538.842) [-538.053] (-541.566) -- 0:00:20
      821000 -- [-535.491] (-542.614) (-536.842) (-542.535) * (-536.510) (-538.764) [-539.674] (-541.132) -- 0:00:20
      821500 -- [-538.870] (-537.744) (-542.090) (-544.295) * [-535.535] (-539.397) (-539.619) (-545.387) -- 0:00:20
      822000 -- [-531.604] (-542.632) (-536.394) (-536.533) * [-532.872] (-540.964) (-536.206) (-534.092) -- 0:00:20
      822500 -- [-542.874] (-538.509) (-532.161) (-536.486) * (-542.398) (-540.963) [-534.191] (-536.775) -- 0:00:20
      823000 -- [-530.006] (-537.752) (-538.178) (-539.857) * (-534.274) [-535.434] (-542.261) (-539.994) -- 0:00:20
      823500 -- (-538.210) (-540.752) (-538.841) [-537.797] * (-539.667) (-540.417) (-535.357) [-533.131] -- 0:00:20
      824000 -- (-537.654) [-532.887] (-544.330) (-540.035) * (-537.663) (-547.060) (-529.712) [-543.025] -- 0:00:20
      824500 -- (-537.671) [-529.547] (-543.061) (-541.627) * (-532.816) (-539.600) [-532.627] (-535.842) -- 0:00:20
      825000 -- (-538.270) (-533.968) [-529.634] (-544.348) * [-539.000] (-534.598) (-537.119) (-534.674) -- 0:00:20

      Average standard deviation of split frequencies: 0.007419

      825500 -- (-540.408) (-538.610) [-536.472] (-544.155) * (-533.513) (-535.182) (-538.540) [-540.482] -- 0:00:20
      826000 -- (-537.261) (-539.451) [-536.386] (-536.228) * (-536.186) (-536.755) [-537.264] (-535.882) -- 0:00:20
      826500 -- (-537.516) [-535.795] (-534.892) (-537.577) * (-547.138) (-537.983) [-534.051] (-534.502) -- 0:00:19
      827000 -- (-546.149) [-534.088] (-535.611) (-530.025) * (-536.999) (-541.873) [-535.821] (-532.451) -- 0:00:19
      827500 -- (-539.107) (-543.331) (-535.697) [-533.276] * (-535.662) [-541.285] (-538.657) (-534.981) -- 0:00:19
      828000 -- (-535.136) (-549.244) (-536.861) [-539.967] * (-531.701) [-532.142] (-547.814) (-535.131) -- 0:00:19
      828500 -- (-547.990) (-537.604) (-534.643) [-537.437] * (-539.381) (-532.884) [-531.308] (-541.971) -- 0:00:19
      829000 -- [-542.427] (-542.230) (-538.411) (-540.411) * (-538.527) (-537.621) (-533.944) [-536.019] -- 0:00:19
      829500 -- (-545.493) (-539.575) [-540.192] (-538.389) * [-534.516] (-536.388) (-534.398) (-538.646) -- 0:00:19
      830000 -- [-535.120] (-538.908) (-545.784) (-542.076) * (-540.007) (-538.525) (-534.616) [-535.085] -- 0:00:19

      Average standard deviation of split frequencies: 0.007094

      830500 -- [-536.073] (-538.883) (-541.570) (-543.882) * [-539.448] (-539.314) (-536.656) (-537.735) -- 0:00:19
      831000 -- (-535.943) [-541.154] (-541.172) (-538.387) * (-533.790) (-539.854) [-532.611] (-542.402) -- 0:00:19
      831500 -- (-544.697) [-536.788] (-548.424) (-537.404) * (-538.298) [-534.042] (-536.325) (-538.226) -- 0:00:19
      832000 -- (-548.955) (-537.654) (-541.847) [-531.921] * (-537.952) (-536.689) [-534.455] (-545.021) -- 0:00:19
      832500 -- (-542.750) [-534.716] (-541.839) (-539.617) * (-543.610) (-539.091) (-540.074) [-538.901] -- 0:00:19
      833000 -- (-537.129) [-538.178] (-543.570) (-544.926) * [-541.041] (-531.217) (-537.068) (-539.415) -- 0:00:19
      833500 -- [-536.404] (-533.668) (-541.930) (-540.948) * (-535.030) (-541.166) (-547.967) [-532.731] -- 0:00:19
      834000 -- (-543.686) [-537.320] (-543.107) (-542.048) * (-536.688) (-541.054) [-539.952] (-542.257) -- 0:00:19
      834500 -- (-538.063) [-530.699] (-541.341) (-536.384) * (-534.349) (-538.292) [-544.886] (-536.753) -- 0:00:19
      835000 -- [-532.556] (-533.170) (-539.309) (-537.156) * (-540.162) (-535.632) [-534.836] (-541.818) -- 0:00:18

      Average standard deviation of split frequencies: 0.006767

      835500 -- [-537.836] (-535.559) (-537.529) (-542.399) * [-540.202] (-539.334) (-541.846) (-541.946) -- 0:00:18
      836000 -- (-537.798) (-537.957) (-533.375) [-534.844] * (-533.554) [-534.089] (-542.417) (-540.461) -- 0:00:18
      836500 -- (-542.544) [-540.584] (-542.328) (-537.490) * (-534.700) [-536.769] (-537.532) (-539.799) -- 0:00:18
      837000 -- (-540.124) (-541.317) (-534.568) [-541.026] * (-542.142) (-539.980) (-533.106) [-540.086] -- 0:00:18
      837500 -- [-531.437] (-536.687) (-538.281) (-538.922) * (-532.188) (-536.234) (-536.484) [-532.132] -- 0:00:18
      838000 -- (-541.550) [-535.751] (-542.349) (-541.280) * (-532.922) (-533.849) (-542.563) [-541.505] -- 0:00:18
      838500 -- (-552.301) (-533.467) (-539.607) [-538.848] * (-536.142) [-547.636] (-542.217) (-539.103) -- 0:00:18
      839000 -- (-540.918) (-535.958) [-540.392] (-541.156) * (-536.329) (-539.546) [-539.047] (-538.829) -- 0:00:18
      839500 -- [-540.036] (-533.801) (-542.646) (-536.489) * (-533.501) (-535.446) (-540.674) [-537.959] -- 0:00:18
      840000 -- (-540.806) (-539.634) [-536.344] (-543.863) * (-540.138) (-542.408) (-542.906) [-537.942] -- 0:00:18

      Average standard deviation of split frequencies: 0.006729

      840500 -- [-535.936] (-534.114) (-538.285) (-539.036) * (-538.096) (-535.141) (-543.132) [-535.462] -- 0:00:18
      841000 -- (-543.472) (-538.752) (-543.919) [-537.269] * (-539.483) [-531.735] (-547.268) (-535.973) -- 0:00:18
      841500 -- (-534.862) (-538.097) [-535.459] (-540.121) * [-543.142] (-534.594) (-539.770) (-539.498) -- 0:00:18
      842000 -- (-543.481) (-542.453) (-542.504) [-538.340] * (-538.420) (-537.128) (-550.781) [-539.823] -- 0:00:18
      842500 -- (-547.958) (-541.385) (-537.505) [-533.606] * [-539.510] (-536.184) (-538.201) (-538.190) -- 0:00:18
      843000 -- [-539.078] (-535.850) (-540.220) (-537.335) * (-538.621) (-536.802) (-548.665) [-536.880] -- 0:00:18
      843500 -- (-535.543) [-541.130] (-541.943) (-535.758) * (-534.519) (-541.001) (-543.133) [-536.284] -- 0:00:17
      844000 -- (-539.116) (-542.756) (-536.193) [-531.806] * [-532.147] (-540.665) (-538.474) (-536.053) -- 0:00:17
      844500 -- (-533.838) (-536.904) [-530.786] (-533.997) * (-543.162) (-534.741) (-534.123) [-538.418] -- 0:00:17
      845000 -- (-535.878) (-541.071) (-537.978) [-537.494] * (-535.889) (-542.179) [-531.806] (-539.662) -- 0:00:17

      Average standard deviation of split frequencies: 0.006408

      845500 -- [-535.993] (-535.158) (-534.110) (-536.286) * (-540.198) [-540.040] (-538.318) (-537.400) -- 0:00:17
      846000 -- (-535.060) (-536.374) (-534.277) [-538.219] * [-536.967] (-536.815) (-535.721) (-536.183) -- 0:00:17
      846500 -- (-537.158) (-537.820) (-539.064) [-530.541] * (-541.968) [-537.047] (-532.877) (-539.623) -- 0:00:17
      847000 -- (-533.988) (-539.384) [-533.092] (-541.496) * (-538.431) (-538.014) [-535.159] (-539.235) -- 0:00:17
      847500 -- (-535.375) (-544.027) [-537.322] (-536.976) * (-536.066) (-540.420) (-534.307) [-536.074] -- 0:00:17
      848000 -- [-537.912] (-541.726) (-531.894) (-534.503) * (-535.921) (-535.319) [-535.091] (-539.806) -- 0:00:17
      848500 -- (-537.293) (-541.819) (-533.724) [-544.418] * (-535.581) (-543.612) (-535.924) [-531.434] -- 0:00:17
      849000 -- (-532.863) [-536.847] (-538.516) (-544.746) * [-534.432] (-537.743) (-539.652) (-544.133) -- 0:00:17
      849500 -- (-543.528) (-544.162) (-531.776) [-534.630] * [-541.456] (-544.274) (-537.033) (-535.570) -- 0:00:17
      850000 -- (-533.517) (-543.920) (-537.497) [-533.826] * [-535.735] (-548.210) (-541.716) (-538.671) -- 0:00:17

      Average standard deviation of split frequencies: 0.005542

      850500 -- [-533.519] (-547.027) (-534.500) (-534.530) * (-539.067) (-541.838) [-544.522] (-541.119) -- 0:00:17
      851000 -- (-532.090) [-544.735] (-534.845) (-534.879) * (-537.988) (-535.634) (-549.715) [-535.649] -- 0:00:17
      851500 -- (-541.645) (-544.260) (-542.784) [-535.935] * (-541.324) (-539.553) (-542.759) [-540.516] -- 0:00:17
      852000 -- (-533.129) [-537.335] (-538.207) (-539.869) * [-538.110] (-543.807) (-535.218) (-540.328) -- 0:00:17
      852500 -- (-536.039) [-538.531] (-538.075) (-542.645) * (-539.000) [-536.941] (-537.594) (-539.031) -- 0:00:16
      853000 -- (-533.962) [-538.204] (-537.458) (-549.926) * (-536.125) (-536.124) [-539.216] (-542.327) -- 0:00:16
      853500 -- (-530.287) [-535.440] (-541.319) (-541.363) * (-535.051) (-542.756) (-541.886) [-541.262] -- 0:00:16
      854000 -- (-544.137) (-534.981) [-533.646] (-538.811) * (-540.119) (-539.990) [-543.479] (-542.431) -- 0:00:16
      854500 -- (-542.739) (-539.958) (-535.935) [-542.010] * (-537.677) [-539.476] (-539.897) (-543.199) -- 0:00:16
      855000 -- (-541.502) [-538.071] (-535.225) (-541.262) * (-539.103) [-541.508] (-549.055) (-539.763) -- 0:00:16

      Average standard deviation of split frequencies: 0.005782

      855500 -- (-540.525) (-538.517) [-540.422] (-541.996) * (-536.679) (-538.550) [-534.714] (-540.788) -- 0:00:16
      856000 -- (-549.793) (-542.719) [-539.528] (-544.902) * (-541.675) (-540.266) [-537.558] (-537.014) -- 0:00:16
      856500 -- (-537.205) (-536.263) [-536.544] (-543.706) * (-534.435) (-541.883) [-537.387] (-539.586) -- 0:00:16
      857000 -- (-540.030) [-542.302] (-541.134) (-539.109) * [-533.437] (-542.377) (-535.188) (-544.591) -- 0:00:16
      857500 -- (-543.525) (-536.532) (-541.808) [-541.059] * (-533.815) [-535.909] (-533.333) (-542.668) -- 0:00:16
      858000 -- (-542.403) (-538.830) [-535.190] (-545.607) * (-536.056) (-539.323) (-538.686) [-542.720] -- 0:00:16
      858500 -- (-540.282) (-543.792) (-537.027) [-546.163] * (-535.328) (-543.827) (-538.118) [-538.729] -- 0:00:16
      859000 -- (-536.759) (-542.988) [-540.086] (-533.763) * (-537.625) (-540.952) [-533.055] (-542.980) -- 0:00:16
      859500 -- [-534.791] (-541.583) (-541.593) (-542.477) * (-534.216) (-539.511) [-533.634] (-539.860) -- 0:00:16
      860000 -- [-533.843] (-540.566) (-540.234) (-537.877) * (-545.773) [-537.469] (-544.724) (-540.968) -- 0:00:16

      Average standard deviation of split frequencies: 0.006025

      860500 -- [-536.579] (-546.468) (-538.973) (-536.071) * (-533.525) [-535.818] (-542.514) (-541.187) -- 0:00:16
      861000 -- (-536.659) (-537.866) [-548.829] (-536.091) * (-534.664) (-535.928) [-540.554] (-540.226) -- 0:00:15
      861500 -- [-533.797] (-540.245) (-539.235) (-540.382) * (-541.145) [-542.723] (-535.029) (-540.837) -- 0:00:15
      862000 -- (-535.590) (-539.432) (-539.319) [-542.201] * [-535.406] (-533.422) (-535.269) (-541.508) -- 0:00:15
      862500 -- [-539.274] (-542.348) (-541.836) (-536.138) * [-537.867] (-535.841) (-537.160) (-538.492) -- 0:00:15
      863000 -- (-540.630) (-541.653) [-538.952] (-546.136) * (-543.126) (-540.377) [-538.288] (-540.194) -- 0:00:15
      863500 -- [-537.096] (-537.026) (-536.865) (-536.572) * [-537.261] (-554.329) (-533.882) (-542.657) -- 0:00:15
      864000 -- [-536.782] (-539.597) (-547.123) (-532.213) * [-537.559] (-540.583) (-532.112) (-538.983) -- 0:00:15
      864500 -- (-536.950) [-535.573] (-536.817) (-535.730) * (-536.184) (-541.010) (-536.707) [-541.282] -- 0:00:15
      865000 -- (-538.225) (-537.513) [-535.646] (-533.853) * (-536.970) (-537.067) [-533.746] (-540.103) -- 0:00:15

      Average standard deviation of split frequencies: 0.005443

      865500 -- (-536.367) (-541.646) [-538.998] (-535.908) * [-535.837] (-535.059) (-534.124) (-540.338) -- 0:00:15
      866000 -- [-539.244] (-536.091) (-533.652) (-539.702) * (-540.513) [-542.607] (-538.071) (-545.208) -- 0:00:15
      866500 -- [-535.314] (-549.253) (-535.952) (-543.498) * (-540.280) (-535.880) [-535.671] (-547.475) -- 0:00:15
      867000 -- (-542.857) (-533.710) [-535.987] (-536.206) * (-538.495) (-542.098) [-532.559] (-534.920) -- 0:00:15
      867500 -- (-541.187) (-539.434) [-539.339] (-541.317) * (-543.944) (-537.627) [-533.018] (-535.087) -- 0:00:15
      868000 -- (-540.737) (-543.381) (-533.680) [-539.176] * (-542.734) (-535.571) (-543.022) [-533.475] -- 0:00:15
      868500 -- (-540.093) (-534.283) [-536.881] (-541.360) * (-531.835) [-534.289] (-535.091) (-536.789) -- 0:00:15
      869000 -- [-538.982] (-537.272) (-534.244) (-543.611) * (-537.888) [-531.193] (-532.300) (-539.878) -- 0:00:15
      869500 -- [-537.802] (-538.000) (-541.063) (-543.346) * (-535.959) (-542.570) [-545.214] (-535.733) -- 0:00:15
      870000 -- (-538.904) [-535.815] (-533.165) (-536.401) * (-538.407) (-539.801) [-534.358] (-538.112) -- 0:00:14

      Average standard deviation of split frequencies: 0.005414

      870500 -- (-546.397) (-534.295) [-536.525] (-536.889) * (-535.335) (-536.165) [-534.701] (-540.284) -- 0:00:14
      871000 -- (-539.820) (-543.784) [-542.314] (-542.603) * (-534.701) (-538.397) (-538.943) [-535.610] -- 0:00:14
      871500 -- (-543.792) (-538.246) [-540.748] (-532.441) * (-537.134) (-540.173) (-538.203) [-536.072] -- 0:00:14
      872000 -- (-546.157) (-539.282) (-539.605) [-537.894] * (-540.173) (-538.113) [-543.281] (-534.976) -- 0:00:14
      872500 -- (-537.516) (-537.157) [-537.572] (-537.660) * (-535.477) (-539.613) (-539.981) [-538.937] -- 0:00:14
      873000 -- (-537.379) [-534.785] (-539.569) (-534.159) * (-537.655) (-540.253) (-534.843) [-536.878] -- 0:00:14
      873500 -- [-541.601] (-539.337) (-538.594) (-537.363) * (-542.371) [-539.176] (-533.294) (-540.663) -- 0:00:14
      874000 -- [-533.892] (-534.561) (-543.210) (-534.982) * (-548.584) [-539.446] (-533.181) (-536.243) -- 0:00:14
      874500 -- [-540.077] (-549.827) (-540.298) (-539.722) * [-547.725] (-536.156) (-537.883) (-541.796) -- 0:00:14
      875000 -- (-537.592) (-540.549) (-534.732) [-540.179] * (-547.893) (-536.940) (-537.184) [-535.088] -- 0:00:14

      Average standard deviation of split frequencies: 0.005381

      875500 -- [-539.771] (-544.059) (-536.138) (-533.951) * (-548.286) (-536.558) (-537.833) [-535.164] -- 0:00:14
      876000 -- [-535.813] (-541.006) (-538.721) (-537.360) * (-539.166) [-533.215] (-536.790) (-539.436) -- 0:00:14
      876500 -- (-537.889) (-540.169) (-537.478) [-543.112] * (-544.178) (-535.707) [-536.225] (-538.134) -- 0:00:14
      877000 -- (-537.717) [-539.611] (-541.269) (-537.149) * (-533.728) (-535.189) [-537.563] (-538.180) -- 0:00:14
      877500 -- [-534.308] (-542.855) (-545.254) (-537.521) * [-533.852] (-538.809) (-539.272) (-542.887) -- 0:00:14
      878000 -- [-535.614] (-538.976) (-543.231) (-535.824) * (-540.456) [-534.135] (-542.818) (-532.064) -- 0:00:14
      878500 -- [-534.821] (-541.011) (-539.177) (-537.062) * [-538.719] (-537.266) (-542.434) (-533.376) -- 0:00:13
      879000 -- (-543.012) (-538.932) [-533.293] (-542.665) * [-538.942] (-537.359) (-539.628) (-539.154) -- 0:00:13
      879500 -- [-540.526] (-538.662) (-539.001) (-542.093) * (-543.094) (-536.980) [-532.634] (-538.327) -- 0:00:13
      880000 -- (-535.495) (-549.263) [-538.038] (-544.875) * (-547.048) [-531.990] (-536.183) (-537.424) -- 0:00:13

      Average standard deviation of split frequencies: 0.005353

      880500 -- (-548.631) [-547.279] (-535.201) (-535.739) * (-535.477) [-535.209] (-534.555) (-541.201) -- 0:00:13
      881000 -