--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 02 16:25:02 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/143/CG42486-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.64 -541.89
2 -533.37 -543.68
--------------------------------------
TOTAL -533.49 -543.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.371916 0.009780 0.211656 0.563684 0.354313 1387.75 1444.37 1.000
r(A<->C){all} 0.229767 0.007796 0.067722 0.403865 0.221933 505.58 567.08 1.002
r(A<->G){all} 0.180828 0.005261 0.050907 0.323230 0.172141 733.91 758.46 1.000
r(A<->T){all} 0.099655 0.002970 0.008813 0.205847 0.093046 723.41 725.57 1.001
r(C<->G){all} 0.080760 0.002785 0.000931 0.181650 0.069931 571.92 703.34 1.000
r(C<->T){all} 0.296200 0.007564 0.132801 0.473416 0.292110 649.68 810.62 1.000
r(G<->T){all} 0.112790 0.002651 0.023272 0.216240 0.103428 917.70 954.73 1.000
pi(A){all} 0.249538 0.000687 0.198511 0.301542 0.248535 1136.21 1318.61 1.000
pi(C){all} 0.191857 0.000570 0.147063 0.238346 0.191139 973.43 1037.70 1.001
pi(G){all} 0.249672 0.000728 0.196624 0.301626 0.249306 1112.65 1255.57 1.000
pi(T){all} 0.308933 0.000781 0.255924 0.364509 0.308498 1093.18 1250.47 1.001
alpha{1,2} 0.151428 0.024076 0.000199 0.419809 0.115563 1256.90 1358.53 1.001
alpha{3} 1.329204 0.454405 0.316347 2.639709 1.210331 1345.80 1396.42 1.000
pinvar{all} 0.194049 0.017363 0.000061 0.436651 0.177473 1051.72 1276.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -509.728667
Model 2: PositiveSelection -506.832783
Model 0: one-ratio -514.45548
Model 3: discrete -506.832783
Model 7: beta -510.867505
Model 8: beta&w>1 -506.872532
Model 0 vs 1 9.453625999999986
Model 2 vs 1 5.791767999999934
Model 8 vs 7 7.989946000000032
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.994** 6.851
72 Q 0.796 5.513
74 N 1.000** 6.891
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.935 6.517 +- 2.757
72 Q 0.613 4.207 +- 3.424
74 N 0.985* 6.796 +- 2.475
>C1
MKFLAMMALLGLLAIFFVSSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQANRFS
>C2
MKFLAIMAFLGLLAILFVDSSEASYCPCNLRKAEVCGTNGLTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQASRFS
>C3
MKFLAMMALLGLLAILFLASSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQASRFS
>C4
MNFLAMMALLGLLAMLFVPSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRNLNIRKLGSCSAIRFT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=77
C1 MKFLAMMALLGLLAIFFVSSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
C2 MKFLAIMAFLGLLAILFVDSSEASYCPCNLRKAEVCGTNGLTYQNRCVFE
C3 MKFLAMMALLGLLAILFLASSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
C4 MNFLAMMALLGLLAMLFVPSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
*:***:**:*****::*: *********************:*********
C1 CTQREYRKLGRILNIKKMGSCQANRFS
C2 CTQREYRKLGRILNIKKMGSCQASRFS
C3 CTQREYRKLGRILNIKKMGSCQASRFS
C4 CTQREYRKLGRNLNIRKLGSCSAIRFT
*********** ***:*:***.* **:
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [924]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [924]--->[924]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/143/CG42486-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.195 Mb, Max= 30.357 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MKFLAMMALLGLLAIFFVSSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQANRFS
>C2
MKFLAIMAFLGLLAILFVDSSEASYCPCNLRKAEVCGTNGLTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQASRFS
>C3
MKFLAMMALLGLLAILFLASSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQASRFS
>C4
MNFLAMMALLGLLAMLFVPSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRNLNIRKLGSCSAIRFT
FORMAT of file /tmp/tmp734167438043829518aln Not Supported[FATAL:T-COFFEE]
>C1
MKFLAMMALLGLLAIFFVSSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQANRFS
>C2
MKFLAIMAFLGLLAILFVDSSEASYCPCNLRKAEVCGTNGLTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQASRFS
>C3
MKFLAMMALLGLLAILFLASSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQASRFS
>C4
MNFLAMMALLGLLAMLFVPSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRNLNIRKLGSCSAIRFT
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:77 S:100 BS:77
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 92.21 C1 C2 92.21
TOP 1 0 92.21 C2 C1 92.21
BOT 0 2 94.81 C1 C3 94.81
TOP 2 0 94.81 C3 C1 94.81
BOT 0 3 87.01 C1 C4 87.01
TOP 3 0 87.01 C4 C1 87.01
BOT 1 2 93.51 C2 C3 93.51
TOP 2 1 93.51 C3 C2 93.51
BOT 1 3 84.42 C2 C4 84.42
TOP 3 1 84.42 C4 C2 84.42
BOT 2 3 87.01 C3 C4 87.01
TOP 3 2 87.01 C4 C3 87.01
AVG 0 C1 * 91.34
AVG 1 C2 * 90.04
AVG 2 C3 * 91.77
AVG 3 C4 * 86.15
TOT TOT * 89.83
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAAGTTCTTGGCTATGATGGCTCTTTTGGGCCTATTGGCTATATTCTT
C2 ATGAAGTTCTTGGCTATAATGGCTTTTTTGGGCCTATTGGCTATATTGTT
C3 ATGAAGTTCTTGGCTATGATGGCTCTTTTGGGGCTATTGGCTATATTATT
C4 ATGAATTTCTTGGCTATGATGGCGCTTTTGGGCCTTTTGGCCATGTTATT
***** ***********.***** ******* **:***** **.** **
C1 TGTGTCTTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG
C2 TGTGGATTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG
C3 TCTGGCTTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG
C4 TGTGCCATCATCGGAGGCCAGCTACTGTCCCTGTAATCTCCGAAAGGCAG
* ** .:*********** ** ** ** *********** **********
C1 AGGTCTGTGGAACCAATGGTGTGACCTATCAGAATCGATGTGTTTTTGAG
C2 AGGTCTGTGGAACCAATGGTTTGACCTATCAGAATCGATGCGTTTTTGAG
C3 AGGTCTGTGGAACCAATGGTGTGACCTATCAGAATAGATGTGTTTTTGAG
C4 AGGTCTGTGGAACCAATGGGGTTACCTACCAAAATCGGTGTGTTTTCGAG
******************* * ***** **.***.*.** ***** ***
C1 TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTGAACATCAAAAA
C2 TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTGAATATAAAAAA
C3 TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTAAACATCAAAAA
C4 TGCACTCAGCGGGAATATAGGAAGCTCGGAAGAAATCTGAACATCCGAAA
********************.*************:* *.** **...***
C1 AATGGGATCTTGTCAAGCTAATCGTTTCTCT
C2 AATGGGATCTTGTCAAGCTTCTCGGTTCTCT
C3 AATGGGATCTTGTCAAGCTTCTCGGTTCTCT
C4 ACTGGGATCTTGTTCAGCTATACGATTCACT
*.*********** .****: :** ***:**
>C1
ATGAAGTTCTTGGCTATGATGGCTCTTTTGGGCCTATTGGCTATATTCTT
TGTGTCTTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG
AGGTCTGTGGAACCAATGGTGTGACCTATCAGAATCGATGTGTTTTTGAG
TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTGAACATCAAAAA
AATGGGATCTTGTCAAGCTAATCGTTTCTCT
>C2
ATGAAGTTCTTGGCTATAATGGCTTTTTTGGGCCTATTGGCTATATTGTT
TGTGGATTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG
AGGTCTGTGGAACCAATGGTTTGACCTATCAGAATCGATGCGTTTTTGAG
TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTGAATATAAAAAA
AATGGGATCTTGTCAAGCTTCTCGGTTCTCT
>C3
ATGAAGTTCTTGGCTATGATGGCTCTTTTGGGGCTATTGGCTATATTATT
TCTGGCTTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG
AGGTCTGTGGAACCAATGGTGTGACCTATCAGAATAGATGTGTTTTTGAG
TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTAAACATCAAAAA
AATGGGATCTTGTCAAGCTTCTCGGTTCTCT
>C4
ATGAATTTCTTGGCTATGATGGCGCTTTTGGGCCTTTTGGCCATGTTATT
TGTGCCATCATCGGAGGCCAGCTACTGTCCCTGTAATCTCCGAAAGGCAG
AGGTCTGTGGAACCAATGGGGTTACCTACCAAAATCGGTGTGTTTTCGAG
TGCACTCAGCGGGAATATAGGAAGCTCGGAAGAAATCTGAACATCCGAAA
ACTGGGATCTTGTTCAGCTATACGATTCACT
>C1
MKFLAMMALLGLLAIFFVSSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQANRFS
>C2
MKFLAIMAFLGLLAILFVDSSEASYCPCNLRKAEVCGTNGLTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQASRFS
>C3
MKFLAMMALLGLLAILFLASSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRILNIKKMGSCQASRFS
>C4
MNFLAMMALLGLLAMLFVPSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
CTQREYRKLGRNLNIRKLGSCSAIRFT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 231 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478103748
Setting output file names to "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 833268890
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1670495347
Seed = 380841835
Swapseed = 1478103748
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 14 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 20 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -591.433044 -- -26.620141
Chain 2 -- -591.433044 -- -26.620141
Chain 3 -- -585.923992 -- -26.620141
Chain 4 -- -591.433044 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -590.481701 -- -26.620141
Chain 2 -- -585.923992 -- -26.620141
Chain 3 -- -590.481701 -- -26.620141
Chain 4 -- -591.433044 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-591.433] (-591.433) (-585.924) (-591.433) * [-590.482] (-585.924) (-590.482) (-591.433)
500 -- [-542.628] (-540.413) (-541.604) (-542.966) * (-539.262) (-538.027) (-543.524) [-537.454] -- 0:00:00
1000 -- (-543.623) [-539.789] (-537.462) (-546.085) * (-537.730) [-541.704] (-542.029) (-539.807) -- 0:00:00
1500 -- (-538.412) (-538.038) [-533.848] (-541.509) * (-535.923) (-539.568) [-534.174] (-553.230) -- 0:11:05
2000 -- (-542.884) (-536.712) (-535.766) [-542.750] * (-542.708) (-539.099) (-537.668) [-533.709] -- 0:08:19
2500 -- (-537.888) (-540.746) [-535.438] (-542.390) * (-539.747) [-533.691] (-534.173) (-535.320) -- 0:06:39
3000 -- [-537.005] (-548.579) (-533.750) (-540.991) * (-534.101) [-537.840] (-533.184) (-532.803) -- 0:05:32
3500 -- (-544.492) [-535.701] (-533.351) (-541.272) * (-539.212) (-535.665) [-534.029] (-534.977) -- 0:04:44
4000 -- (-538.768) (-535.490) [-536.269] (-538.968) * (-541.159) (-532.254) (-535.122) [-532.341] -- 0:04:09
4500 -- (-544.200) (-538.708) [-533.029] (-544.120) * [-538.395] (-538.053) (-542.670) (-540.578) -- 0:03:41
5000 -- (-546.479) (-536.537) (-531.471) [-538.666] * [-535.466] (-534.831) (-535.443) (-539.693) -- 0:03:19
Average standard deviation of split frequencies: 0.052378
5500 -- [-543.016] (-534.155) (-536.408) (-535.759) * [-533.899] (-533.772) (-536.673) (-534.865) -- 0:03:00
6000 -- (-539.714) [-539.429] (-538.947) (-535.374) * [-535.062] (-533.624) (-545.443) (-535.577) -- 0:02:45
6500 -- (-542.618) (-539.902) [-535.052] (-540.633) * [-533.690] (-536.754) (-531.445) (-534.231) -- 0:02:32
7000 -- (-538.031) (-534.326) (-533.778) [-533.752] * (-540.340) [-534.673] (-531.195) (-533.715) -- 0:02:21
7500 -- (-533.480) (-533.180) [-534.272] (-534.287) * [-540.358] (-533.987) (-537.075) (-533.512) -- 0:02:12
8000 -- [-534.562] (-537.230) (-532.649) (-534.483) * [-534.014] (-534.545) (-532.188) (-535.088) -- 0:02:04
8500 -- (-535.359) (-537.766) (-536.998) [-538.337] * [-534.604] (-535.671) (-535.204) (-535.355) -- 0:01:56
9000 -- (-542.744) (-533.795) (-534.373) [-535.217] * (-538.404) (-541.218) (-537.729) [-533.969] -- 0:01:50
9500 -- (-534.743) (-534.847) [-540.184] (-536.045) * (-542.483) [-539.869] (-536.811) (-533.215) -- 0:01:44
10000 -- (-540.477) (-535.718) (-538.641) [-537.007] * (-537.198) (-534.936) [-538.964] (-534.034) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- (-535.020) (-538.962) (-537.927) [-533.615] * (-535.796) [-532.109] (-538.477) (-540.063) -- 0:03:08
11000 -- (-534.055) [-535.370] (-537.644) (-534.765) * [-538.114] (-532.719) (-538.202) (-534.929) -- 0:02:59
11500 -- [-534.367] (-536.078) (-542.601) (-533.328) * (-540.525) [-534.279] (-537.806) (-536.007) -- 0:02:51
12000 -- (-533.577) (-535.093) (-536.052) [-534.143] * (-542.366) (-534.854) (-534.770) [-535.732] -- 0:02:44
12500 -- (-535.374) (-537.608) (-547.700) [-537.552] * [-536.596] (-536.044) (-536.060) (-531.806) -- 0:02:38
13000 -- [-532.843] (-537.200) (-539.142) (-537.042) * [-534.873] (-536.488) (-538.524) (-534.405) -- 0:02:31
13500 -- (-534.413) [-536.618] (-534.690) (-533.758) * (-534.973) (-534.769) (-538.947) [-536.291] -- 0:02:26
14000 -- (-537.485) (-539.787) (-533.688) [-532.361] * (-537.137) [-535.606] (-534.948) (-536.413) -- 0:02:20
14500 -- (-541.675) [-540.800] (-536.772) (-536.674) * (-536.625) [-538.103] (-534.049) (-538.015) -- 0:02:15
15000 -- [-536.908] (-538.376) (-539.819) (-538.296) * (-535.807) [-535.453] (-538.568) (-533.284) -- 0:02:11
Average standard deviation of split frequencies: 0.058926
15500 -- (-542.276) (-538.098) [-537.517] (-536.246) * (-535.855) [-538.277] (-538.300) (-533.540) -- 0:02:07
16000 -- (-540.670) [-536.798] (-538.339) (-538.376) * (-539.474) (-535.487) [-534.739] (-538.083) -- 0:02:03
16500 -- [-533.607] (-549.217) (-538.085) (-539.974) * (-534.759) (-533.163) [-533.444] (-537.239) -- 0:01:59
17000 -- [-537.828] (-541.064) (-537.827) (-539.475) * (-534.620) (-540.665) (-533.826) [-535.381] -- 0:01:55
17500 -- (-535.942) (-543.895) (-532.902) [-538.140] * (-534.749) [-535.644] (-535.954) (-538.593) -- 0:01:52
18000 -- [-535.241] (-544.555) (-533.767) (-538.337) * (-535.293) [-538.753] (-533.212) (-535.982) -- 0:01:49
18500 -- [-536.086] (-540.151) (-536.526) (-538.922) * (-548.128) (-539.402) (-532.031) [-532.294] -- 0:01:46
19000 -- [-537.094] (-543.733) (-536.897) (-539.184) * (-555.112) (-535.757) [-536.207] (-532.697) -- 0:01:43
19500 -- (-538.771) (-537.900) [-541.420] (-545.686) * (-535.903) [-536.178] (-535.255) (-531.981) -- 0:02:30
20000 -- (-538.989) (-536.391) [-533.902] (-543.483) * [-535.838] (-538.788) (-533.158) (-542.624) -- 0:02:27
Average standard deviation of split frequencies: 0.136859
20500 -- (-543.147) [-537.737] (-538.583) (-538.741) * (-538.278) (-539.064) [-533.780] (-535.568) -- 0:02:23
21000 -- [-539.305] (-537.924) (-537.061) (-540.249) * (-536.543) (-543.407) (-533.833) [-536.694] -- 0:02:19
21500 -- (-533.132) (-535.996) [-537.386] (-542.367) * [-530.140] (-536.179) (-543.763) (-536.043) -- 0:02:16
22000 -- (-533.179) (-536.849) (-540.722) [-534.164] * (-535.925) (-538.111) (-540.137) [-541.671] -- 0:02:13
22500 -- (-536.474) (-546.972) (-546.616) [-536.821] * (-534.591) (-536.162) (-537.559) [-539.579] -- 0:02:10
23000 -- (-541.060) (-546.966) (-540.492) [-535.564] * (-532.718) [-532.897] (-536.635) (-536.051) -- 0:02:07
23500 -- [-532.970] (-541.804) (-540.124) (-542.023) * [-536.768] (-537.756) (-536.694) (-539.871) -- 0:02:04
24000 -- (-539.242) [-534.953] (-535.340) (-534.835) * (-534.338) (-534.962) (-538.772) [-541.256] -- 0:02:02
24500 -- (-533.840) (-543.538) [-531.865] (-538.197) * (-535.621) [-535.023] (-539.026) (-538.717) -- 0:01:59
25000 -- [-534.105] (-543.251) (-538.042) (-537.013) * [-535.407] (-538.451) (-538.194) (-540.507) -- 0:01:57
Average standard deviation of split frequencies: 0.096698
25500 -- (-534.837) (-539.240) (-537.544) [-536.581] * (-537.665) (-536.893) [-539.929] (-540.616) -- 0:01:54
26000 -- (-532.557) [-536.329] (-535.259) (-542.394) * (-540.655) [-534.365] (-535.082) (-544.614) -- 0:01:52
26500 -- (-536.881) [-535.479] (-533.878) (-537.910) * (-541.591) [-536.196] (-533.275) (-535.255) -- 0:01:50
27000 -- (-536.546) [-536.427] (-535.156) (-538.177) * (-542.456) [-534.764] (-540.952) (-539.640) -- 0:01:48
27500 -- (-539.742) (-536.621) (-539.725) [-537.207] * [-539.092] (-537.523) (-537.062) (-544.510) -- 0:01:46
28000 -- (-534.209) (-536.478) [-533.937] (-544.559) * (-539.960) (-535.387) (-541.833) [-536.296] -- 0:02:18
28500 -- (-533.175) (-536.030) [-531.158] (-538.138) * [-539.122] (-536.266) (-534.375) (-533.413) -- 0:02:16
29000 -- (-535.974) (-538.669) (-531.382) [-536.618] * (-544.114) (-538.278) [-537.101] (-537.353) -- 0:02:13
29500 -- (-537.577) [-538.104] (-533.164) (-539.050) * (-536.788) (-534.805) (-536.911) [-536.456] -- 0:02:11
30000 -- (-531.792) (-540.629) [-533.134] (-540.901) * (-539.798) [-533.224] (-540.076) (-538.090) -- 0:02:09
Average standard deviation of split frequencies: 0.092231
30500 -- [-540.515] (-540.861) (-534.737) (-535.756) * [-536.082] (-540.081) (-538.733) (-533.830) -- 0:02:07
31000 -- (-533.599) (-541.932) (-535.888) [-534.563] * (-537.274) (-534.003) [-536.016] (-531.021) -- 0:02:05
31500 -- (-539.702) [-537.459] (-534.642) (-535.324) * (-533.337) [-533.220] (-536.771) (-537.077) -- 0:02:02
32000 -- (-537.813) (-543.301) [-542.303] (-538.740) * (-538.196) (-535.421) (-535.887) [-535.756] -- 0:02:01
32500 -- (-535.907) (-537.870) [-538.238] (-535.365) * [-537.085] (-533.368) (-538.709) (-543.173) -- 0:01:59
33000 -- (-530.259) (-537.760) [-533.664] (-537.456) * (-534.149) [-533.780] (-535.191) (-535.073) -- 0:01:57
33500 -- [-536.883] (-535.094) (-534.523) (-534.780) * [-532.772] (-535.253) (-537.058) (-538.964) -- 0:01:55
34000 -- (-541.071) (-535.799) (-533.400) [-533.590] * (-536.785) (-533.204) (-539.003) [-536.843] -- 0:01:53
34500 -- [-541.001] (-540.046) (-535.847) (-537.607) * (-536.193) (-537.534) (-537.260) [-536.852] -- 0:01:51
35000 -- [-538.041] (-538.298) (-539.529) (-538.212) * [-534.884] (-539.915) (-544.521) (-542.364) -- 0:01:50
Average standard deviation of split frequencies: 0.052378
35500 -- (-536.975) (-534.939) (-536.850) [-532.329] * (-536.675) (-543.914) [-539.518] (-542.751) -- 0:01:48
36000 -- (-535.118) (-539.071) [-535.703] (-538.815) * (-538.021) [-539.733] (-538.387) (-542.380) -- 0:01:47
36500 -- (-534.136) (-536.922) [-537.704] (-538.863) * (-536.794) (-539.440) [-535.242] (-540.488) -- 0:01:45
37000 -- (-537.882) (-534.997) [-537.747] (-545.269) * [-535.127] (-538.996) (-537.820) (-539.807) -- 0:02:10
37500 -- (-535.823) [-534.446] (-535.848) (-543.507) * (-539.054) (-536.283) (-540.237) [-538.531] -- 0:02:08
38000 -- (-538.215) [-532.087] (-537.395) (-539.173) * [-537.235] (-537.857) (-536.174) (-539.203) -- 0:02:06
38500 -- (-535.534) (-533.722) (-539.796) [-540.337] * (-543.080) (-539.492) (-535.102) [-535.285] -- 0:02:04
39000 -- (-538.225) [-532.832] (-537.037) (-539.229) * (-538.138) [-533.059] (-541.202) (-535.263) -- 0:02:03
39500 -- (-534.828) [-540.418] (-541.180) (-538.239) * (-541.229) (-538.736) (-534.201) [-536.735] -- 0:02:01
40000 -- (-535.429) (-534.202) (-537.608) [-534.426] * (-535.660) [-533.796] (-536.089) (-535.469) -- 0:02:00
Average standard deviation of split frequencies: 0.061824
40500 -- [-537.903] (-538.554) (-540.818) (-534.244) * (-537.464) (-534.232) (-535.458) [-539.755] -- 0:01:58
41000 -- [-535.673] (-538.043) (-531.483) (-537.934) * (-539.508) (-534.355) (-534.137) [-546.345] -- 0:01:56
41500 -- (-534.920) (-533.570) (-536.837) [-535.365] * (-534.312) [-535.907] (-539.804) (-544.319) -- 0:01:55
42000 -- [-534.546] (-535.662) (-535.048) (-537.515) * (-537.305) [-535.999] (-539.564) (-536.529) -- 0:01:54
42500 -- (-533.713) [-537.684] (-540.622) (-536.808) * (-537.746) (-535.336) (-538.530) [-533.892] -- 0:01:52
43000 -- [-536.088] (-536.273) (-534.069) (-539.438) * [-537.799] (-542.047) (-538.706) (-535.215) -- 0:01:51
43500 -- (-532.627) (-539.274) [-533.704] (-544.083) * (-538.006) (-534.495) (-536.794) [-536.721] -- 0:01:49
44000 -- [-533.918] (-536.860) (-534.732) (-535.653) * (-538.048) [-537.708] (-532.959) (-533.431) -- 0:01:48
44500 -- [-534.412] (-534.415) (-536.121) (-539.127) * (-539.012) [-533.790] (-536.921) (-537.704) -- 0:01:47
45000 -- (-537.807) (-539.302) [-536.954] (-536.358) * (-536.084) (-540.080) [-537.296] (-537.928) -- 0:01:46
Average standard deviation of split frequencies: 0.068319
45500 -- (-537.194) [-534.572] (-539.196) (-535.584) * [-532.959] (-539.160) (-537.393) (-537.478) -- 0:01:44
46000 -- (-536.240) (-535.696) (-537.080) [-537.916] * (-536.787) (-539.995) (-534.722) [-536.894] -- 0:01:43
46500 -- (-534.835) [-539.015] (-539.553) (-537.949) * (-534.634) (-537.843) (-537.946) [-541.849] -- 0:02:03
47000 -- (-534.490) [-539.244] (-542.161) (-538.759) * [-536.757] (-544.856) (-531.853) (-537.797) -- 0:02:01
47500 -- (-535.889) [-541.028] (-537.805) (-538.412) * (-534.618) (-543.939) [-535.743] (-532.612) -- 0:02:00
48000 -- (-534.773) (-547.188) (-535.964) [-535.822] * [-531.233] (-537.937) (-531.670) (-534.182) -- 0:01:59
48500 -- (-533.964) [-538.093] (-535.595) (-538.966) * (-535.473) (-533.260) [-533.068] (-544.439) -- 0:01:57
49000 -- (-535.940) (-537.720) (-534.670) [-538.104] * (-537.306) [-531.550] (-535.989) (-536.820) -- 0:01:56
49500 -- (-535.383) (-535.241) [-534.054] (-537.413) * [-534.198] (-534.404) (-535.126) (-534.515) -- 0:01:55
50000 -- (-541.737) (-542.831) [-533.404] (-534.653) * (-532.568) (-537.666) (-532.173) [-533.151] -- 0:01:54
Average standard deviation of split frequencies: 0.068230
50500 -- [-535.624] (-532.615) (-539.533) (-537.610) * (-536.232) [-532.673] (-535.893) (-538.553) -- 0:01:52
51000 -- (-538.154) (-537.723) (-534.646) [-533.472] * (-532.743) (-540.575) [-534.902] (-537.072) -- 0:01:51
51500 -- (-535.830) (-537.470) [-537.505] (-534.244) * (-538.249) [-531.686] (-536.453) (-534.931) -- 0:01:50
52000 -- (-536.265) (-535.345) (-537.453) [-533.449] * (-536.924) (-530.078) [-534.881] (-539.201) -- 0:01:49
52500 -- [-537.945] (-536.582) (-539.053) (-535.596) * [-532.186] (-530.760) (-544.745) (-536.644) -- 0:01:48
53000 -- (-541.828) [-533.415] (-538.584) (-532.958) * (-538.357) [-532.558] (-540.606) (-532.621) -- 0:01:47
53500 -- (-541.591) [-533.881] (-531.953) (-543.768) * (-533.491) [-534.991] (-538.071) (-535.587) -- 0:01:46
54000 -- (-548.528) [-533.440] (-542.239) (-541.397) * [-539.342] (-535.918) (-535.631) (-535.952) -- 0:01:45
54500 -- [-534.976] (-533.337) (-538.748) (-537.080) * (-533.519) (-535.408) (-537.985) [-534.205] -- 0:01:44
55000 -- (-539.275) [-538.128] (-544.161) (-536.162) * [-534.894] (-535.293) (-536.256) (-533.838) -- 0:01:43
Average standard deviation of split frequencies: 0.061732
55500 -- [-535.716] (-542.052) (-535.644) (-533.383) * (-533.867) [-539.441] (-540.076) (-536.242) -- 0:01:59
56000 -- (-533.854) (-538.978) [-531.718] (-537.150) * (-535.440) [-534.261] (-540.574) (-534.309) -- 0:01:58
56500 -- (-539.825) [-537.148] (-534.904) (-536.499) * [-533.371] (-535.012) (-535.391) (-535.093) -- 0:01:56
57000 -- (-536.058) (-536.214) (-538.920) [-532.805] * (-534.708) (-534.816) [-538.151] (-533.722) -- 0:01:55
57500 -- (-535.948) (-536.349) [-536.009] (-533.818) * [-537.450] (-538.680) (-535.874) (-535.728) -- 0:01:54
58000 -- (-536.651) (-535.371) [-535.492] (-534.347) * (-535.432) [-536.728] (-536.045) (-539.347) -- 0:01:53
58500 -- [-533.599] (-535.982) (-535.062) (-535.117) * (-533.062) (-536.783) [-533.999] (-541.208) -- 0:01:52
59000 -- (-536.493) [-533.323] (-536.085) (-547.328) * (-538.933) (-535.649) [-535.800] (-538.177) -- 0:01:51
59500 -- (-532.614) [-535.233] (-539.013) (-547.305) * (-541.666) (-540.916) (-535.752) [-536.655] -- 0:01:50
60000 -- [-536.381] (-537.574) (-539.297) (-538.053) * (-543.735) (-541.006) [-535.274] (-533.365) -- 0:01:49
Average standard deviation of split frequencies: 0.051803
60500 -- [-536.054] (-535.371) (-539.349) (-543.711) * [-536.493] (-537.361) (-540.633) (-533.317) -- 0:01:48
61000 -- (-536.019) [-537.868] (-538.855) (-540.227) * (-538.293) (-538.673) (-537.737) [-535.001] -- 0:01:47
61500 -- [-534.331] (-537.946) (-533.555) (-542.203) * (-533.762) (-540.812) [-532.923] (-532.477) -- 0:01:46
62000 -- (-537.543) (-538.276) [-533.384] (-540.302) * (-541.524) (-540.065) [-529.859] (-540.111) -- 0:01:45
62500 -- (-538.702) [-535.198] (-541.548) (-539.854) * (-537.443) (-544.167) [-529.823] (-538.182) -- 0:01:45
63000 -- (-539.727) (-540.957) (-541.122) [-534.085] * (-537.505) (-543.639) [-537.503] (-535.492) -- 0:01:44
63500 -- (-539.488) (-535.547) [-538.291] (-535.432) * (-537.028) (-538.247) (-533.622) [-536.079] -- 0:01:43
64000 -- (-540.028) (-538.911) (-542.805) [-540.285] * (-540.470) (-539.773) (-538.179) [-535.954] -- 0:01:42
64500 -- (-538.747) (-532.979) [-538.313] (-538.405) * (-537.796) (-544.580) (-536.552) [-538.676] -- 0:01:56
65000 -- (-537.351) (-538.899) (-537.607) [-533.971] * (-541.335) [-533.987] (-538.732) (-538.665) -- 0:01:55
Average standard deviation of split frequencies: 0.038093
65500 -- (-539.138) [-536.528] (-535.323) (-543.408) * [-542.856] (-537.032) (-535.122) (-538.172) -- 0:01:54
66000 -- (-533.374) [-536.946] (-531.724) (-537.840) * (-536.795) (-538.810) [-537.284] (-539.047) -- 0:01:53
66500 -- [-533.640] (-534.006) (-532.556) (-538.017) * (-535.583) (-535.330) (-535.463) [-538.808] -- 0:01:52
67000 -- (-538.488) (-535.791) [-534.649] (-535.110) * (-535.445) (-536.645) (-535.132) [-535.640] -- 0:01:51
67500 -- [-533.626] (-536.090) (-545.539) (-530.865) * (-540.497) [-533.826] (-541.547) (-536.937) -- 0:01:50
68000 -- (-538.354) (-541.966) (-537.280) [-534.778] * [-535.697] (-535.129) (-536.759) (-534.336) -- 0:01:49
68500 -- (-540.163) (-540.053) [-534.768] (-533.422) * (-538.424) (-532.621) [-537.309] (-539.763) -- 0:01:48
69000 -- (-543.581) (-537.733) [-532.364] (-532.512) * (-541.234) (-535.851) (-534.671) [-538.364] -- 0:01:47
69500 -- (-535.808) (-545.681) [-536.107] (-533.259) * [-533.231] (-536.032) (-537.228) (-534.967) -- 0:01:47
70000 -- (-535.131) (-533.284) [-537.784] (-534.149) * (-531.319) (-534.542) (-539.554) [-536.459] -- 0:01:46
Average standard deviation of split frequencies: 0.035578
70500 -- (-539.986) (-537.267) (-532.654) [-535.544] * (-536.405) [-537.599] (-535.295) (-534.626) -- 0:01:45
71000 -- [-540.721] (-533.684) (-541.871) (-535.593) * (-537.744) (-538.147) (-538.362) [-535.228] -- 0:01:44
71500 -- (-541.187) (-539.452) (-535.756) [-539.207] * [-532.906] (-535.009) (-536.305) (-538.870) -- 0:01:43
72000 -- (-544.009) (-532.931) [-535.524] (-536.385) * (-536.968) (-533.580) [-530.480] (-536.812) -- 0:01:43
72500 -- (-541.524) (-532.689) [-534.689] (-536.302) * (-540.313) (-541.804) [-537.888] (-533.562) -- 0:01:42
73000 -- (-540.003) [-531.869] (-533.539) (-534.617) * [-536.594] (-535.426) (-531.078) (-534.852) -- 0:01:41
73500 -- (-539.158) (-539.456) [-535.033] (-536.501) * (-536.251) (-533.109) [-532.486] (-537.131) -- 0:01:53
74000 -- (-540.152) (-538.265) (-540.005) [-532.335] * (-538.823) [-536.407] (-536.986) (-542.648) -- 0:01:52
74500 -- (-538.394) (-535.096) [-535.279] (-535.600) * [-533.916] (-537.543) (-536.370) (-536.375) -- 0:01:51
75000 -- (-535.901) (-532.323) [-534.392] (-538.267) * (-537.081) [-536.654] (-538.813) (-537.980) -- 0:01:51
Average standard deviation of split frequencies: 0.037216
75500 -- (-537.232) [-536.487] (-535.716) (-539.658) * [-539.509] (-540.373) (-536.944) (-535.405) -- 0:01:50
76000 -- (-537.645) [-535.302] (-536.169) (-535.367) * (-531.434) (-539.782) [-536.665] (-537.804) -- 0:01:49
76500 -- (-535.678) (-541.361) (-544.040) [-532.142] * (-534.532) (-539.412) (-539.991) [-547.405] -- 0:01:48
77000 -- (-539.555) (-543.547) (-543.176) [-535.682] * [-534.659] (-544.215) (-539.678) (-538.522) -- 0:01:47
77500 -- (-539.163) (-536.595) (-547.178) [-540.389] * [-538.180] (-539.638) (-535.810) (-537.403) -- 0:01:47
78000 -- [-542.729] (-537.741) (-541.926) (-538.549) * (-544.447) [-533.746] (-534.261) (-538.055) -- 0:01:46
78500 -- (-540.720) [-535.383] (-539.420) (-544.798) * (-538.908) [-537.428] (-535.812) (-533.858) -- 0:01:45
79000 -- (-537.628) (-533.739) [-536.355] (-532.845) * (-534.014) (-538.804) (-540.168) [-539.578] -- 0:01:44
79500 -- (-542.620) [-537.075] (-532.382) (-532.739) * (-537.378) [-540.342] (-544.319) (-537.831) -- 0:01:44
80000 -- (-533.823) (-539.084) (-533.365) [-535.914] * (-537.013) [-534.768] (-542.792) (-535.051) -- 0:01:43
Average standard deviation of split frequencies: 0.027271
80500 -- (-535.583) (-539.701) [-533.446] (-532.044) * (-537.263) [-536.357] (-540.077) (-536.787) -- 0:01:42
81000 -- (-536.744) (-535.793) (-534.403) [-532.701] * (-533.152) (-535.873) [-535.640] (-534.743) -- 0:01:42
81500 -- (-542.672) [-538.088] (-537.026) (-532.490) * (-538.129) [-533.618] (-534.806) (-537.417) -- 0:01:41
82000 -- (-543.658) (-542.388) (-537.779) [-534.943] * (-537.209) [-536.251] (-533.874) (-536.613) -- 0:01:40
82500 -- [-538.035] (-535.285) (-536.014) (-532.642) * (-534.993) [-536.952] (-535.437) (-539.422) -- 0:01:51
83000 -- (-539.334) (-540.436) (-536.106) [-532.783] * [-540.601] (-535.686) (-535.036) (-536.255) -- 0:01:50
83500 -- (-537.101) [-535.503] (-538.016) (-535.453) * (-539.353) [-534.637] (-535.525) (-535.251) -- 0:01:49
84000 -- (-537.548) [-537.451] (-541.757) (-534.488) * [-538.961] (-537.053) (-537.693) (-535.699) -- 0:01:49
84500 -- [-539.269] (-538.096) (-538.200) (-538.697) * (-535.219) [-534.669] (-542.219) (-539.682) -- 0:01:48
85000 -- (-543.420) [-534.498] (-536.397) (-535.293) * [-537.003] (-535.346) (-536.033) (-549.874) -- 0:01:47
Average standard deviation of split frequencies: 0.036543
85500 -- (-537.243) (-538.809) [-535.222] (-536.719) * (-539.016) [-537.393] (-540.895) (-538.777) -- 0:01:46
86000 -- (-537.267) [-533.145] (-538.247) (-533.279) * [-535.754] (-536.777) (-542.386) (-541.796) -- 0:01:46
86500 -- (-536.106) (-530.567) (-536.349) [-531.290] * (-539.082) [-535.357] (-545.757) (-541.314) -- 0:01:45
87000 -- [-540.497] (-537.763) (-532.191) (-536.549) * (-536.998) [-536.456] (-548.448) (-536.882) -- 0:01:44
87500 -- (-534.228) (-534.485) (-540.966) [-536.160] * (-536.543) (-536.674) [-539.557] (-537.016) -- 0:01:44
88000 -- [-537.084] (-531.801) (-539.412) (-533.097) * (-537.468) (-538.297) [-536.712] (-536.641) -- 0:01:43
88500 -- (-532.771) [-539.363] (-537.941) (-538.443) * (-541.649) [-535.029] (-539.010) (-538.806) -- 0:01:42
89000 -- (-538.464) [-533.267] (-535.121) (-534.909) * [-538.296] (-538.693) (-532.747) (-537.140) -- 0:01:42
89500 -- [-535.202] (-543.342) (-533.341) (-536.063) * [-535.549] (-539.750) (-532.734) (-536.667) -- 0:01:41
90000 -- (-539.736) [-533.955] (-537.037) (-538.622) * (-538.235) (-533.562) [-532.222] (-532.580) -- 0:01:41
Average standard deviation of split frequencies: 0.038128
90500 -- (-536.625) (-534.418) [-534.334] (-537.531) * (-536.317) (-533.845) (-537.688) [-532.438] -- 0:01:40
91000 -- (-536.765) (-536.062) (-534.523) [-534.235] * [-536.158] (-540.006) (-542.868) (-533.937) -- 0:01:39
91500 -- (-536.264) [-539.153] (-540.227) (-539.428) * (-539.513) (-532.843) (-536.140) [-533.166] -- 0:01:49
92000 -- [-535.469] (-538.022) (-537.936) (-537.448) * (-534.379) (-540.268) (-538.208) [-532.966] -- 0:01:48
92500 -- (-539.184) (-541.391) [-535.655] (-533.774) * (-535.141) (-537.243) (-535.334) [-532.465] -- 0:01:47
93000 -- [-537.376] (-537.077) (-537.110) (-535.188) * (-537.213) (-534.168) (-536.890) [-534.942] -- 0:01:47
93500 -- (-539.580) (-535.502) [-536.960] (-533.211) * (-540.309) (-535.364) (-541.547) [-536.674] -- 0:01:46
94000 -- (-540.182) (-532.862) [-534.036] (-539.816) * [-541.296] (-533.303) (-544.663) (-537.692) -- 0:01:46
94500 -- (-542.647) (-537.173) (-532.649) [-540.067] * [-535.907] (-533.560) (-542.314) (-535.705) -- 0:01:45
95000 -- (-535.206) (-536.957) (-536.548) [-540.375] * [-538.018] (-536.400) (-535.928) (-539.847) -- 0:01:44
Average standard deviation of split frequencies: 0.029463
95500 -- (-536.071) (-535.264) [-531.158] (-535.725) * (-542.096) [-537.471] (-533.333) (-535.543) -- 0:01:44
96000 -- (-540.236) (-536.117) (-532.137) [-539.768] * [-538.743] (-536.704) (-537.304) (-535.433) -- 0:01:43
96500 -- (-537.469) (-536.335) (-531.852) [-535.775] * (-538.930) (-539.096) [-532.764] (-532.161) -- 0:01:42
97000 -- [-536.991] (-532.627) (-540.515) (-536.435) * (-533.245) [-534.093] (-536.270) (-536.191) -- 0:01:42
97500 -- (-537.142) [-532.908] (-535.846) (-534.150) * (-533.934) [-536.730] (-537.762) (-538.639) -- 0:01:41
98000 -- (-536.493) [-534.283] (-537.466) (-534.131) * (-540.375) (-540.908) (-538.697) [-534.378] -- 0:01:41
98500 -- (-539.972) [-538.449] (-538.618) (-538.992) * (-536.138) (-539.059) [-532.418] (-537.691) -- 0:01:40
99000 -- (-532.458) (-536.968) [-537.909] (-539.820) * (-543.452) (-539.709) (-531.265) [-536.403] -- 0:01:40
99500 -- [-537.541] (-537.352) (-542.418) (-536.223) * [-536.605] (-542.389) (-534.824) (-537.347) -- 0:01:39
100000 -- [-534.495] (-544.304) (-537.426) (-538.155) * [-543.947] (-537.220) (-532.341) (-537.925) -- 0:01:39
Average standard deviation of split frequencies: 0.021853
100500 -- (-538.130) (-536.875) (-540.087) [-539.020] * (-538.237) [-538.643] (-535.168) (-534.599) -- 0:01:47
101000 -- [-532.527] (-539.503) (-541.760) (-533.851) * (-542.469) (-540.449) [-534.672] (-536.547) -- 0:01:46
101500 -- [-532.310] (-540.887) (-541.091) (-535.307) * [-538.864] (-534.901) (-537.709) (-532.884) -- 0:01:46
102000 -- (-536.566) (-541.835) (-540.159) [-535.312] * (-533.523) [-535.782] (-535.850) (-531.684) -- 0:01:45
102500 -- (-535.078) [-539.261] (-541.175) (-539.677) * (-533.238) (-536.864) [-534.323] (-534.828) -- 0:01:45
103000 -- (-536.240) [-536.427] (-546.605) (-536.433) * (-540.615) (-541.074) [-535.067] (-537.644) -- 0:01:44
103500 -- [-537.123] (-544.485) (-533.957) (-533.131) * (-541.570) (-548.649) [-540.546] (-539.699) -- 0:01:43
104000 -- [-538.445] (-544.211) (-536.895) (-533.766) * (-536.851) [-538.831] (-537.365) (-541.588) -- 0:01:43
104500 -- (-537.532) (-540.370) [-538.283] (-535.409) * (-534.971) (-536.312) [-537.619] (-539.512) -- 0:01:42
105000 -- (-535.636) (-535.186) [-536.865] (-534.053) * (-540.707) [-535.169] (-534.770) (-536.022) -- 0:01:42
Average standard deviation of split frequencies: 0.020754
105500 -- (-541.549) (-535.301) [-537.593] (-532.823) * (-537.004) (-539.801) [-535.071] (-541.699) -- 0:01:41
106000 -- (-535.068) (-536.904) [-535.390] (-536.357) * [-536.718] (-541.845) (-535.328) (-535.370) -- 0:01:41
106500 -- (-538.503) [-534.740] (-540.616) (-537.340) * (-539.181) [-535.804] (-536.406) (-539.843) -- 0:01:40
107000 -- [-535.036] (-537.119) (-537.417) (-537.412) * (-540.293) [-531.704] (-541.673) (-538.212) -- 0:01:40
107500 -- [-538.000] (-538.348) (-535.986) (-539.762) * (-536.092) (-539.491) (-542.039) [-534.392] -- 0:01:39
108000 -- (-540.953) (-541.380) (-538.002) [-535.930] * [-537.829] (-535.387) (-540.074) (-536.526) -- 0:01:39
108500 -- (-554.880) (-537.520) (-540.053) [-530.737] * [-534.756] (-537.010) (-538.052) (-536.234) -- 0:01:38
109000 -- (-538.652) (-539.791) (-536.303) [-533.331] * [-532.865] (-531.376) (-541.962) (-536.042) -- 0:01:46
109500 -- [-544.490] (-534.873) (-535.896) (-534.856) * (-534.021) [-537.837] (-537.638) (-534.519) -- 0:01:45
110000 -- (-547.648) (-537.851) [-536.212] (-536.310) * (-535.411) (-540.283) [-534.484] (-533.405) -- 0:01:45
Average standard deviation of split frequencies: 0.014199
110500 -- [-543.158] (-538.040) (-541.003) (-536.736) * (-537.775) (-536.452) [-532.400] (-541.120) -- 0:01:44
111000 -- (-537.992) [-538.180] (-536.826) (-537.720) * (-542.270) (-536.017) (-535.111) [-534.470] -- 0:01:44
111500 -- (-539.772) (-536.143) (-536.921) [-534.176] * (-535.693) (-531.061) [-541.585] (-535.505) -- 0:01:43
112000 -- (-546.074) (-534.991) [-537.046] (-539.530) * (-536.286) (-537.339) (-539.377) [-534.604] -- 0:01:43
112500 -- (-537.573) (-535.055) [-535.930] (-535.802) * (-536.845) (-537.869) (-536.739) [-538.642] -- 0:01:42
113000 -- (-540.209) (-535.298) [-539.610] (-534.712) * (-537.215) (-539.577) (-536.484) [-536.253] -- 0:01:42
113500 -- (-541.191) [-538.770] (-537.762) (-536.404) * (-541.449) (-536.625) [-533.639] (-532.884) -- 0:01:41
114000 -- (-538.085) (-539.380) [-532.569] (-538.683) * (-541.014) (-541.455) (-540.666) [-532.196] -- 0:01:41
114500 -- (-541.398) (-543.701) (-534.118) [-537.423] * (-533.085) [-536.189] (-537.062) (-532.375) -- 0:01:40
115000 -- (-543.661) (-535.014) (-535.181) [-535.385] * (-535.068) (-536.699) (-543.545) [-533.735] -- 0:01:40
Average standard deviation of split frequencies: 0.013546
115500 -- [-536.284] (-534.195) (-538.285) (-536.497) * (-531.259) [-532.201] (-539.808) (-535.790) -- 0:01:39
116000 -- (-536.401) (-541.442) (-533.046) [-534.572] * (-536.587) (-538.425) (-535.372) [-538.662] -- 0:01:39
116500 -- (-540.569) (-536.430) (-535.967) [-536.634] * (-534.845) (-541.862) [-536.305] (-538.883) -- 0:01:38
117000 -- (-537.332) [-534.566] (-533.979) (-536.647) * [-538.678] (-537.598) (-539.235) (-536.983) -- 0:01:38
117500 -- (-538.544) [-532.196] (-536.758) (-541.160) * (-538.363) [-535.008] (-544.477) (-538.231) -- 0:01:37
118000 -- [-536.660] (-538.479) (-538.495) (-536.819) * (-536.223) [-533.656] (-540.685) (-538.774) -- 0:01:44
118500 -- [-533.369] (-531.187) (-536.207) (-543.424) * (-539.564) (-534.441) (-546.480) [-535.521] -- 0:01:44
119000 -- [-534.531] (-537.651) (-533.843) (-547.053) * (-537.619) (-535.632) (-543.606) [-540.597] -- 0:01:43
119500 -- (-539.723) (-541.482) (-540.903) [-545.080] * (-535.781) (-536.654) (-541.446) [-537.683] -- 0:01:43
120000 -- [-548.026] (-544.381) (-535.657) (-540.463) * [-531.322] (-539.644) (-539.036) (-536.072) -- 0:01:42
Average standard deviation of split frequencies: 0.018231
120500 -- (-536.712) (-539.208) [-533.573] (-535.298) * (-534.689) [-534.298] (-533.802) (-535.908) -- 0:01:42
121000 -- [-536.387] (-543.650) (-536.720) (-542.362) * (-531.627) [-537.668] (-538.788) (-542.460) -- 0:01:41
121500 -- (-537.142) (-540.045) [-535.683] (-535.705) * [-531.384] (-533.296) (-540.396) (-541.293) -- 0:01:41
122000 -- (-535.619) (-532.353) [-535.534] (-534.285) * [-533.792] (-534.959) (-535.110) (-535.030) -- 0:01:40
122500 -- (-539.948) (-540.542) [-538.526] (-536.670) * [-538.945] (-541.730) (-533.881) (-539.548) -- 0:01:40
123000 -- (-534.487) (-540.482) (-534.550) [-533.256] * [-532.708] (-536.080) (-533.549) (-536.380) -- 0:01:39
123500 -- (-536.228) (-543.900) (-535.214) [-531.073] * [-530.967] (-534.951) (-532.556) (-537.326) -- 0:01:39
124000 -- (-535.377) (-541.862) [-537.569] (-534.870) * (-538.519) (-535.153) (-533.826) [-533.519] -- 0:01:38
124500 -- (-541.336) (-541.244) (-538.331) [-536.348] * (-535.438) [-536.682] (-540.485) (-541.702) -- 0:01:38
125000 -- (-532.824) (-539.160) [-535.205] (-534.759) * [-534.468] (-536.648) (-534.691) (-538.730) -- 0:01:38
Average standard deviation of split frequencies: 0.019954
125500 -- (-535.315) (-544.162) (-535.668) [-535.394] * [-534.844] (-537.997) (-539.894) (-538.526) -- 0:01:37
126000 -- [-535.713] (-544.137) (-536.924) (-538.649) * [-530.263] (-535.514) (-543.563) (-534.090) -- 0:01:37
126500 -- (-533.561) (-547.791) (-538.500) [-539.676] * [-532.017] (-533.289) (-536.399) (-543.119) -- 0:01:36
127000 -- [-535.068] (-535.740) (-538.096) (-536.328) * (-536.268) (-530.630) (-535.546) [-535.091] -- 0:01:43
127500 -- (-540.125) (-534.969) (-537.267) [-533.430] * [-536.021] (-534.225) (-534.787) (-546.429) -- 0:01:42
128000 -- (-547.541) (-534.744) (-537.161) [-535.724] * (-534.530) (-533.887) [-535.475] (-537.532) -- 0:01:42
128500 -- (-542.240) (-536.946) (-538.311) [-535.538] * (-535.643) [-537.727] (-534.797) (-538.555) -- 0:01:41
129000 -- (-539.156) [-535.921] (-539.469) (-538.147) * (-537.678) (-538.001) (-536.199) [-534.502] -- 0:01:41
129500 -- (-538.324) (-536.694) [-535.901] (-539.323) * (-535.669) (-539.846) [-538.592] (-539.244) -- 0:01:40
130000 -- (-538.331) [-536.678] (-536.384) (-534.548) * [-532.888] (-537.769) (-535.336) (-535.189) -- 0:01:40
Average standard deviation of split frequencies: 0.012026
130500 -- (-536.364) (-539.840) (-538.723) [-533.643] * (-535.755) [-535.648] (-534.200) (-531.321) -- 0:01:39
131000 -- (-544.743) (-538.387) (-539.127) [-531.688] * (-533.366) (-533.551) (-532.241) [-531.325] -- 0:01:39
131500 -- (-536.172) (-537.769) (-537.271) [-533.743] * [-533.652] (-532.975) (-533.088) (-533.095) -- 0:01:39
132000 -- [-534.822] (-541.874) (-535.681) (-538.475) * (-536.334) (-536.862) (-534.495) [-534.099] -- 0:01:38
132500 -- (-534.287) [-534.273] (-540.667) (-536.268) * (-532.742) [-533.144] (-538.893) (-533.304) -- 0:01:38
133000 -- (-534.738) (-535.899) (-537.514) [-537.311] * (-538.132) [-538.627] (-535.221) (-538.384) -- 0:01:37
133500 -- [-537.084] (-540.206) (-532.045) (-538.398) * (-541.264) (-537.814) [-533.264] (-535.496) -- 0:01:37
134000 -- (-540.952) (-541.918) (-536.541) [-535.173] * (-534.236) (-532.340) [-534.283] (-536.677) -- 0:01:36
134500 -- (-534.963) [-539.931] (-533.429) (-532.819) * [-538.143] (-537.733) (-533.735) (-533.927) -- 0:01:36
135000 -- [-534.518] (-542.714) (-534.829) (-535.528) * (-534.382) (-538.454) (-534.139) [-532.854] -- 0:01:36
Average standard deviation of split frequencies: 0.011554
135500 -- (-534.950) [-538.369] (-536.090) (-534.879) * (-536.207) (-540.081) [-534.779] (-539.123) -- 0:01:35
136000 -- [-532.885] (-539.419) (-533.275) (-539.854) * (-533.167) (-538.461) (-537.334) [-534.759] -- 0:01:41
136500 -- (-537.791) (-541.962) [-534.369] (-533.563) * [-533.493] (-540.007) (-535.752) (-536.081) -- 0:01:41
137000 -- (-539.048) [-533.748] (-532.729) (-533.633) * (-537.427) [-540.038] (-533.273) (-534.994) -- 0:01:40
137500 -- [-534.012] (-532.871) (-537.800) (-537.994) * [-535.346] (-536.476) (-535.789) (-546.529) -- 0:01:40
138000 -- [-531.693] (-540.001) (-535.633) (-541.563) * (-536.569) (-534.416) [-538.414] (-534.989) -- 0:01:39
138500 -- (-531.978) (-538.467) [-532.522] (-534.645) * (-541.103) (-533.808) (-536.781) [-535.840] -- 0:01:39
139000 -- [-536.492] (-538.235) (-536.302) (-536.309) * (-535.028) (-538.083) (-534.817) [-538.327] -- 0:01:39
139500 -- (-534.348) (-531.376) [-541.657] (-538.015) * (-535.778) (-531.372) [-530.392] (-535.034) -- 0:01:38
140000 -- [-534.134] (-535.375) (-537.223) (-537.666) * (-533.825) (-535.336) [-532.328] (-537.206) -- 0:01:38
Average standard deviation of split frequencies: 0.015639
140500 -- [-536.098] (-532.415) (-535.033) (-538.121) * (-534.458) (-533.157) [-534.625] (-533.790) -- 0:01:37
141000 -- (-538.099) (-535.014) (-542.213) [-536.498] * (-534.424) (-532.037) (-532.184) [-538.046] -- 0:01:37
141500 -- (-537.090) (-537.921) (-543.922) [-539.118] * (-538.857) [-535.674] (-534.570) (-537.510) -- 0:01:37
142000 -- [-532.973] (-545.840) (-539.874) (-535.162) * [-536.888] (-538.377) (-537.071) (-536.377) -- 0:01:36
142500 -- [-533.945] (-539.229) (-538.713) (-540.741) * (-537.010) (-534.873) [-535.202] (-542.968) -- 0:01:36
143000 -- (-535.953) [-538.714] (-532.212) (-544.766) * (-533.010) (-533.499) [-539.395] (-533.416) -- 0:01:35
143500 -- [-536.383] (-532.900) (-536.868) (-536.262) * (-537.492) (-537.966) [-535.456] (-541.166) -- 0:01:35
144000 -- (-541.478) [-535.350] (-536.869) (-540.030) * (-535.409) (-535.313) [-535.833] (-540.382) -- 0:01:35
144500 -- (-536.105) (-537.186) (-536.327) [-539.965] * (-537.032) (-533.772) [-540.291] (-537.965) -- 0:01:34
145000 -- (-543.459) (-538.159) (-539.595) [-536.723] * [-538.340] (-531.749) (-535.663) (-538.850) -- 0:01:40
Average standard deviation of split frequencies: 0.017220
145500 -- (-541.003) (-535.415) (-539.101) [-533.745] * (-538.607) (-530.659) (-539.953) [-535.205] -- 0:01:39
146000 -- (-536.936) (-537.620) (-537.004) [-535.443] * [-537.349] (-532.773) (-539.269) (-538.146) -- 0:01:39
146500 -- (-539.680) (-533.797) (-534.980) [-535.681] * (-534.764) (-539.029) [-539.276] (-542.581) -- 0:01:39
147000 -- (-537.907) [-533.458] (-535.896) (-534.699) * [-539.673] (-540.141) (-536.331) (-539.058) -- 0:01:38
147500 -- [-537.304] (-537.266) (-536.313) (-530.802) * (-541.679) [-539.269] (-534.705) (-542.852) -- 0:01:38
148000 -- (-536.255) [-534.623] (-538.003) (-536.925) * (-537.288) [-534.813] (-534.820) (-534.773) -- 0:01:37
148500 -- (-538.000) (-536.597) [-539.451] (-532.802) * (-533.786) [-535.150] (-543.011) (-536.897) -- 0:01:37
149000 -- (-536.445) [-534.119] (-539.084) (-533.505) * (-535.592) [-533.809] (-540.013) (-533.537) -- 0:01:37
149500 -- (-538.285) [-535.242] (-540.920) (-535.169) * (-543.228) (-535.648) [-539.712] (-541.483) -- 0:01:36
150000 -- (-540.594) (-531.557) [-535.273] (-537.569) * (-540.626) [-536.187] (-534.205) (-536.868) -- 0:01:36
Average standard deviation of split frequencies: 0.014601
150500 -- (-538.719) (-531.940) (-546.515) [-538.236] * (-540.035) [-532.840] (-536.420) (-538.803) -- 0:01:35
151000 -- [-537.902] (-534.889) (-542.034) (-539.705) * (-536.317) [-540.290] (-540.557) (-533.656) -- 0:01:35
151500 -- (-534.861) (-536.294) (-540.517) [-535.469] * (-542.451) [-533.730] (-536.621) (-533.063) -- 0:01:35
152000 -- (-534.595) (-545.336) [-538.342] (-540.436) * (-544.114) [-535.825] (-536.598) (-535.289) -- 0:01:34
152500 -- [-540.694] (-536.356) (-535.835) (-536.624) * (-542.394) [-536.066] (-541.890) (-536.060) -- 0:01:34
153000 -- (-531.907) (-535.944) (-539.571) [-537.175] * (-535.785) (-538.396) [-530.759] (-539.393) -- 0:01:34
153500 -- [-534.426] (-535.558) (-539.261) (-538.041) * (-540.261) (-535.933) [-536.577] (-535.395) -- 0:01:33
154000 -- (-543.117) (-533.345) [-540.627] (-536.575) * (-539.246) (-534.712) (-533.365) [-535.617] -- 0:01:38
154500 -- (-539.031) [-535.586] (-542.460) (-535.095) * (-540.343) [-541.006] (-536.051) (-536.217) -- 0:01:38
155000 -- (-535.388) [-538.822] (-535.850) (-537.338) * (-538.946) [-532.746] (-541.468) (-535.886) -- 0:01:38
Average standard deviation of split frequencies: 0.008058
155500 -- (-537.494) (-533.681) (-535.225) [-540.203] * (-537.453) [-534.541] (-534.242) (-537.071) -- 0:01:37
156000 -- [-533.659] (-540.630) (-537.660) (-535.825) * (-546.992) (-537.926) (-536.085) [-536.040] -- 0:01:37
156500 -- (-530.875) (-534.447) [-536.576] (-537.589) * (-537.852) (-537.908) [-533.148] (-536.248) -- 0:01:37
157000 -- (-533.941) (-538.067) (-533.749) [-537.918] * (-535.566) (-535.458) (-534.958) [-535.530] -- 0:01:36
157500 -- (-538.957) (-537.919) (-532.013) [-535.116] * (-540.812) [-534.193] (-533.711) (-532.472) -- 0:01:36
158000 -- (-535.610) (-542.250) [-534.486] (-537.845) * (-539.202) (-538.669) (-535.335) [-533.486] -- 0:01:35
158500 -- (-533.664) (-544.719) (-540.644) [-534.423] * (-542.799) (-534.844) (-540.944) [-535.701] -- 0:01:35
159000 -- (-534.112) (-539.657) [-533.082] (-534.266) * (-540.920) [-538.115] (-540.585) (-535.333) -- 0:01:35
159500 -- (-535.894) (-534.369) (-532.584) [-533.322] * (-541.382) (-536.862) [-536.928] (-536.988) -- 0:01:34
160000 -- (-539.179) (-537.283) [-532.126] (-538.531) * (-536.331) [-536.495] (-536.933) (-538.530) -- 0:01:34
Average standard deviation of split frequencies: 0.011736
160500 -- (-534.314) [-534.992] (-534.751) (-535.005) * [-538.159] (-539.729) (-538.311) (-535.912) -- 0:01:34
161000 -- [-535.365] (-535.063) (-535.312) (-541.085) * (-534.363) (-542.629) [-537.792] (-535.792) -- 0:01:33
161500 -- (-533.635) (-540.695) (-538.368) [-535.145] * (-541.289) [-540.748] (-545.823) (-534.933) -- 0:01:33
162000 -- (-533.358) (-536.964) (-540.721) [-534.173] * [-537.594] (-538.587) (-536.416) (-537.111) -- 0:01:33
162500 -- (-534.137) (-533.136) (-537.964) [-537.896] * [-532.862] (-537.689) (-542.543) (-536.781) -- 0:01:32
163000 -- [-537.420] (-534.985) (-539.462) (-539.254) * (-533.253) [-539.371] (-533.773) (-533.366) -- 0:01:37
163500 -- (-539.507) (-540.448) (-535.498) [-532.809] * (-535.643) [-537.217] (-537.863) (-533.760) -- 0:01:37
164000 -- [-532.162] (-534.786) (-538.140) (-540.799) * (-538.313) (-536.349) [-533.656] (-540.266) -- 0:01:36
164500 -- (-531.482) (-539.085) (-538.395) [-530.273] * (-533.697) (-540.005) [-533.532] (-536.788) -- 0:01:36
165000 -- [-531.786] (-541.396) (-540.293) (-533.924) * (-534.232) [-536.747] (-532.786) (-534.369) -- 0:01:36
Average standard deviation of split frequencies: 0.007573
165500 -- (-534.992) [-536.081] (-540.846) (-535.940) * (-538.185) (-536.686) (-538.744) [-535.524] -- 0:01:35
166000 -- (-535.685) (-537.173) [-535.555] (-533.135) * (-536.447) (-537.638) (-537.806) [-540.189] -- 0:01:35
166500 -- (-537.680) [-534.132] (-536.070) (-536.726) * (-533.511) (-543.159) (-535.715) [-533.773] -- 0:01:35
167000 -- [-537.302] (-537.914) (-533.040) (-539.776) * (-535.706) [-541.946] (-538.771) (-529.870) -- 0:01:34
167500 -- (-539.745) (-535.103) [-534.534] (-536.037) * (-537.934) (-539.156) [-537.444] (-532.522) -- 0:01:34
168000 -- [-539.993] (-536.385) (-538.429) (-535.300) * [-533.078] (-535.041) (-539.643) (-535.279) -- 0:01:34
168500 -- (-541.728) (-540.401) (-534.294) [-532.010] * (-538.424) (-537.442) (-535.628) [-534.140] -- 0:01:33
169000 -- (-535.972) (-538.207) (-539.481) [-533.968] * (-539.186) (-533.790) [-532.757] (-548.142) -- 0:01:33
169500 -- [-535.643] (-538.821) (-536.851) (-532.765) * (-536.695) [-535.195] (-535.986) (-537.970) -- 0:01:33
170000 -- [-537.559] (-536.634) (-537.405) (-532.989) * (-531.198) (-533.912) [-537.028] (-541.583) -- 0:01:32
Average standard deviation of split frequencies: 0.011049
170500 -- [-540.607] (-534.526) (-531.637) (-531.804) * (-534.454) [-537.696] (-534.847) (-539.972) -- 0:01:32
171000 -- (-536.453) (-535.866) (-532.455) [-537.088] * [-535.397] (-540.922) (-532.726) (-537.761) -- 0:01:32
171500 -- [-536.077] (-536.016) (-535.226) (-540.744) * [-532.608] (-540.865) (-534.301) (-533.959) -- 0:01:31
172000 -- (-535.410) (-533.511) [-535.052] (-535.019) * (-543.324) (-540.376) (-535.743) [-538.100] -- 0:01:36
172500 -- (-532.811) (-536.892) [-536.958] (-538.454) * (-533.107) (-539.152) (-532.544) [-531.471] -- 0:01:35
173000 -- [-532.462] (-537.340) (-540.222) (-536.506) * (-539.201) (-534.926) [-536.782] (-534.928) -- 0:01:35
173500 -- [-534.615] (-532.243) (-535.515) (-536.419) * (-533.873) (-536.340) [-534.510] (-536.924) -- 0:01:35
174000 -- (-532.566) (-538.757) [-533.707] (-536.487) * (-533.807) (-538.608) (-535.866) [-533.064] -- 0:01:34
174500 -- (-537.543) (-534.904) (-541.885) [-534.086] * (-535.776) [-532.621] (-536.708) (-532.413) -- 0:01:34
175000 -- (-537.439) (-537.214) [-538.781] (-532.153) * (-540.637) (-536.249) (-535.897) [-533.608] -- 0:01:34
Average standard deviation of split frequencies: 0.007142
175500 -- [-534.660] (-543.058) (-535.455) (-536.918) * (-540.949) (-537.785) (-537.040) [-537.599] -- 0:01:33
176000 -- (-533.852) [-535.814] (-534.300) (-536.969) * [-535.685] (-546.207) (-533.593) (-539.797) -- 0:01:33
176500 -- (-535.494) (-537.396) (-535.154) [-534.629] * [-536.249] (-541.029) (-534.969) (-543.552) -- 0:01:33
177000 -- [-533.640] (-535.065) (-536.084) (-534.202) * (-539.479) (-540.295) (-538.377) [-535.816] -- 0:01:32
177500 -- (-538.135) (-532.270) (-534.351) [-533.312] * (-532.616) (-537.720) (-536.735) [-535.818] -- 0:01:32
178000 -- (-534.428) [-535.527] (-534.464) (-542.582) * (-538.692) [-541.824] (-533.749) (-541.214) -- 0:01:32
178500 -- (-541.396) (-535.553) (-535.372) [-537.345] * (-533.614) (-536.663) [-533.705] (-537.867) -- 0:01:32
179000 -- (-540.501) (-538.949) [-538.049] (-536.063) * (-533.445) (-537.298) (-532.567) [-537.689] -- 0:01:31
179500 -- (-538.394) (-546.897) [-537.235] (-537.902) * [-533.504] (-536.259) (-535.521) (-539.844) -- 0:01:31
180000 -- [-534.072] (-536.981) (-535.325) (-540.295) * (-541.322) (-536.733) [-535.755] (-542.732) -- 0:01:31
Average standard deviation of split frequencies: 0.006958
180500 -- (-534.825) (-535.378) (-535.416) [-532.638] * [-535.086] (-541.010) (-533.356) (-544.639) -- 0:01:30
181000 -- (-545.900) (-536.769) [-533.752] (-537.896) * (-533.530) (-537.906) (-537.304) [-533.751] -- 0:01:35
181500 -- (-541.752) (-535.756) [-533.192] (-539.790) * (-547.685) (-537.275) (-538.335) [-536.722] -- 0:01:34
182000 -- (-538.760) (-539.427) [-536.697] (-535.064) * (-540.678) [-535.506] (-539.065) (-534.161) -- 0:01:34
182500 -- (-537.033) (-533.812) [-534.944] (-537.000) * [-539.838] (-533.656) (-538.130) (-536.700) -- 0:01:34
183000 -- [-533.686] (-534.000) (-537.970) (-542.823) * (-538.578) (-537.251) [-535.179] (-535.168) -- 0:01:33
183500 -- [-533.187] (-536.099) (-539.293) (-545.327) * (-538.187) (-534.684) (-542.003) [-534.527] -- 0:01:33
184000 -- (-537.349) (-530.635) [-536.480] (-533.726) * (-533.510) (-535.784) (-537.943) [-534.148] -- 0:01:33
184500 -- (-537.870) (-538.967) (-539.113) [-535.146] * (-539.472) (-535.353) (-536.975) [-533.346] -- 0:01:32
185000 -- (-535.487) [-534.473] (-537.660) (-536.399) * [-533.594] (-539.464) (-539.113) (-535.750) -- 0:01:32
Average standard deviation of split frequencies: 0.008448
185500 -- (-538.289) (-532.400) (-538.644) [-533.285] * (-535.467) (-534.923) (-536.815) [-535.157] -- 0:01:32
186000 -- (-541.259) [-536.991] (-541.546) (-535.301) * (-533.675) [-535.384] (-534.876) (-533.624) -- 0:01:31
186500 -- (-540.043) [-533.051] (-537.778) (-547.268) * [-536.584] (-542.206) (-542.879) (-535.394) -- 0:01:31
187000 -- (-533.681) (-537.562) [-535.761] (-547.093) * [-534.299] (-537.352) (-534.655) (-535.864) -- 0:01:31
187500 -- [-535.702] (-541.872) (-540.783) (-535.381) * (-539.161) (-535.261) (-543.133) [-537.079] -- 0:01:31
188000 -- (-536.626) (-537.949) (-540.396) [-538.324] * [-536.814] (-534.723) (-536.774) (-540.325) -- 0:01:30
188500 -- (-546.261) [-537.923] (-535.812) (-539.564) * (-532.848) [-533.655] (-541.412) (-539.615) -- 0:01:30
189000 -- (-538.448) (-546.629) [-535.945] (-546.976) * (-541.785) [-538.351] (-540.073) (-535.216) -- 0:01:30
189500 -- [-534.378] (-537.585) (-537.103) (-543.730) * (-539.681) (-533.936) (-538.850) [-533.254] -- 0:01:29
190000 -- (-531.620) (-543.028) (-542.330) [-543.265] * (-539.579) (-539.762) [-534.656] (-532.751) -- 0:01:33
Average standard deviation of split frequencies: 0.004945
190500 -- (-532.483) [-531.660] (-531.263) (-542.287) * (-539.401) (-537.569) (-541.094) [-534.997] -- 0:01:33
191000 -- [-534.340] (-532.342) (-533.702) (-543.768) * (-538.595) (-539.122) [-541.640] (-541.834) -- 0:01:33
191500 -- (-535.472) (-537.062) [-532.851] (-546.933) * (-536.105) (-533.226) [-535.990] (-538.377) -- 0:01:32
192000 -- (-537.704) (-536.209) [-532.951] (-543.906) * [-534.979] (-533.559) (-538.275) (-537.499) -- 0:01:32
192500 -- (-537.619) (-532.729) [-539.631] (-542.375) * (-535.157) (-533.762) [-533.494] (-538.867) -- 0:01:32
193000 -- [-534.101] (-535.825) (-540.196) (-537.817) * [-537.193] (-533.601) (-533.657) (-535.275) -- 0:01:31
193500 -- (-533.358) [-534.597] (-535.550) (-533.701) * (-536.418) (-535.379) [-533.790] (-534.442) -- 0:01:31
194000 -- (-532.244) (-538.522) (-539.196) [-531.908] * (-543.275) (-538.644) [-537.695] (-536.397) -- 0:01:31
194500 -- [-536.290] (-536.593) (-536.062) (-533.146) * (-535.559) (-539.508) [-536.904] (-534.046) -- 0:01:31
195000 -- (-536.735) (-531.507) (-540.440) [-531.322] * (-544.257) [-537.753] (-536.391) (-533.201) -- 0:01:30
Average standard deviation of split frequencies: 0.008017
195500 -- (-537.789) (-534.583) (-541.592) [-535.068] * (-546.619) [-532.162] (-534.459) (-537.197) -- 0:01:30
196000 -- [-537.495] (-534.401) (-535.820) (-539.082) * (-538.582) (-534.604) (-537.429) [-533.368] -- 0:01:30
196500 -- (-535.440) (-537.077) (-540.883) [-532.357] * (-541.742) (-534.152) (-533.176) [-534.431] -- 0:01:29
197000 -- (-534.393) [-534.751] (-539.035) (-537.752) * (-535.670) (-535.543) [-534.575] (-540.043) -- 0:01:29
197500 -- (-542.367) (-536.326) [-531.991] (-533.772) * (-533.534) (-542.625) [-533.128] (-537.297) -- 0:01:29
198000 -- (-537.571) [-539.707] (-537.379) (-534.239) * [-537.915] (-536.941) (-540.758) (-535.206) -- 0:01:29
198500 -- (-534.675) (-535.924) (-539.120) [-536.173] * (-533.971) (-535.028) (-533.277) [-535.605] -- 0:01:28
199000 -- (-541.035) [-536.879] (-531.882) (-540.155) * [-533.512] (-532.944) (-533.331) (-535.639) -- 0:01:32
199500 -- (-537.552) (-535.530) (-539.766) [-536.820] * (-537.182) (-535.642) (-537.356) [-533.198] -- 0:01:32
200000 -- (-536.421) [-537.323] (-537.652) (-538.987) * (-536.853) [-537.494] (-534.979) (-540.403) -- 0:01:32
Average standard deviation of split frequencies: 0.007831
200500 -- (-532.521) (-541.047) [-538.939] (-539.461) * (-541.034) (-545.644) (-531.449) [-533.725] -- 0:01:31
201000 -- (-537.630) [-531.519] (-541.667) (-533.819) * [-543.284] (-545.299) (-539.225) (-533.770) -- 0:01:31
201500 -- (-537.689) [-533.476] (-539.899) (-538.119) * (-532.237) (-535.248) [-536.006] (-535.072) -- 0:01:31
202000 -- [-536.626] (-536.168) (-534.460) (-535.672) * (-538.536) [-533.687] (-534.036) (-534.958) -- 0:01:30
202500 -- (-538.573) [-535.998] (-536.337) (-539.585) * (-534.087) (-536.930) (-536.255) [-533.877] -- 0:01:30
203000 -- (-535.128) (-541.240) (-535.391) [-534.633] * (-541.357) (-533.644) [-534.395] (-538.409) -- 0:01:30
203500 -- [-535.676] (-536.051) (-538.942) (-535.112) * (-537.490) [-536.182] (-539.583) (-538.597) -- 0:01:30
204000 -- [-540.314] (-542.787) (-536.167) (-532.691) * (-536.714) [-536.379] (-542.378) (-536.695) -- 0:01:29
204500 -- (-542.914) (-543.528) [-530.931] (-536.142) * [-535.304] (-532.313) (-541.096) (-538.216) -- 0:01:29
205000 -- (-538.802) (-535.180) (-533.462) [-535.414] * [-535.392] (-536.957) (-544.168) (-539.005) -- 0:01:29
Average standard deviation of split frequencies: 0.009153
205500 -- (-532.085) [-533.373] (-535.881) (-535.035) * (-537.230) (-536.895) (-543.242) [-538.060] -- 0:01:28
206000 -- (-535.969) [-534.420] (-532.785) (-536.360) * (-536.667) (-534.577) [-535.319] (-540.343) -- 0:01:28
206500 -- [-534.186] (-540.152) (-541.207) (-533.405) * (-536.275) [-536.679] (-544.899) (-543.347) -- 0:01:28
207000 -- (-533.066) [-535.333] (-532.316) (-538.311) * (-535.285) (-537.497) (-538.785) [-532.518] -- 0:01:28
207500 -- (-535.380) (-537.189) [-538.817] (-533.846) * [-537.790] (-535.157) (-535.263) (-534.118) -- 0:01:27
208000 -- [-539.443] (-540.538) (-538.513) (-541.012) * (-537.168) [-532.899] (-539.604) (-535.298) -- 0:01:31
208500 -- (-532.729) (-538.716) [-533.554] (-537.509) * (-533.780) (-533.293) [-532.922] (-536.709) -- 0:01:31
209000 -- (-534.813) [-534.082] (-538.380) (-534.587) * (-537.778) [-533.944] (-538.843) (-538.599) -- 0:01:30
209500 -- (-539.704) (-533.554) (-536.170) [-534.307] * [-534.564] (-533.577) (-534.928) (-535.023) -- 0:01:30
210000 -- (-540.947) (-532.878) (-539.984) [-536.970] * (-534.921) [-536.784] (-536.013) (-544.948) -- 0:01:30
Average standard deviation of split frequencies: 0.008951
210500 -- [-534.473] (-539.709) (-536.312) (-547.999) * (-537.752) [-535.109] (-543.143) (-531.411) -- 0:01:30
211000 -- [-537.122] (-541.490) (-532.862) (-539.322) * (-538.521) (-535.369) (-535.559) [-535.183] -- 0:01:29
211500 -- (-537.253) (-541.312) (-534.591) [-536.732] * (-540.001) (-547.565) (-535.005) [-534.283] -- 0:01:29
212000 -- (-545.008) (-536.413) (-537.282) [-537.070] * (-536.068) [-533.410] (-537.849) (-540.405) -- 0:01:29
212500 -- (-538.285) [-535.312] (-536.493) (-538.314) * (-541.861) (-536.036) (-537.994) [-535.647] -- 0:01:28
213000 -- (-540.752) [-535.831] (-534.670) (-534.581) * (-538.475) (-537.117) (-542.465) [-536.451] -- 0:01:28
213500 -- (-543.076) (-535.965) [-535.266] (-534.044) * (-536.947) (-540.054) (-545.315) [-535.369] -- 0:01:28
214000 -- (-538.615) [-537.023] (-534.583) (-536.737) * (-539.569) [-533.472] (-543.171) (-541.421) -- 0:01:28
214500 -- (-535.667) (-535.760) [-535.371] (-536.197) * [-536.891] (-536.064) (-538.881) (-540.999) -- 0:01:27
215000 -- (-535.870) (-537.889) [-539.290] (-536.388) * [-537.693] (-533.800) (-535.396) (-540.230) -- 0:01:27
Average standard deviation of split frequencies: 0.011640
215500 -- (-536.723) (-537.605) [-532.757] (-538.593) * (-540.769) [-534.871] (-534.762) (-541.554) -- 0:01:27
216000 -- (-544.471) [-533.777] (-537.038) (-536.589) * (-541.949) [-539.503] (-531.205) (-538.205) -- 0:01:27
216500 -- (-537.542) [-532.040] (-538.496) (-538.680) * (-537.762) (-540.556) (-535.735) [-539.299] -- 0:01:26
217000 -- (-537.783) (-534.306) [-531.976] (-540.984) * (-541.797) [-540.787] (-537.463) (-538.539) -- 0:01:30
217500 -- (-539.672) [-535.661] (-539.664) (-536.979) * (-538.085) (-541.009) [-535.093] (-540.641) -- 0:01:29
218000 -- [-541.255] (-535.488) (-536.979) (-536.372) * [-532.153] (-537.152) (-537.723) (-535.210) -- 0:01:29
218500 -- [-535.457] (-533.932) (-543.056) (-540.293) * (-534.768) (-547.328) [-535.432] (-534.393) -- 0:01:29
219000 -- [-538.134] (-532.698) (-545.232) (-539.908) * [-533.874] (-541.156) (-540.510) (-537.386) -- 0:01:29
219500 -- [-539.863] (-537.883) (-534.354) (-535.836) * (-536.342) (-535.734) (-538.404) [-532.189] -- 0:01:28
220000 -- (-534.510) (-536.597) [-539.264] (-535.642) * (-540.003) [-535.643] (-534.813) (-540.768) -- 0:01:28
Average standard deviation of split frequencies: 0.009969
220500 -- (-540.282) (-537.745) (-537.538) [-535.994] * (-535.390) (-532.045) [-538.521] (-540.089) -- 0:01:28
221000 -- (-538.091) (-540.327) (-536.981) [-541.750] * (-534.683) (-537.628) (-536.897) [-541.916] -- 0:01:28
221500 -- [-532.044] (-539.444) (-537.979) (-544.921) * (-544.229) [-535.056] (-540.407) (-536.217) -- 0:01:27
222000 -- (-535.811) [-538.357] (-538.450) (-536.827) * [-534.850] (-538.371) (-532.614) (-535.344) -- 0:01:27
222500 -- (-533.460) (-537.970) (-534.073) [-538.615] * (-535.798) (-537.127) (-538.178) [-533.665] -- 0:01:27
223000 -- (-535.524) (-542.492) [-536.372] (-535.400) * (-534.518) [-534.323] (-535.210) (-537.542) -- 0:01:27
223500 -- (-532.358) [-535.791] (-540.216) (-536.410) * (-535.819) (-534.051) (-536.634) [-531.368] -- 0:01:26
224000 -- (-532.039) (-537.332) (-534.819) [-537.340] * (-533.529) (-535.271) [-539.497] (-539.408) -- 0:01:26
224500 -- [-534.115] (-533.844) (-536.442) (-538.164) * (-532.486) (-539.335) (-538.012) [-540.440] -- 0:01:26
225000 -- (-539.376) (-536.212) (-536.988) [-534.247] * (-531.013) (-533.997) [-536.145] (-538.934) -- 0:01:26
Average standard deviation of split frequencies: 0.009734
225500 -- (-539.173) (-537.142) [-536.872] (-534.439) * (-534.516) (-536.287) [-538.951] (-535.200) -- 0:01:25
226000 -- (-538.165) [-536.251] (-536.098) (-537.046) * [-535.236] (-536.987) (-541.010) (-541.009) -- 0:01:29
226500 -- [-533.129] (-541.384) (-536.017) (-534.953) * (-533.719) (-533.893) (-538.756) [-535.493] -- 0:01:28
227000 -- (-534.652) (-541.421) (-538.130) [-539.783] * (-545.101) (-536.777) [-534.793] (-540.415) -- 0:01:28
227500 -- [-536.245] (-545.807) (-537.407) (-539.455) * (-533.938) (-534.628) [-532.856] (-531.702) -- 0:01:28
228000 -- (-534.058) (-538.421) [-533.811] (-537.041) * (-535.811) (-534.616) [-531.024] (-535.763) -- 0:01:28
228500 -- [-536.111] (-538.142) (-537.819) (-536.912) * [-535.281] (-532.704) (-533.381) (-535.297) -- 0:01:27
229000 -- [-538.707] (-538.282) (-535.525) (-535.654) * (-540.049) (-537.146) [-533.456] (-536.077) -- 0:01:27
229500 -- (-544.916) (-539.767) [-539.782] (-533.849) * (-541.856) (-538.480) (-532.089) [-537.420] -- 0:01:27
230000 -- (-536.262) (-542.790) (-536.410) [-532.188] * [-546.309] (-542.929) (-536.559) (-533.850) -- 0:01:27
Average standard deviation of split frequencies: 0.013624
230500 -- (-537.680) (-542.362) [-531.808] (-537.249) * (-538.646) (-535.812) [-532.256] (-535.495) -- 0:01:26
231000 -- (-542.745) (-537.286) [-537.336] (-537.474) * (-540.607) [-538.058] (-535.786) (-541.212) -- 0:01:26
231500 -- (-534.100) (-537.930) [-533.259] (-535.724) * [-536.021] (-537.086) (-531.369) (-540.049) -- 0:01:26
232000 -- (-553.490) [-539.381] (-531.873) (-540.433) * [-533.637] (-538.956) (-532.929) (-545.707) -- 0:01:26
232500 -- [-539.746] (-533.453) (-543.405) (-535.129) * (-537.305) [-539.084] (-540.292) (-540.104) -- 0:01:25
233000 -- (-536.190) [-537.014] (-534.632) (-535.281) * (-536.374) (-531.687) (-533.387) [-540.684] -- 0:01:25
233500 -- [-534.758] (-534.818) (-533.665) (-538.840) * (-535.444) (-534.223) (-539.312) [-539.119] -- 0:01:25
234000 -- (-537.602) (-534.583) [-534.811] (-537.649) * [-537.078] (-532.602) (-538.021) (-537.947) -- 0:01:25
234500 -- (-537.787) (-535.534) (-539.909) [-535.216] * (-537.919) (-536.471) [-532.167] (-538.212) -- 0:01:24
235000 -- [-538.274] (-539.926) (-542.179) (-537.383) * [-535.501] (-533.841) (-535.086) (-539.262) -- 0:01:27
Average standard deviation of split frequencies: 0.010653
235500 -- [-538.322] (-534.832) (-538.916) (-535.344) * (-539.792) [-538.191] (-532.447) (-533.208) -- 0:01:27
236000 -- [-533.897] (-545.173) (-534.831) (-540.045) * (-541.897) [-535.057] (-535.398) (-535.015) -- 0:01:27
236500 -- (-536.011) [-534.933] (-537.542) (-535.175) * (-535.740) [-531.351] (-535.061) (-535.928) -- 0:01:27
237000 -- (-533.939) [-535.986] (-538.888) (-533.688) * (-534.875) (-538.265) (-535.090) [-540.496] -- 0:01:26
237500 -- (-535.636) (-534.321) (-537.070) [-534.745] * [-536.470] (-536.309) (-538.560) (-535.866) -- 0:01:26
238000 -- (-535.592) (-532.346) (-534.075) [-537.087] * [-535.126] (-538.708) (-535.982) (-539.177) -- 0:01:26
238500 -- [-533.259] (-539.275) (-540.218) (-543.081) * (-539.568) (-531.452) [-532.877] (-536.230) -- 0:01:26
239000 -- (-533.955) [-538.465] (-537.666) (-534.551) * (-536.902) [-535.871] (-534.785) (-532.731) -- 0:01:25
239500 -- (-534.437) (-536.906) (-540.368) [-532.913] * (-539.570) [-536.639] (-535.880) (-538.275) -- 0:01:25
240000 -- [-537.838] (-539.191) (-536.079) (-535.765) * (-537.920) [-542.206] (-543.358) (-535.670) -- 0:01:25
Average standard deviation of split frequencies: 0.010447
240500 -- (-535.649) (-546.016) [-533.943] (-536.095) * [-534.552] (-536.110) (-548.701) (-534.071) -- 0:01:25
241000 -- [-537.716] (-545.042) (-533.889) (-536.342) * (-537.346) (-533.447) (-534.115) [-532.015] -- 0:01:25
241500 -- (-540.777) (-539.833) (-533.658) [-536.400] * [-534.575] (-537.474) (-532.332) (-534.664) -- 0:01:24
242000 -- (-537.385) [-537.069] (-535.180) (-537.468) * (-533.711) (-533.806) (-531.638) [-536.764] -- 0:01:24
242500 -- (-537.342) [-535.178] (-538.300) (-538.573) * (-534.848) (-534.932) [-534.726] (-541.666) -- 0:01:24
243000 -- [-537.156] (-537.197) (-539.989) (-542.886) * (-534.157) (-538.004) (-535.796) [-534.782] -- 0:01:24
243500 -- (-533.139) (-534.978) (-535.918) [-541.181] * (-532.845) (-535.038) [-531.826] (-539.334) -- 0:01:23
244000 -- [-532.644] (-534.396) (-536.484) (-542.511) * [-531.918] (-533.773) (-533.740) (-538.391) -- 0:01:26
244500 -- (-536.187) (-535.541) (-542.025) [-542.998] * (-533.555) (-538.557) (-531.914) [-534.716] -- 0:01:26
245000 -- [-543.223] (-536.878) (-543.383) (-546.292) * [-536.586] (-534.308) (-542.537) (-534.505) -- 0:01:26
Average standard deviation of split frequencies: 0.010220
245500 -- (-536.691) (-538.628) (-538.687) [-538.970] * (-534.725) (-531.322) (-537.996) [-539.381] -- 0:01:26
246000 -- (-536.086) [-541.946] (-537.505) (-536.052) * (-531.387) (-535.383) (-534.053) [-534.310] -- 0:01:25
246500 -- (-536.249) (-539.452) [-535.947] (-537.353) * (-535.670) (-535.254) (-532.891) [-533.072] -- 0:01:25
247000 -- (-535.864) (-536.775) [-536.648] (-548.173) * (-538.677) (-536.077) [-534.016] (-538.039) -- 0:01:25
247500 -- [-536.908] (-542.188) (-533.428) (-544.256) * (-534.962) [-541.658] (-539.378) (-541.952) -- 0:01:25
248000 -- [-538.212] (-538.751) (-537.901) (-541.393) * [-533.881] (-536.680) (-544.826) (-533.640) -- 0:01:24
248500 -- [-535.058] (-536.147) (-534.761) (-549.016) * (-536.019) (-543.474) [-535.012] (-536.892) -- 0:01:24
249000 -- [-539.729] (-531.617) (-537.762) (-542.173) * (-535.736) [-538.085] (-543.609) (-537.532) -- 0:01:24
249500 -- (-535.445) [-532.529] (-535.140) (-543.063) * (-536.368) (-548.414) (-537.207) [-539.131] -- 0:01:24
250000 -- (-534.984) (-532.932) [-535.766] (-537.829) * (-537.913) (-542.222) (-535.186) [-539.106] -- 0:01:24
Average standard deviation of split frequencies: 0.012537
250500 -- (-533.564) [-538.662] (-535.044) (-540.746) * (-536.768) (-538.856) [-537.684] (-535.109) -- 0:01:23
251000 -- [-532.758] (-539.034) (-535.946) (-543.003) * (-540.907) [-538.832] (-537.008) (-533.789) -- 0:01:23
251500 -- [-532.821] (-534.350) (-537.805) (-542.611) * [-538.354] (-538.217) (-539.045) (-532.414) -- 0:01:23
252000 -- (-533.618) [-532.982] (-537.885) (-537.205) * [-532.709] (-539.860) (-535.195) (-540.274) -- 0:01:23
252500 -- (-541.477) [-535.642] (-548.191) (-538.073) * [-533.908] (-535.345) (-539.585) (-541.414) -- 0:01:25
253000 -- [-534.069] (-537.215) (-545.707) (-541.850) * [-536.536] (-536.321) (-536.356) (-533.282) -- 0:01:25
253500 -- (-534.844) [-542.241] (-538.865) (-538.842) * [-531.408] (-538.126) (-532.018) (-533.789) -- 0:01:25
254000 -- (-536.019) (-542.136) (-544.892) [-536.398] * [-535.296] (-546.045) (-533.264) (-533.520) -- 0:01:25
254500 -- (-531.682) (-535.189) (-536.895) [-534.414] * (-535.852) [-540.663] (-532.739) (-533.865) -- 0:01:24
255000 -- (-539.116) (-536.390) [-538.635] (-540.153) * (-533.104) (-543.850) (-538.824) [-532.304] -- 0:01:24
Average standard deviation of split frequencies: 0.012276
255500 -- (-539.504) (-534.702) [-535.182] (-540.741) * [-535.939] (-535.594) (-539.716) (-537.133) -- 0:01:24
256000 -- (-539.404) [-535.311] (-534.958) (-541.062) * [-538.267] (-538.949) (-535.925) (-538.538) -- 0:01:24
256500 -- (-540.138) (-538.496) (-533.847) [-540.092] * (-533.936) (-535.745) (-536.430) [-537.369] -- 0:01:24
257000 -- (-538.485) (-533.821) (-532.849) [-538.093] * (-537.776) [-535.134] (-541.712) (-540.654) -- 0:01:23
257500 -- (-535.777) (-534.619) [-533.245] (-538.326) * [-533.888] (-536.009) (-542.477) (-539.730) -- 0:01:23
258000 -- (-542.752) (-534.935) [-533.170] (-539.191) * [-537.344] (-534.076) (-542.670) (-538.337) -- 0:01:23
258500 -- (-539.683) [-536.596] (-543.901) (-537.436) * (-539.322) (-539.510) (-541.947) [-534.950] -- 0:01:23
259000 -- (-537.199) [-535.418] (-536.003) (-533.876) * (-539.883) (-542.055) [-536.194] (-535.687) -- 0:01:22
259500 -- [-533.168] (-535.165) (-537.991) (-540.606) * (-536.444) (-538.866) (-537.402) [-533.870] -- 0:01:22
260000 -- [-538.076] (-534.677) (-537.524) (-535.372) * (-538.540) (-546.650) [-533.782] (-536.039) -- 0:01:22
Average standard deviation of split frequencies: 0.010851
260500 -- [-536.617] (-534.255) (-533.597) (-535.318) * (-537.240) (-543.754) [-530.937] (-534.656) -- 0:01:22
261000 -- (-537.955) (-537.328) [-534.065] (-535.670) * (-538.660) (-543.586) [-535.924] (-537.688) -- 0:01:22
261500 -- [-533.224] (-533.549) (-535.457) (-534.624) * [-535.218] (-537.928) (-535.666) (-535.191) -- 0:01:21
262000 -- (-535.196) [-532.898] (-535.837) (-532.592) * [-537.367] (-534.581) (-534.355) (-540.216) -- 0:01:24
262500 -- (-536.190) (-534.957) (-538.300) [-542.749] * (-534.268) [-530.581] (-533.482) (-541.125) -- 0:01:24
263000 -- (-534.332) [-537.294] (-538.623) (-537.264) * (-538.435) (-534.575) (-534.707) [-536.778] -- 0:01:24
263500 -- (-533.600) (-536.152) (-539.299) [-535.649] * [-532.514] (-535.314) (-532.719) (-540.193) -- 0:01:23
264000 -- (-535.959) (-535.746) (-532.751) [-536.786] * [-534.319] (-533.557) (-538.107) (-534.868) -- 0:01:23
264500 -- (-537.480) (-540.957) [-533.786] (-533.365) * (-534.836) (-538.682) (-535.033) [-538.083] -- 0:01:23
265000 -- [-535.587] (-532.651) (-535.954) (-539.475) * [-535.288] (-534.181) (-540.397) (-543.384) -- 0:01:23
Average standard deviation of split frequencies: 0.011815
265500 -- (-535.361) (-536.929) [-537.926] (-534.679) * (-539.114) [-533.228] (-537.544) (-543.148) -- 0:01:22
266000 -- (-541.578) [-532.399] (-538.094) (-533.958) * (-534.712) (-539.004) (-538.789) [-538.439] -- 0:01:22
266500 -- (-541.381) (-534.742) (-541.816) [-534.184] * (-540.426) [-533.839] (-543.294) (-538.983) -- 0:01:22
267000 -- (-548.327) (-534.529) (-537.034) [-536.630] * (-540.317) (-533.864) (-538.458) [-534.517] -- 0:01:22
267500 -- (-541.235) [-532.133] (-534.461) (-534.711) * (-537.325) [-535.940] (-544.366) (-533.955) -- 0:01:22
268000 -- (-536.336) [-535.465] (-537.605) (-537.091) * (-537.642) (-535.467) (-536.306) [-536.720] -- 0:01:21
268500 -- (-540.696) (-534.787) (-537.029) [-533.948] * (-538.421) [-542.014] (-536.533) (-538.119) -- 0:01:21
269000 -- (-540.858) (-534.966) [-537.345] (-534.724) * [-531.411] (-537.983) (-535.706) (-532.638) -- 0:01:21
269500 -- [-534.201] (-535.410) (-536.801) (-532.059) * [-541.197] (-532.440) (-534.267) (-530.755) -- 0:01:21
270000 -- (-536.468) [-536.070] (-536.922) (-532.106) * (-540.004) (-532.582) [-532.822] (-535.657) -- 0:01:21
Average standard deviation of split frequencies: 0.010450
270500 -- [-535.060] (-535.467) (-535.808) (-534.184) * (-537.484) [-538.958] (-540.329) (-546.748) -- 0:01:20
271000 -- (-535.863) (-535.109) [-537.037] (-536.561) * (-534.823) (-532.842) [-535.187] (-539.707) -- 0:01:23
271500 -- [-534.630] (-539.120) (-538.754) (-535.637) * (-538.252) (-532.629) [-532.942] (-539.937) -- 0:01:23
272000 -- [-534.099] (-543.536) (-540.203) (-538.563) * (-535.781) [-535.013] (-534.108) (-540.900) -- 0:01:22
272500 -- (-537.389) [-542.074] (-540.378) (-542.118) * (-537.560) (-535.083) [-539.098] (-537.569) -- 0:01:22
273000 -- (-530.902) (-533.094) [-536.848] (-540.037) * (-538.705) [-531.679] (-533.460) (-535.094) -- 0:01:22
273500 -- (-534.245) [-537.319] (-537.297) (-538.723) * (-539.404) [-535.313] (-533.695) (-536.660) -- 0:01:22
274000 -- [-536.333] (-539.147) (-536.417) (-543.669) * (-538.630) (-537.489) [-534.299] (-539.396) -- 0:01:22
274500 -- (-533.983) (-536.261) [-535.856] (-536.706) * [-534.921] (-540.781) (-533.931) (-539.026) -- 0:01:21
275000 -- [-535.333] (-542.699) (-533.018) (-538.442) * (-539.107) (-544.212) [-530.306] (-538.705) -- 0:01:21
Average standard deviation of split frequencies: 0.013664
275500 -- (-533.304) [-544.777] (-538.603) (-541.547) * (-537.602) (-538.890) [-531.189] (-537.511) -- 0:01:21
276000 -- [-535.285] (-534.550) (-533.490) (-535.103) * (-536.837) [-536.778] (-538.015) (-539.565) -- 0:01:21
276500 -- (-534.545) (-539.788) [-538.580] (-535.692) * (-536.938) [-535.600] (-534.210) (-533.855) -- 0:01:21
277000 -- (-532.568) [-536.967] (-537.499) (-539.938) * (-535.525) (-535.765) (-534.262) [-534.421] -- 0:01:20
277500 -- (-533.955) (-547.224) (-535.005) [-536.171] * [-534.954] (-542.335) (-535.149) (-535.429) -- 0:01:20
278000 -- (-529.979) (-544.607) (-537.336) [-538.034] * (-536.927) (-532.178) (-535.262) [-533.013] -- 0:01:20
278500 -- (-531.397) (-536.800) [-539.297] (-538.877) * (-537.545) [-533.258] (-535.529) (-534.647) -- 0:01:20
279000 -- (-536.611) (-545.188) (-537.444) [-537.063] * (-534.266) (-534.793) [-536.179] (-540.594) -- 0:01:20
279500 -- (-532.122) (-545.173) (-534.937) [-536.775] * (-536.031) [-530.788] (-541.836) (-540.043) -- 0:01:19
280000 -- (-539.904) (-538.329) [-532.254] (-530.948) * [-538.596] (-536.693) (-535.693) (-537.304) -- 0:01:22
Average standard deviation of split frequencies: 0.016796
280500 -- (-532.709) (-540.447) [-531.904] (-536.743) * (-534.115) [-532.742] (-534.928) (-539.623) -- 0:01:22
281000 -- (-532.761) (-535.880) [-534.754] (-537.193) * (-535.857) (-535.041) (-535.444) [-545.542] -- 0:01:21
281500 -- [-537.317] (-536.751) (-534.702) (-534.122) * [-531.626] (-535.758) (-538.901) (-535.282) -- 0:01:21
282000 -- (-540.544) (-535.970) (-536.484) [-535.666] * [-532.306] (-539.593) (-535.239) (-533.509) -- 0:01:21
282500 -- (-538.488) [-535.350] (-535.507) (-538.134) * (-538.165) [-536.709] (-536.661) (-533.756) -- 0:01:21
283000 -- (-533.678) (-534.183) [-532.523] (-534.535) * [-536.202] (-534.812) (-538.179) (-534.812) -- 0:01:21
283500 -- (-542.543) (-540.204) [-531.135] (-536.704) * (-541.255) (-536.697) (-534.761) [-540.727] -- 0:01:20
284000 -- [-536.217] (-534.605) (-533.849) (-532.512) * (-536.737) [-540.434] (-531.951) (-538.701) -- 0:01:20
284500 -- (-536.067) (-535.646) (-541.217) [-537.990] * (-535.506) (-533.985) (-540.581) [-533.670] -- 0:01:20
285000 -- (-539.771) (-536.451) [-532.434] (-538.224) * (-538.111) (-535.856) (-534.454) [-535.767] -- 0:01:20
Average standard deviation of split frequencies: 0.015384
285500 -- (-539.771) (-535.928) (-536.382) [-537.323] * [-533.008] (-540.616) (-541.725) (-536.034) -- 0:01:20
286000 -- (-539.217) [-536.658] (-535.991) (-534.028) * (-535.224) (-535.905) (-542.647) [-537.732] -- 0:01:19
286500 -- [-535.544] (-535.614) (-537.614) (-539.543) * (-534.274) [-537.348] (-542.336) (-545.803) -- 0:01:19
287000 -- [-534.808] (-532.088) (-540.582) (-534.385) * [-532.379] (-538.455) (-535.829) (-538.307) -- 0:01:19
287500 -- (-535.493) (-532.071) [-534.817] (-541.374) * [-533.835] (-539.430) (-535.434) (-539.425) -- 0:01:19
288000 -- [-538.406] (-536.353) (-532.628) (-543.770) * (-536.211) (-542.226) (-536.294) [-533.306] -- 0:01:19
288500 -- (-533.583) [-540.365] (-545.653) (-536.868) * (-536.804) (-541.610) [-540.418] (-537.138) -- 0:01:18
289000 -- (-537.042) (-533.901) [-534.755] (-536.483) * (-534.600) (-538.210) [-537.126] (-537.643) -- 0:01:21
289500 -- (-538.701) [-534.607] (-532.961) (-541.133) * (-533.505) (-542.922) [-532.877] (-534.759) -- 0:01:20
290000 -- [-534.983] (-534.340) (-534.168) (-537.204) * (-532.063) (-539.694) (-533.289) [-533.907] -- 0:01:20
Average standard deviation of split frequencies: 0.015137
290500 -- [-537.340] (-538.369) (-534.501) (-537.056) * (-532.831) (-537.569) (-533.641) [-539.302] -- 0:01:20
291000 -- (-538.927) (-537.789) [-536.105] (-537.880) * (-535.287) (-534.736) (-535.275) [-535.183] -- 0:01:20
291500 -- (-537.098) (-535.314) [-531.592] (-538.948) * (-536.421) [-536.658] (-537.892) (-533.795) -- 0:01:20
292000 -- (-534.334) (-537.431) (-532.942) [-537.439] * (-537.186) (-534.544) [-533.981] (-540.308) -- 0:01:20
292500 -- [-532.385] (-536.862) (-533.834) (-540.453) * (-534.716) (-540.111) (-531.883) [-533.290] -- 0:01:19
293000 -- (-534.012) [-531.624] (-535.644) (-540.861) * (-539.298) (-533.875) [-532.422] (-538.424) -- 0:01:19
293500 -- (-534.855) [-535.524] (-537.952) (-533.429) * (-544.148) (-538.590) (-534.942) [-532.989] -- 0:01:19
294000 -- (-538.089) (-532.079) [-533.532] (-540.102) * (-540.354) (-534.782) (-533.835) [-538.298] -- 0:01:19
294500 -- (-533.962) [-538.386] (-540.148) (-536.054) * (-540.613) (-536.172) (-535.436) [-533.159] -- 0:01:19
295000 -- (-534.162) (-540.753) [-533.158] (-534.395) * [-539.332] (-534.957) (-535.411) (-530.729) -- 0:01:18
Average standard deviation of split frequencies: 0.013802
295500 -- (-539.723) (-542.148) [-534.427] (-532.904) * [-536.427] (-535.198) (-540.319) (-535.103) -- 0:01:18
296000 -- (-536.585) (-538.665) (-541.576) [-533.253] * (-534.536) (-537.391) (-535.973) [-537.832] -- 0:01:18
296500 -- (-539.156) [-535.255] (-541.230) (-531.912) * (-535.727) [-534.383] (-532.702) (-531.773) -- 0:01:18
297000 -- (-537.442) [-536.009] (-537.539) (-536.106) * [-534.300] (-536.283) (-537.416) (-538.564) -- 0:01:18
297500 -- [-539.040] (-535.884) (-537.201) (-536.138) * (-532.130) (-534.741) (-545.909) [-535.767] -- 0:01:17
298000 -- (-539.102) [-532.060] (-538.651) (-534.504) * (-535.625) (-540.705) (-545.346) [-535.097] -- 0:01:20
298500 -- (-534.951) (-535.240) (-534.881) [-532.620] * (-546.833) [-533.816] (-537.814) (-538.244) -- 0:01:19
299000 -- (-538.263) (-531.540) [-533.682] (-541.211) * (-536.141) (-536.941) [-535.654] (-533.996) -- 0:01:19
299500 -- [-536.980] (-539.613) (-540.771) (-538.755) * (-541.367) (-535.009) (-535.308) [-537.935] -- 0:01:19
300000 -- (-537.109) (-535.818) [-532.265] (-535.735) * (-534.578) (-534.590) [-530.737] (-536.706) -- 0:01:19
Average standard deviation of split frequencies: 0.010452
300500 -- (-537.168) (-537.095) [-531.714] (-540.553) * (-534.454) (-535.113) (-537.509) [-537.173] -- 0:01:19
301000 -- (-538.966) [-541.805] (-542.184) (-533.513) * (-534.016) [-533.811] (-547.528) (-540.868) -- 0:01:18
301500 -- [-534.319] (-536.143) (-535.275) (-537.242) * (-534.770) (-531.621) [-536.481] (-538.385) -- 0:01:18
302000 -- (-535.686) (-538.961) (-537.209) [-537.194] * (-532.649) (-537.619) [-538.846] (-535.494) -- 0:01:18
302500 -- (-541.745) (-543.506) (-541.689) [-531.637] * (-539.811) (-536.448) (-533.562) [-536.461] -- 0:01:18
303000 -- (-535.930) [-541.106] (-535.748) (-534.596) * (-534.114) [-531.578] (-540.703) (-536.891) -- 0:01:18
303500 -- (-536.037) (-537.020) (-538.006) [-537.046] * (-537.869) [-535.766] (-539.964) (-538.724) -- 0:01:18
304000 -- (-539.182) [-533.352] (-535.729) (-541.055) * (-540.262) [-533.866] (-541.317) (-535.880) -- 0:01:17
304500 -- (-540.324) (-546.076) [-532.612] (-537.388) * (-532.870) [-540.563] (-532.451) (-540.458) -- 0:01:17
305000 -- (-541.313) (-541.898) (-540.017) [-533.494] * (-539.681) (-537.762) [-537.376] (-534.862) -- 0:01:17
Average standard deviation of split frequencies: 0.008216
305500 -- (-534.297) (-533.630) (-535.687) [-539.718] * (-537.815) (-535.683) (-535.715) [-533.583] -- 0:01:17
306000 -- (-531.813) (-543.909) [-536.394] (-534.345) * [-537.809] (-534.016) (-534.569) (-536.591) -- 0:01:17
306500 -- (-535.424) (-536.037) [-537.752] (-531.450) * [-536.548] (-537.620) (-531.577) (-535.782) -- 0:01:16
307000 -- (-542.750) (-536.807) [-538.413] (-533.756) * (-542.489) [-532.937] (-537.281) (-534.014) -- 0:01:19
307500 -- (-533.413) (-537.454) (-538.331) [-537.289] * (-539.408) (-533.974) [-536.681] (-531.978) -- 0:01:18
308000 -- (-539.947) (-536.553) [-538.387] (-535.234) * (-537.302) [-537.781] (-536.847) (-539.404) -- 0:01:18
308500 -- (-534.697) (-536.833) (-534.047) [-536.398] * (-538.654) (-534.712) [-537.670] (-536.097) -- 0:01:18
309000 -- (-541.465) [-533.950] (-537.205) (-543.300) * (-543.386) (-538.014) [-532.898] (-536.149) -- 0:01:18
309500 -- (-539.511) (-530.668) [-535.454] (-540.562) * (-538.422) (-535.053) [-532.171] (-535.114) -- 0:01:18
310000 -- [-534.122] (-535.929) (-533.589) (-538.706) * (-543.749) (-539.331) (-538.111) [-539.611] -- 0:01:17
Average standard deviation of split frequencies: 0.007081
310500 -- (-537.123) (-537.786) [-534.189] (-538.570) * (-538.550) (-541.235) (-533.678) [-538.213] -- 0:01:17
311000 -- (-537.957) (-545.971) [-534.883] (-535.012) * (-537.870) [-541.357] (-532.821) (-536.333) -- 0:01:17
311500 -- (-538.375) (-537.981) [-537.866] (-535.435) * (-538.108) [-541.599] (-532.666) (-532.527) -- 0:01:17
312000 -- (-533.946) (-536.716) (-539.529) [-535.040] * (-537.353) (-538.786) [-533.931] (-537.127) -- 0:01:17
312500 -- (-533.373) [-540.013] (-537.922) (-533.628) * [-534.205] (-537.145) (-534.828) (-535.935) -- 0:01:17
313000 -- (-534.850) (-538.757) (-535.216) [-534.594] * [-535.693] (-540.768) (-532.206) (-537.798) -- 0:01:16
313500 -- (-532.606) [-536.091] (-534.714) (-537.294) * (-540.691) (-544.490) [-532.424] (-533.092) -- 0:01:16
314000 -- (-533.713) [-534.859] (-538.345) (-542.144) * (-538.666) (-542.123) (-536.516) [-531.972] -- 0:01:16
314500 -- (-533.197) (-538.231) (-537.864) [-540.987] * [-541.638] (-538.784) (-536.524) (-534.945) -- 0:01:16
315000 -- (-534.217) [-534.341] (-548.246) (-540.893) * (-531.441) [-543.996] (-538.727) (-533.764) -- 0:01:16
Average standard deviation of split frequencies: 0.004973
315500 -- (-537.743) [-537.921] (-546.660) (-539.244) * (-531.713) (-546.193) (-541.488) [-534.335] -- 0:01:15
316000 -- (-541.879) (-537.931) (-541.640) [-537.622] * (-530.536) (-537.750) [-537.173] (-537.267) -- 0:01:17
316500 -- (-538.408) (-532.425) [-538.776] (-535.242) * (-533.501) (-533.973) [-533.804] (-543.527) -- 0:01:17
317000 -- [-536.041] (-540.240) (-540.911) (-536.890) * [-537.162] (-535.706) (-538.125) (-541.408) -- 0:01:17
317500 -- (-534.415) [-542.405] (-536.467) (-539.513) * [-535.561] (-532.545) (-544.035) (-542.319) -- 0:01:17
318000 -- (-535.564) (-531.495) (-542.253) [-533.820] * (-539.915) (-534.711) [-543.342] (-546.177) -- 0:01:17
318500 -- (-532.654) (-533.325) (-536.599) [-533.060] * (-533.587) (-537.553) (-535.430) [-538.708] -- 0:01:17
319000 -- (-536.206) (-535.647) [-536.853] (-532.246) * (-536.093) (-532.047) (-535.401) [-541.455] -- 0:01:16
319500 -- (-530.936) (-538.906) [-539.652] (-537.178) * [-535.185] (-537.668) (-539.119) (-545.887) -- 0:01:16
320000 -- (-533.604) (-533.765) [-533.994] (-545.456) * (-536.560) (-536.022) (-537.489) [-538.113] -- 0:01:16
Average standard deviation of split frequencies: 0.009801
320500 -- (-544.919) (-535.130) (-533.474) [-535.659] * (-536.933) (-537.245) [-537.278] (-540.031) -- 0:01:16
321000 -- (-544.646) (-536.335) (-531.202) [-537.073] * (-535.368) (-536.463) [-535.763] (-536.239) -- 0:01:16
321500 -- (-546.092) [-541.692] (-534.096) (-540.574) * [-539.614] (-540.881) (-534.066) (-536.381) -- 0:01:15
322000 -- (-537.420) [-534.362] (-532.068) (-535.050) * (-540.360) (-536.545) [-532.675] (-536.747) -- 0:01:15
322500 -- (-539.006) [-537.459] (-536.155) (-540.519) * (-535.040) (-535.420) [-534.045] (-541.347) -- 0:01:15
323000 -- (-535.079) [-532.056] (-540.609) (-538.452) * [-534.616] (-537.456) (-537.694) (-536.785) -- 0:01:15
323500 -- (-537.566) [-533.805] (-541.466) (-536.654) * (-533.408) [-535.806] (-535.624) (-536.294) -- 0:01:15
324000 -- (-541.526) [-535.383] (-537.669) (-537.956) * (-533.763) (-542.302) (-534.609) [-535.266] -- 0:01:15
324500 -- (-534.696) (-536.085) [-539.012] (-537.138) * (-537.603) (-545.263) [-539.649] (-534.615) -- 0:01:14
325000 -- (-534.994) [-537.383] (-538.182) (-537.686) * [-531.036] (-536.891) (-535.811) (-537.067) -- 0:01:16
Average standard deviation of split frequencies: 0.012532
325500 -- [-534.236] (-540.002) (-544.352) (-540.683) * [-534.565] (-540.061) (-531.927) (-542.450) -- 0:01:16
326000 -- [-532.656] (-534.866) (-545.700) (-537.193) * (-538.984) (-539.789) (-536.345) [-535.762] -- 0:01:16
326500 -- (-537.292) (-538.741) [-542.430] (-536.548) * (-541.588) (-541.307) [-534.042] (-541.030) -- 0:01:16
327000 -- (-537.050) (-536.870) (-539.832) [-537.754] * (-536.453) [-535.234] (-539.218) (-531.696) -- 0:01:16
327500 -- (-534.403) (-535.407) [-538.237] (-545.775) * (-536.780) [-537.748] (-539.488) (-542.303) -- 0:01:15
328000 -- (-540.612) [-531.997] (-542.985) (-546.173) * (-537.018) (-538.039) (-536.072) [-535.115] -- 0:01:15
328500 -- [-533.839] (-536.129) (-542.671) (-538.464) * (-540.778) (-536.108) (-540.551) [-535.769] -- 0:01:15
329000 -- (-534.388) [-540.761] (-545.673) (-545.313) * (-540.699) (-532.986) (-533.442) [-534.731] -- 0:01:15
329500 -- (-535.315) (-539.512) [-537.370] (-541.425) * (-539.482) (-538.205) [-539.618] (-538.410) -- 0:01:15
330000 -- (-535.289) [-533.249] (-537.502) (-541.945) * (-545.362) [-537.944] (-542.544) (-534.078) -- 0:01:15
Average standard deviation of split frequencies: 0.011405
330500 -- [-532.097] (-535.233) (-538.417) (-538.042) * (-540.977) (-537.026) (-539.256) [-534.904] -- 0:01:14
331000 -- [-536.393] (-538.120) (-539.629) (-539.189) * (-538.945) (-540.088) (-535.431) [-542.765] -- 0:01:14
331500 -- [-533.194] (-534.175) (-539.391) (-535.043) * [-536.595] (-536.000) (-533.472) (-539.382) -- 0:01:14
332000 -- (-534.606) (-537.636) [-535.183] (-537.194) * (-537.217) (-541.678) [-533.935] (-531.240) -- 0:01:14
332500 -- (-533.314) (-536.046) [-539.653] (-538.878) * (-535.875) (-548.804) [-531.485] (-535.753) -- 0:01:14
333000 -- (-544.178) (-540.979) [-533.624] (-536.690) * [-538.873] (-542.825) (-534.682) (-537.932) -- 0:01:14
333500 -- (-538.863) [-537.707] (-533.690) (-536.367) * (-538.841) (-540.167) (-535.642) [-533.369] -- 0:01:13
334000 -- (-536.728) (-540.795) (-533.034) [-531.567] * (-546.853) (-541.665) [-539.093] (-533.714) -- 0:01:15
334500 -- (-543.372) [-539.722] (-537.624) (-537.626) * (-536.951) (-539.778) (-543.005) [-535.954] -- 0:01:15
335000 -- (-533.674) (-537.618) [-535.245] (-537.033) * [-532.931] (-538.930) (-534.093) (-540.167) -- 0:01:15
Average standard deviation of split frequencies: 0.010289
335500 -- (-536.911) (-531.657) (-535.299) [-534.853] * [-532.440] (-538.794) (-536.025) (-537.532) -- 0:01:15
336000 -- [-535.518] (-537.385) (-537.740) (-539.623) * (-535.233) (-543.093) [-534.079] (-540.321) -- 0:01:15
336500 -- (-538.163) [-535.825] (-535.645) (-532.613) * [-532.473] (-544.639) (-544.043) (-533.024) -- 0:01:14
337000 -- (-535.753) (-540.044) [-536.439] (-544.847) * (-535.191) [-538.269] (-535.823) (-535.869) -- 0:01:14
337500 -- (-540.793) [-533.913] (-542.037) (-534.673) * (-533.419) (-536.612) (-534.335) [-532.831] -- 0:01:14
338000 -- [-535.841] (-537.517) (-539.227) (-534.717) * (-539.408) [-547.815] (-539.437) (-540.650) -- 0:01:14
338500 -- (-532.418) (-534.358) [-537.425] (-539.268) * [-537.837] (-538.741) (-540.905) (-544.121) -- 0:01:14
339000 -- [-537.616] (-534.622) (-539.990) (-537.816) * [-540.588] (-540.588) (-553.031) (-543.723) -- 0:01:14
339500 -- (-535.963) (-537.113) [-537.490] (-538.343) * [-534.143] (-538.151) (-540.604) (-536.844) -- 0:01:13
340000 -- [-532.569] (-530.666) (-539.451) (-536.989) * (-532.755) [-538.629] (-539.581) (-533.698) -- 0:01:13
Average standard deviation of split frequencies: 0.007380
340500 -- [-534.426] (-534.914) (-536.062) (-536.979) * (-532.285) [-533.272] (-539.293) (-536.955) -- 0:01:13
341000 -- (-538.594) (-534.363) [-532.663] (-537.703) * (-531.529) (-535.079) (-543.608) [-532.925] -- 0:01:13
341500 -- (-542.108) (-537.947) [-537.273] (-537.739) * (-534.638) (-532.575) (-541.206) [-536.658] -- 0:01:13
342000 -- (-540.026) (-535.984) (-535.385) [-538.405] * (-536.146) [-532.345] (-536.339) (-534.860) -- 0:01:13
342500 -- [-534.680] (-533.205) (-535.914) (-545.612) * (-534.312) (-538.386) [-532.878] (-546.991) -- 0:01:12
343000 -- (-541.571) (-535.123) [-536.741] (-544.491) * (-541.615) (-541.935) [-536.113] (-534.792) -- 0:01:14
343500 -- (-542.813) [-532.942] (-538.256) (-550.166) * (-541.250) [-538.966] (-535.569) (-538.535) -- 0:01:14
344000 -- [-536.680] (-530.662) (-534.944) (-550.206) * [-534.737] (-536.839) (-536.224) (-540.732) -- 0:01:14
344500 -- (-537.796) [-533.912] (-537.100) (-548.775) * (-535.322) [-540.867] (-534.176) (-539.002) -- 0:01:14
345000 -- (-536.125) (-540.627) (-537.275) [-543.964] * (-535.583) (-540.128) (-538.051) [-534.676] -- 0:01:14
Average standard deviation of split frequencies: 0.009991
345500 -- (-540.300) [-536.681] (-538.680) (-541.674) * (-537.150) (-543.131) (-537.546) [-532.315] -- 0:01:13
346000 -- [-536.180] (-536.961) (-538.430) (-543.156) * (-536.806) (-537.878) (-542.579) [-533.602] -- 0:01:13
346500 -- (-538.572) (-542.373) [-537.266] (-544.046) * (-536.572) [-532.847] (-532.027) (-535.378) -- 0:01:13
347000 -- (-543.283) (-535.463) [-540.957] (-547.700) * (-535.466) [-539.930] (-532.831) (-537.062) -- 0:01:13
347500 -- (-535.039) [-532.922] (-538.447) (-545.592) * [-540.098] (-534.492) (-535.496) (-540.937) -- 0:01:13
348000 -- (-534.945) [-534.350] (-538.043) (-542.060) * (-536.487) (-536.308) (-539.785) [-534.204] -- 0:01:13
348500 -- (-537.369) (-535.353) (-541.210) [-537.779] * (-535.840) (-534.352) [-537.027] (-536.771) -- 0:01:12
349000 -- (-539.776) [-532.766] (-542.552) (-544.038) * (-538.026) (-537.469) [-534.497] (-539.285) -- 0:01:12
349500 -- [-539.745] (-531.797) (-538.591) (-539.820) * (-538.301) [-536.664] (-533.050) (-539.873) -- 0:01:12
350000 -- (-538.054) (-538.094) [-536.098] (-541.228) * (-545.622) (-535.656) [-532.580] (-539.259) -- 0:01:12
Average standard deviation of split frequencies: 0.017028
350500 -- (-540.165) (-533.264) (-538.126) [-537.870] * (-536.471) [-535.792] (-535.739) (-537.732) -- 0:01:12
351000 -- [-534.744] (-534.838) (-543.881) (-537.884) * (-536.581) (-535.887) (-542.604) [-534.649] -- 0:01:12
351500 -- [-542.361] (-532.554) (-536.790) (-541.358) * [-534.730] (-537.763) (-537.038) (-540.262) -- 0:01:11
352000 -- [-535.798] (-538.691) (-539.549) (-538.982) * [-534.163] (-543.486) (-538.759) (-542.804) -- 0:01:13
352500 -- [-532.481] (-538.299) (-534.659) (-543.576) * (-536.552) (-539.494) (-545.811) [-541.042] -- 0:01:13
353000 -- (-537.423) (-534.849) [-534.597] (-537.225) * [-535.655] (-540.557) (-545.632) (-534.387) -- 0:01:13
353500 -- [-533.614] (-531.983) (-534.969) (-540.490) * (-536.043) (-534.114) (-534.946) [-531.579] -- 0:01:13
354000 -- (-535.259) (-536.174) (-536.069) [-541.287] * (-536.332) (-538.572) [-535.182] (-532.632) -- 0:01:12
354500 -- (-534.596) [-534.897] (-538.332) (-541.411) * (-534.432) [-535.743] (-532.438) (-536.313) -- 0:01:12
355000 -- (-537.982) [-537.672] (-537.154) (-535.804) * (-539.676) [-534.154] (-537.980) (-533.260) -- 0:01:12
Average standard deviation of split frequencies: 0.014124
355500 -- (-536.847) (-532.649) [-533.665] (-534.550) * (-533.310) [-538.895] (-540.202) (-533.449) -- 0:01:12
356000 -- [-536.423] (-536.453) (-534.221) (-531.440) * (-538.598) [-531.858] (-537.749) (-534.322) -- 0:01:12
356500 -- [-538.373] (-538.859) (-538.752) (-539.836) * (-539.734) [-542.235] (-542.389) (-534.968) -- 0:01:12
357000 -- (-540.263) (-541.372) [-535.804] (-533.695) * (-536.186) [-540.086] (-532.752) (-536.390) -- 0:01:12
357500 -- [-536.338] (-535.883) (-538.070) (-533.759) * (-538.746) (-539.420) (-535.507) [-535.148] -- 0:01:11
358000 -- (-539.125) (-533.566) [-536.037] (-538.194) * (-538.788) (-532.866) (-536.317) [-532.326] -- 0:01:11
358500 -- [-535.394] (-536.641) (-535.354) (-535.256) * (-537.386) (-541.778) (-533.273) [-533.675] -- 0:01:11
359000 -- [-535.265] (-536.362) (-536.994) (-539.796) * (-544.133) [-534.107] (-534.525) (-534.102) -- 0:01:11
359500 -- [-537.533] (-538.282) (-534.617) (-539.626) * (-540.177) (-533.882) (-537.698) [-533.003] -- 0:01:11
360000 -- [-535.121] (-538.084) (-537.355) (-533.672) * (-533.038) (-533.761) (-534.897) [-539.491] -- 0:01:11
Average standard deviation of split frequencies: 0.013942
360500 -- (-529.870) [-536.057] (-536.448) (-536.139) * [-539.935] (-532.718) (-534.966) (-537.888) -- 0:01:10
361000 -- (-530.288) (-536.281) [-534.650] (-533.224) * (-531.812) (-536.041) (-538.438) [-534.694] -- 0:01:12
361500 -- (-532.784) (-537.351) [-536.688] (-536.714) * (-536.225) [-533.445] (-535.177) (-537.622) -- 0:01:12
362000 -- (-537.317) [-546.520] (-535.079) (-543.331) * [-532.772] (-539.263) (-539.616) (-533.316) -- 0:01:12
362500 -- (-539.489) (-545.959) (-538.301) [-542.413] * (-536.705) (-537.836) (-535.642) [-540.476] -- 0:01:12
363000 -- [-530.403] (-541.931) (-534.987) (-539.398) * [-536.673] (-537.355) (-537.408) (-535.201) -- 0:01:11
363500 -- (-538.077) (-541.591) (-538.286) [-532.233] * (-542.311) [-533.529] (-532.075) (-534.093) -- 0:01:11
364000 -- [-536.532] (-542.198) (-539.458) (-536.477) * [-535.600] (-534.978) (-534.165) (-533.114) -- 0:01:11
364500 -- (-536.492) (-538.799) [-533.093] (-536.069) * (-541.265) (-536.852) (-536.630) [-533.228] -- 0:01:11
365000 -- (-536.131) (-540.422) (-535.702) [-537.254] * (-542.738) [-533.255] (-534.794) (-538.676) -- 0:01:11
Average standard deviation of split frequencies: 0.012880
365500 -- [-531.437] (-538.001) (-532.459) (-534.943) * (-540.201) (-536.130) [-542.059] (-541.005) -- 0:01:11
366000 -- [-533.674] (-541.677) (-537.114) (-537.565) * (-534.595) (-542.979) [-535.152] (-539.034) -- 0:01:11
366500 -- (-533.569) (-539.415) (-534.902) [-534.839] * (-534.368) (-537.601) (-532.151) [-537.434] -- 0:01:10
367000 -- (-536.713) [-535.301] (-539.998) (-544.885) * (-540.797) [-538.825] (-534.960) (-542.974) -- 0:01:10
367500 -- (-537.083) (-536.227) (-538.954) [-532.846] * (-536.168) (-539.556) [-534.930] (-541.026) -- 0:01:10
368000 -- (-532.896) (-537.634) [-537.991] (-534.158) * (-535.107) [-537.782] (-534.626) (-538.777) -- 0:01:10
368500 -- (-536.363) (-538.382) (-541.282) [-537.652] * (-532.839) [-539.857] (-538.960) (-534.337) -- 0:01:10
369000 -- [-538.066] (-543.177) (-534.783) (-533.852) * (-533.701) (-536.246) [-529.804] (-539.634) -- 0:01:10
369500 -- (-539.090) (-534.883) (-535.291) [-536.604] * (-534.067) [-533.272] (-535.983) (-538.589) -- 0:01:09
370000 -- (-540.166) [-535.563] (-534.023) (-535.782) * (-537.024) (-536.197) [-531.400] (-537.250) -- 0:01:11
Average standard deviation of split frequencies: 0.012718
370500 -- [-540.152] (-535.810) (-536.198) (-536.172) * (-534.913) (-533.868) [-532.469] (-536.651) -- 0:01:11
371000 -- (-534.233) [-535.767] (-537.001) (-539.795) * (-532.688) (-533.766) (-533.654) [-538.686] -- 0:01:11
371500 -- (-534.404) (-533.442) [-534.560] (-542.278) * (-538.540) (-535.384) [-536.915] (-534.328) -- 0:01:11
372000 -- (-531.687) (-534.184) [-531.616] (-538.802) * (-533.032) [-535.012] (-540.561) (-539.299) -- 0:01:10
372500 -- (-537.497) (-539.996) (-540.600) [-534.164] * [-537.241] (-539.025) (-536.831) (-536.230) -- 0:01:10
373000 -- [-533.045] (-534.204) (-539.121) (-540.791) * (-540.596) (-539.919) (-533.367) [-533.882] -- 0:01:10
373500 -- [-541.821] (-535.992) (-532.955) (-535.544) * [-534.196] (-539.200) (-537.630) (-537.157) -- 0:01:10
374000 -- (-534.078) (-540.458) [-532.308] (-535.575) * [-533.979] (-543.798) (-539.667) (-537.280) -- 0:01:10
374500 -- (-542.551) (-535.851) [-535.124] (-536.968) * (-533.868) (-537.732) [-533.332] (-547.984) -- 0:01:10
375000 -- [-536.220] (-534.032) (-533.521) (-542.455) * (-537.172) [-536.187] (-536.754) (-541.710) -- 0:01:10
Average standard deviation of split frequencies: 0.010866
375500 -- [-538.792] (-532.285) (-534.068) (-536.606) * [-537.067] (-533.234) (-536.454) (-537.384) -- 0:01:09
376000 -- (-538.424) (-535.936) (-536.418) [-536.880] * [-533.531] (-535.351) (-539.018) (-536.253) -- 0:01:09
376500 -- [-532.752] (-537.778) (-539.254) (-539.661) * (-537.746) [-537.163] (-534.533) (-536.592) -- 0:01:09
377000 -- (-532.856) [-537.923] (-536.652) (-536.911) * [-536.835] (-536.026) (-535.088) (-533.382) -- 0:01:09
377500 -- (-536.292) (-534.115) [-535.233] (-541.256) * [-534.115] (-534.518) (-533.443) (-533.524) -- 0:01:09
378000 -- (-542.230) (-537.446) (-536.923) [-541.707] * (-534.845) [-536.666] (-532.135) (-534.709) -- 0:01:09
378500 -- (-535.986) (-539.062) (-535.470) [-535.565] * (-537.021) [-534.648] (-537.944) (-544.297) -- 0:01:08
379000 -- [-537.029] (-534.612) (-536.200) (-534.478) * (-533.664) (-537.377) (-537.260) [-536.710] -- 0:01:10
379500 -- [-537.079] (-534.619) (-533.146) (-535.421) * (-532.094) [-540.241] (-533.665) (-536.021) -- 0:01:10
380000 -- (-533.361) [-533.510] (-531.754) (-538.765) * [-537.667] (-541.106) (-533.318) (-539.937) -- 0:01:10
Average standard deviation of split frequencies: 0.014035
380500 -- (-537.851) (-538.881) (-538.022) [-531.416] * [-536.787] (-532.188) (-534.538) (-534.653) -- 0:01:10
381000 -- (-542.518) (-535.336) (-535.410) [-533.405] * (-540.245) (-536.843) [-532.641] (-535.516) -- 0:01:09
381500 -- (-540.997) (-534.478) (-537.149) [-531.387] * (-539.894) [-534.963] (-530.895) (-534.764) -- 0:01:09
382000 -- (-540.081) (-538.447) (-539.759) [-534.672] * (-536.014) (-537.732) [-536.052] (-536.699) -- 0:01:09
382500 -- (-538.679) (-534.248) [-542.651] (-536.785) * (-537.136) [-535.496] (-532.379) (-537.916) -- 0:01:09
383000 -- [-538.180] (-539.020) (-532.096) (-534.828) * [-535.100] (-535.573) (-534.457) (-535.005) -- 0:01:09
383500 -- (-537.343) [-532.964] (-537.375) (-547.810) * (-537.613) (-532.187) [-535.153] (-535.807) -- 0:01:09
384000 -- [-535.949] (-536.336) (-540.528) (-548.211) * (-536.639) [-533.474] (-530.123) (-534.739) -- 0:01:08
384500 -- (-537.787) (-535.368) (-540.702) [-543.060] * [-536.636] (-531.463) (-535.863) (-538.786) -- 0:01:08
385000 -- (-536.885) [-533.215] (-542.070) (-538.639) * (-540.293) (-534.181) [-533.217] (-535.384) -- 0:01:08
Average standard deviation of split frequencies: 0.014655
385500 -- (-533.466) (-537.743) [-536.746] (-540.129) * [-537.572] (-533.652) (-533.426) (-538.004) -- 0:01:08
386000 -- (-534.157) [-533.000] (-535.344) (-536.904) * (-536.002) [-539.206] (-539.185) (-533.393) -- 0:01:08
386500 -- (-537.034) (-533.987) [-535.075] (-540.614) * [-538.810] (-536.583) (-535.128) (-532.218) -- 0:01:08
387000 -- (-535.201) (-534.471) [-536.744] (-542.470) * (-533.382) [-534.314] (-535.512) (-536.337) -- 0:01:08
387500 -- (-534.219) (-534.933) (-533.602) [-533.419] * [-540.170] (-533.172) (-531.753) (-533.128) -- 0:01:07
388000 -- (-536.710) (-532.720) [-536.575] (-536.070) * (-538.950) (-534.302) (-535.032) [-531.155] -- 0:01:09
388500 -- (-537.084) (-546.564) [-533.605] (-536.030) * [-540.722] (-535.917) (-531.670) (-540.347) -- 0:01:09
389000 -- [-539.690] (-538.386) (-540.979) (-535.335) * (-538.867) (-539.781) [-538.324] (-534.299) -- 0:01:09
389500 -- [-535.825] (-540.064) (-535.944) (-535.071) * (-535.416) (-537.001) (-536.242) [-537.237] -- 0:01:08
390000 -- (-532.251) (-533.995) [-531.018] (-537.602) * (-537.926) (-533.971) [-537.218] (-533.782) -- 0:01:08
Average standard deviation of split frequencies: 0.013676
390500 -- (-534.608) (-535.646) (-533.617) [-533.569] * (-536.407) (-535.822) [-536.355] (-532.269) -- 0:01:08
391000 -- [-534.901] (-539.251) (-534.760) (-539.512) * (-534.397) (-534.991) [-536.562] (-536.060) -- 0:01:08
391500 -- (-536.132) [-535.911] (-539.727) (-535.388) * [-534.473] (-535.606) (-540.108) (-535.440) -- 0:01:08
392000 -- (-536.011) (-541.979) (-539.371) [-533.569] * (-537.189) (-533.329) (-538.409) [-538.781] -- 0:01:08
392500 -- (-542.896) (-542.099) (-535.805) [-534.071] * (-539.688) (-539.039) [-534.899] (-539.105) -- 0:01:08
393000 -- (-535.208) (-541.029) [-535.077] (-537.055) * [-543.540] (-538.123) (-537.503) (-535.955) -- 0:01:07
393500 -- [-535.441] (-544.326) (-534.578) (-538.461) * [-538.943] (-538.909) (-539.349) (-534.254) -- 0:01:07
394000 -- (-534.426) (-538.993) [-535.156] (-533.395) * (-538.538) [-534.720] (-535.095) (-536.485) -- 0:01:07
394500 -- (-536.313) (-540.902) (-539.550) [-535.969] * (-540.106) [-533.996] (-538.390) (-538.294) -- 0:01:07
395000 -- [-531.767] (-543.040) (-538.274) (-540.463) * (-533.997) (-535.089) [-534.476] (-536.327) -- 0:01:07
Average standard deviation of split frequencies: 0.013491
395500 -- (-535.810) [-541.090] (-536.781) (-540.202) * [-535.732] (-537.436) (-535.122) (-533.221) -- 0:01:07
396000 -- (-536.366) [-534.663] (-536.823) (-535.209) * (-533.198) (-537.176) [-536.838] (-532.681) -- 0:01:07
396500 -- (-530.881) [-533.354] (-540.487) (-536.904) * [-532.738] (-534.655) (-533.280) (-533.111) -- 0:01:06
397000 -- (-539.506) (-531.994) (-539.532) [-535.623] * (-538.530) [-533.987] (-538.873) (-539.340) -- 0:01:08
397500 -- (-534.656) (-538.662) (-537.140) [-536.095] * [-532.719] (-535.426) (-536.468) (-537.147) -- 0:01:08
398000 -- (-531.778) [-532.549] (-536.782) (-535.118) * (-536.653) [-538.252] (-536.054) (-539.850) -- 0:01:08
398500 -- (-536.112) (-535.260) (-539.434) [-534.881] * [-534.332] (-532.605) (-539.974) (-540.058) -- 0:01:07
399000 -- [-538.411] (-535.662) (-536.162) (-536.113) * [-534.574] (-540.113) (-538.192) (-541.635) -- 0:01:07
399500 -- (-544.078) [-535.656] (-538.505) (-532.383) * (-534.025) (-537.234) (-532.580) [-538.287] -- 0:01:07
400000 -- (-544.630) [-535.358] (-536.372) (-536.151) * [-537.144] (-539.308) (-538.155) (-543.683) -- 0:01:07
Average standard deviation of split frequencies: 0.012550
400500 -- (-541.276) [-533.144] (-539.642) (-537.116) * [-534.295] (-538.504) (-536.385) (-536.505) -- 0:01:07
401000 -- (-536.246) [-533.245] (-543.669) (-533.039) * (-532.927) (-543.136) (-534.495) [-532.093] -- 0:01:07
401500 -- [-536.933] (-542.011) (-540.033) (-537.807) * (-537.660) (-541.440) [-535.936] (-538.354) -- 0:01:07
402000 -- (-538.532) [-534.938] (-539.472) (-539.705) * (-544.178) (-533.913) [-537.117] (-539.961) -- 0:01:06
402500 -- (-534.999) (-533.945) [-536.597] (-532.647) * (-538.013) [-538.954] (-532.961) (-542.019) -- 0:01:06
403000 -- (-536.869) (-536.502) (-538.367) [-534.061] * [-533.662] (-541.706) (-532.137) (-536.785) -- 0:01:06
403500 -- (-538.504) (-532.288) (-535.466) [-537.863] * (-536.018) (-536.280) (-536.681) [-538.067] -- 0:01:06
404000 -- [-532.843] (-532.134) (-534.159) (-536.817) * (-536.192) [-534.360] (-533.126) (-540.749) -- 0:01:06
404500 -- [-532.880] (-535.730) (-536.578) (-534.974) * [-535.148] (-536.510) (-537.932) (-533.629) -- 0:01:06
405000 -- (-537.277) (-538.998) [-539.416] (-542.484) * [-538.966] (-532.871) (-532.472) (-536.089) -- 0:01:06
Average standard deviation of split frequencies: 0.012385
405500 -- (-531.506) [-536.672] (-535.647) (-535.224) * (-534.512) [-534.640] (-538.924) (-537.637) -- 0:01:05
406000 -- (-538.038) (-537.544) [-536.894] (-535.724) * (-533.395) (-533.122) [-533.590] (-538.668) -- 0:01:07
406500 -- [-536.874] (-535.000) (-536.807) (-536.136) * (-536.817) [-536.865] (-534.256) (-540.443) -- 0:01:07
407000 -- (-537.183) [-537.998] (-539.252) (-535.367) * (-536.899) (-531.946) [-540.035] (-534.659) -- 0:01:07
407500 -- (-536.327) (-543.034) [-535.402] (-535.895) * [-534.772] (-535.160) (-537.115) (-533.345) -- 0:01:06
408000 -- (-541.733) (-537.550) (-534.853) [-542.214] * [-542.349] (-538.578) (-538.398) (-533.587) -- 0:01:06
408500 -- (-535.778) (-537.106) [-535.349] (-537.042) * (-537.166) (-543.208) [-539.398] (-533.897) -- 0:01:06
409000 -- (-536.086) [-537.353] (-533.019) (-537.514) * (-536.200) (-533.377) (-536.399) [-535.610] -- 0:01:06
409500 -- (-536.105) [-539.508] (-539.815) (-540.137) * (-542.756) [-534.199] (-535.963) (-533.743) -- 0:01:06
410000 -- (-538.824) (-538.418) (-546.477) [-538.801] * (-539.691) (-536.132) [-540.500] (-534.718) -- 0:01:06
Average standard deviation of split frequencies: 0.010714
410500 -- [-536.581] (-535.851) (-539.913) (-537.970) * [-535.392] (-534.417) (-535.436) (-539.113) -- 0:01:06
411000 -- [-533.106] (-537.932) (-535.588) (-537.173) * (-534.990) [-538.136] (-538.797) (-536.919) -- 0:01:05
411500 -- (-540.746) [-533.620] (-532.583) (-539.662) * [-533.056] (-538.803) (-534.887) (-532.897) -- 0:01:05
412000 -- [-530.995] (-536.315) (-534.909) (-537.598) * (-541.741) (-534.338) [-536.166] (-534.834) -- 0:01:05
412500 -- (-534.866) [-536.045] (-535.012) (-538.243) * [-535.560] (-536.212) (-536.302) (-541.931) -- 0:01:05
413000 -- (-535.464) (-536.271) (-538.676) [-537.466] * (-540.145) (-538.254) [-538.474] (-532.008) -- 0:01:05
413500 -- [-535.475] (-536.932) (-538.005) (-540.911) * (-540.460) [-532.387] (-546.611) (-533.231) -- 0:01:05
414000 -- (-536.333) (-540.871) [-533.756] (-542.495) * (-542.534) [-536.334] (-533.187) (-540.545) -- 0:01:05
414500 -- (-535.073) [-539.345] (-535.234) (-533.802) * (-533.980) [-536.470] (-537.749) (-539.101) -- 0:01:04
415000 -- (-535.353) [-537.430] (-537.777) (-540.189) * [-538.003] (-533.712) (-533.069) (-539.775) -- 0:01:06
Average standard deviation of split frequencies: 0.009065
415500 -- [-531.776] (-537.461) (-542.125) (-542.110) * (-539.681) (-539.554) (-536.217) [-534.736] -- 0:01:06
416000 -- (-531.318) (-533.235) (-540.129) [-540.312] * (-540.667) (-538.970) [-539.904] (-534.866) -- 0:01:05
416500 -- (-532.338) (-533.459) (-533.048) [-536.531] * (-533.918) (-534.932) (-536.809) [-536.980] -- 0:01:05
417000 -- (-533.704) (-536.619) (-533.588) [-537.535] * [-536.565] (-534.671) (-535.600) (-547.087) -- 0:01:05
417500 -- (-536.367) [-539.170] (-536.388) (-533.673) * (-547.903) (-534.882) [-533.788] (-538.260) -- 0:01:05
418000 -- (-536.960) (-533.282) (-534.437) [-537.155] * [-535.672] (-534.287) (-541.022) (-543.200) -- 0:01:05
418500 -- [-534.842] (-536.963) (-536.558) (-537.402) * (-547.730) (-538.668) [-536.700] (-547.698) -- 0:01:05
419000 -- (-539.361) (-535.985) (-541.768) [-532.420] * (-535.826) [-536.679] (-536.485) (-542.486) -- 0:01:05
419500 -- (-539.197) (-537.085) [-539.830] (-535.603) * (-538.898) [-533.267] (-534.863) (-538.417) -- 0:01:05
420000 -- (-537.914) (-533.836) (-535.538) [-531.755] * (-537.141) [-531.761] (-530.831) (-538.422) -- 0:01:04
Average standard deviation of split frequencies: 0.007471
420500 -- (-541.523) (-538.693) [-538.839] (-535.246) * (-540.533) (-532.196) [-536.134] (-541.963) -- 0:01:04
421000 -- (-537.432) [-532.317] (-539.537) (-535.480) * [-536.283] (-533.569) (-535.801) (-537.567) -- 0:01:04
421500 -- (-539.038) (-535.145) (-533.887) [-536.560] * (-545.383) (-541.710) (-532.971) [-539.976] -- 0:01:04
422000 -- (-549.002) [-538.409] (-539.234) (-534.822) * (-539.661) (-532.049) [-533.454] (-544.556) -- 0:01:04
422500 -- (-537.772) [-538.373] (-534.346) (-534.733) * (-539.175) [-530.730] (-537.093) (-545.187) -- 0:01:04
423000 -- [-535.972] (-534.962) (-534.194) (-536.059) * [-537.903] (-539.646) (-534.975) (-536.424) -- 0:01:04
423500 -- (-534.087) (-534.370) (-533.396) [-545.302] * (-539.729) [-533.144] (-531.197) (-544.109) -- 0:01:03
424000 -- (-536.101) [-533.972] (-535.126) (-532.876) * (-538.268) (-535.512) (-534.691) [-542.774] -- 0:01:05
424500 -- (-537.865) (-533.356) (-535.204) [-533.284] * [-537.063] (-534.660) (-536.327) (-534.776) -- 0:01:05
425000 -- (-540.787) (-534.340) (-536.555) [-537.047] * [-534.616] (-536.588) (-535.283) (-535.912) -- 0:01:04
Average standard deviation of split frequencies: 0.008115
425500 -- (-541.750) [-537.863] (-534.329) (-534.512) * (-536.879) [-533.560] (-533.736) (-540.722) -- 0:01:04
426000 -- [-537.681] (-535.375) (-539.907) (-535.984) * (-534.909) (-539.155) (-533.363) [-536.718] -- 0:01:04
426500 -- [-536.787] (-533.593) (-536.590) (-533.845) * (-544.266) (-536.007) [-531.989] (-533.583) -- 0:01:04
427000 -- (-540.228) [-538.598] (-536.432) (-532.548) * (-540.832) (-541.039) (-533.502) [-534.381] -- 0:01:04
427500 -- (-536.469) [-534.510] (-539.394) (-540.752) * [-536.333] (-537.781) (-533.034) (-534.078) -- 0:01:04
428000 -- [-535.006] (-536.493) (-539.872) (-538.806) * (-537.476) [-537.692] (-531.972) (-536.122) -- 0:01:04
428500 -- [-537.436] (-536.287) (-532.080) (-544.863) * [-535.525] (-537.741) (-537.215) (-535.517) -- 0:01:04
429000 -- [-540.058] (-535.522) (-533.895) (-535.695) * (-535.758) (-535.192) [-534.319] (-538.952) -- 0:01:03
429500 -- [-531.689] (-532.199) (-536.481) (-540.155) * (-534.864) [-536.846] (-536.476) (-531.906) -- 0:01:03
430000 -- (-533.992) [-536.503] (-534.966) (-543.666) * (-539.150) [-535.302] (-537.699) (-533.982) -- 0:01:03
Average standard deviation of split frequencies: 0.008027
430500 -- (-539.855) (-533.184) (-544.621) [-541.996] * (-538.139) (-538.438) [-535.510] (-543.551) -- 0:01:03
431000 -- (-538.171) [-536.317] (-540.506) (-540.633) * (-535.880) (-533.096) (-533.499) [-541.542] -- 0:01:03
431500 -- [-532.962] (-534.022) (-536.764) (-542.504) * [-531.595] (-532.139) (-538.697) (-536.478) -- 0:01:03
432000 -- (-534.969) [-536.134] (-538.265) (-547.573) * [-535.142] (-534.144) (-537.422) (-534.828) -- 0:01:03
432500 -- (-534.323) (-535.146) [-535.479] (-538.782) * (-536.725) (-537.453) (-535.482) [-532.614] -- 0:01:02
433000 -- (-537.173) (-536.890) (-533.416) [-537.522] * (-539.018) (-537.120) [-533.672] (-540.489) -- 0:01:04
433500 -- (-535.247) (-536.830) (-540.995) [-536.269] * (-532.311) (-535.760) [-540.608] (-536.459) -- 0:01:04
434000 -- [-535.221] (-544.261) (-535.988) (-538.813) * (-537.435) (-535.115) (-534.464) [-536.914] -- 0:01:03
434500 -- (-538.214) (-538.193) [-538.893] (-535.252) * (-533.578) (-550.318) [-536.448] (-536.397) -- 0:01:03
435000 -- [-537.996] (-534.915) (-538.897) (-535.096) * [-533.599] (-540.123) (-541.718) (-538.817) -- 0:01:03
Average standard deviation of split frequencies: 0.006487
435500 -- (-539.879) (-535.503) [-532.352] (-535.368) * (-539.455) [-533.461] (-540.061) (-539.204) -- 0:01:03
436000 -- (-541.697) (-536.675) [-536.354] (-534.568) * (-544.350) [-531.544] (-545.176) (-541.461) -- 0:01:03
436500 -- (-537.535) (-546.506) (-537.534) [-536.406] * (-537.517) (-535.975) (-538.794) [-534.521] -- 0:01:03
437000 -- [-532.676] (-541.475) (-537.185) (-536.315) * (-534.635) (-541.448) (-537.605) [-536.324] -- 0:01:03
437500 -- (-538.261) (-542.118) (-532.589) [-537.127] * (-537.408) [-536.666] (-543.735) (-538.343) -- 0:01:03
438000 -- [-535.871] (-537.489) (-544.500) (-535.215) * (-534.500) (-538.878) (-535.325) [-536.824] -- 0:01:02
438500 -- [-536.019] (-537.966) (-534.771) (-534.660) * (-537.419) (-536.533) [-540.394] (-534.468) -- 0:01:02
439000 -- [-531.188] (-543.486) (-541.004) (-533.918) * [-537.937] (-538.699) (-535.864) (-536.917) -- 0:01:02
439500 -- [-537.570] (-537.006) (-534.024) (-536.612) * (-535.094) (-533.183) (-545.708) [-535.645] -- 0:01:02
440000 -- (-534.154) [-533.377] (-535.013) (-540.300) * (-530.649) (-539.694) [-535.103] (-534.836) -- 0:01:02
Average standard deviation of split frequencies: 0.005705
440500 -- (-532.625) (-538.626) [-539.995] (-534.522) * [-536.235] (-538.822) (-537.082) (-537.473) -- 0:01:02
441000 -- (-533.588) [-537.533] (-540.442) (-536.440) * (-535.913) (-535.952) (-539.370) [-531.788] -- 0:01:02
441500 -- (-538.032) [-532.228] (-535.461) (-535.205) * (-539.438) (-538.020) [-535.231] (-532.587) -- 0:01:01
442000 -- (-531.161) (-535.642) [-534.749] (-539.815) * (-533.571) (-534.670) [-543.988] (-532.191) -- 0:01:03
442500 -- (-536.476) (-534.548) [-538.127] (-535.665) * (-537.277) (-537.397) (-539.514) [-536.086] -- 0:01:02
443000 -- [-532.863] (-535.549) (-535.705) (-537.086) * [-533.950] (-533.415) (-534.893) (-537.858) -- 0:01:02
443500 -- [-535.190] (-535.729) (-543.597) (-535.851) * [-536.324] (-534.685) (-536.425) (-539.203) -- 0:01:02
444000 -- (-533.157) [-532.191] (-537.921) (-535.634) * (-533.103) (-538.404) [-533.101] (-535.385) -- 0:01:02
444500 -- (-532.129) [-535.170] (-536.364) (-534.144) * (-532.060) (-535.385) (-534.297) [-535.748] -- 0:01:02
445000 -- (-542.927) (-535.935) (-535.853) [-533.247] * [-535.342] (-536.477) (-534.606) (-537.142) -- 0:01:02
Average standard deviation of split frequencies: 0.004228
445500 -- (-545.381) (-539.537) (-538.022) [-534.562] * (-534.804) (-538.859) [-531.835] (-532.530) -- 0:01:02
446000 -- (-538.641) (-537.443) (-538.141) [-534.379] * (-538.021) (-539.130) (-536.902) [-532.650] -- 0:01:02
446500 -- [-540.849] (-537.263) (-538.719) (-531.616) * (-537.021) (-537.173) (-534.704) [-534.937] -- 0:01:01
447000 -- (-535.357) [-542.226] (-538.035) (-536.705) * [-534.241] (-539.282) (-537.007) (-537.518) -- 0:01:01
447500 -- [-537.867] (-535.866) (-540.200) (-533.357) * (-535.400) [-538.312] (-537.547) (-540.762) -- 0:01:01
448000 -- [-537.425] (-534.957) (-538.345) (-536.001) * (-531.200) [-538.244] (-531.916) (-543.266) -- 0:01:01
448500 -- (-538.508) [-538.941] (-532.909) (-539.831) * [-532.853] (-541.735) (-542.787) (-543.934) -- 0:01:01
449000 -- (-536.545) (-540.603) [-533.795] (-538.679) * (-542.693) (-542.446) [-534.103] (-538.844) -- 0:01:01
449500 -- (-545.091) (-537.423) (-534.912) [-545.496] * (-533.048) (-532.827) [-538.622] (-537.698) -- 0:01:01
450000 -- (-539.033) (-538.030) [-535.680] (-535.262) * [-533.246] (-533.656) (-542.132) (-535.618) -- 0:01:01
Average standard deviation of split frequencies: 0.004881
450500 -- (-537.817) (-533.998) (-545.041) [-536.837] * (-542.334) [-535.235] (-541.534) (-537.476) -- 0:01:00
451000 -- (-536.228) (-534.744) [-533.918] (-531.556) * (-535.829) (-532.735) (-535.923) [-536.866] -- 0:01:02
451500 -- [-534.742] (-533.714) (-536.919) (-538.702) * (-538.240) [-539.573] (-534.465) (-532.073) -- 0:01:01
452000 -- (-534.247) (-537.020) (-539.532) [-535.443] * (-539.201) (-539.421) (-541.509) [-529.527] -- 0:01:01
452500 -- (-537.000) (-539.257) [-535.549] (-538.547) * (-534.560) [-532.680] (-540.609) (-533.031) -- 0:01:01
453000 -- (-533.731) (-536.646) (-537.646) [-540.989] * (-531.961) [-534.996] (-533.273) (-536.428) -- 0:01:01
453500 -- (-535.533) (-534.837) [-534.019] (-540.056) * (-534.220) (-538.116) [-541.034] (-540.639) -- 0:01:01
454000 -- [-533.430] (-537.506) (-536.106) (-537.388) * (-539.957) (-539.386) [-535.333] (-537.033) -- 0:01:01
454500 -- [-536.344] (-543.860) (-539.170) (-534.982) * [-541.409] (-537.739) (-530.350) (-539.266) -- 0:01:01
455000 -- (-536.661) (-536.362) (-536.885) [-533.986] * (-539.204) [-536.885] (-533.609) (-535.748) -- 0:01:01
Average standard deviation of split frequencies: 0.006203
455500 -- (-534.387) (-536.251) [-532.164] (-535.888) * [-536.227] (-533.467) (-533.573) (-537.874) -- 0:01:00
456000 -- (-541.755) (-533.079) (-536.630) [-533.081] * (-537.592) (-541.083) (-537.468) [-535.310] -- 0:01:00
456500 -- (-537.845) [-532.765] (-533.917) (-536.801) * (-537.911) [-539.183] (-536.406) (-538.279) -- 0:01:00
457000 -- (-535.255) [-533.952] (-537.305) (-546.530) * [-537.456] (-535.754) (-538.172) (-532.858) -- 0:01:00
457500 -- [-536.404] (-534.056) (-532.223) (-537.832) * [-534.817] (-539.627) (-533.568) (-534.111) -- 0:01:00
458000 -- [-533.927] (-536.485) (-534.187) (-537.251) * (-534.934) (-533.268) (-534.107) [-534.532] -- 0:01:00
458500 -- (-541.223) (-534.143) [-536.001] (-536.287) * (-537.645) (-537.637) (-532.163) [-530.987] -- 0:01:00
459000 -- (-535.318) [-534.847] (-544.866) (-536.536) * (-534.321) [-538.203] (-531.724) (-536.167) -- 0:01:00
459500 -- (-539.080) [-532.299] (-530.727) (-536.716) * (-532.735) [-534.879] (-536.936) (-535.495) -- 0:00:59
460000 -- (-537.480) [-533.847] (-534.134) (-531.827) * (-536.842) (-534.659) [-531.360] (-539.301) -- 0:01:01
Average standard deviation of split frequencies: 0.006140
460500 -- (-532.544) [-533.919] (-535.958) (-537.407) * (-541.021) (-534.682) [-532.968] (-538.363) -- 0:01:00
461000 -- (-533.907) (-537.877) (-534.920) [-535.978] * [-532.600] (-530.759) (-535.550) (-534.733) -- 0:01:00
461500 -- (-538.387) (-539.445) (-532.735) [-535.734] * [-533.973] (-534.842) (-538.010) (-541.423) -- 0:01:00
462000 -- (-532.732) (-538.006) [-532.781] (-540.894) * [-533.084] (-534.009) (-540.308) (-533.609) -- 0:01:00
462500 -- (-538.082) (-537.988) (-535.210) [-537.097] * (-535.014) (-539.630) (-538.435) [-532.122] -- 0:01:00
463000 -- [-533.206] (-539.637) (-542.336) (-533.856) * (-533.903) (-535.932) [-534.393] (-534.738) -- 0:01:00
463500 -- (-532.711) (-532.965) [-532.046] (-541.318) * (-535.366) (-539.006) (-536.933) [-542.442] -- 0:01:00
464000 -- (-536.553) (-537.951) (-533.665) [-532.480] * (-540.408) (-544.122) (-536.958) [-537.585] -- 0:01:00
464500 -- (-532.693) (-537.029) (-538.554) [-536.236] * [-536.851] (-537.497) (-535.633) (-537.227) -- 0:00:59
465000 -- [-535.814] (-540.572) (-533.671) (-545.138) * (-532.853) (-540.947) [-533.628] (-535.296) -- 0:00:59
Average standard deviation of split frequencies: 0.004046
465500 -- (-537.165) [-538.835] (-536.477) (-537.925) * (-536.097) [-537.985] (-536.076) (-537.053) -- 0:00:59
466000 -- (-536.444) [-534.522] (-536.147) (-539.402) * (-533.809) (-538.187) [-532.546] (-542.749) -- 0:00:59
466500 -- [-531.549] (-539.180) (-537.423) (-537.358) * (-537.390) (-533.787) [-536.897] (-540.584) -- 0:00:59
467000 -- (-537.177) (-540.312) [-539.153] (-531.899) * (-537.280) (-534.619) [-532.833] (-539.042) -- 0:00:59
467500 -- (-537.655) (-538.568) (-532.310) [-537.139] * (-540.052) (-539.034) [-535.004] (-539.231) -- 0:00:59
468000 -- [-533.009] (-550.273) (-535.808) (-534.070) * [-534.306] (-542.066) (-534.510) (-535.775) -- 0:00:59
468500 -- (-538.869) [-534.423] (-542.930) (-534.883) * (-544.260) [-535.108] (-537.254) (-532.289) -- 0:00:58
469000 -- (-542.095) [-535.177] (-535.132) (-539.120) * (-539.206) [-530.928] (-533.369) (-536.826) -- 0:01:00
469500 -- (-539.702) (-535.268) [-532.727] (-541.866) * (-541.560) (-535.172) [-534.381] (-545.989) -- 0:00:59
470000 -- [-535.904] (-537.728) (-536.447) (-545.853) * (-543.840) [-531.464] (-537.302) (-542.204) -- 0:00:59
Average standard deviation of split frequencies: 0.004674
470500 -- [-533.042] (-534.056) (-536.393) (-540.113) * (-540.640) [-534.643] (-535.249) (-544.608) -- 0:00:59
471000 -- [-533.942] (-533.976) (-538.490) (-536.982) * [-538.204] (-537.127) (-537.873) (-536.383) -- 0:00:59
471500 -- (-535.709) (-533.932) [-534.081] (-535.270) * (-541.480) [-534.338] (-536.229) (-535.087) -- 0:00:59
472000 -- (-537.609) [-544.313] (-540.715) (-535.881) * (-536.826) (-535.554) (-530.848) [-533.215] -- 0:00:59
472500 -- (-537.078) (-534.027) [-533.341] (-534.918) * (-545.014) (-535.679) (-537.525) [-536.686] -- 0:00:59
473000 -- (-533.180) (-536.408) [-533.251] (-540.596) * (-530.193) (-535.942) [-533.592] (-540.227) -- 0:00:59
473500 -- [-535.352] (-533.932) (-541.984) (-538.958) * (-532.677) [-538.376] (-530.925) (-535.477) -- 0:00:58
474000 -- (-534.110) (-534.274) (-535.805) [-536.349] * (-534.099) (-541.312) (-534.577) [-539.939] -- 0:00:58
474500 -- (-537.394) (-537.266) (-538.285) [-532.978] * (-531.741) [-532.892] (-541.219) (-538.432) -- 0:00:58
475000 -- [-536.124] (-535.326) (-537.194) (-534.061) * (-534.854) (-534.224) [-530.654] (-543.374) -- 0:00:58
Average standard deviation of split frequencies: 0.005282
475500 -- (-533.728) [-534.736] (-537.860) (-534.537) * (-534.990) [-538.818] (-534.226) (-536.356) -- 0:00:58
476000 -- (-534.107) (-532.732) [-532.654] (-536.335) * (-536.571) (-535.867) (-536.770) [-537.612] -- 0:00:58
476500 -- (-536.209) [-535.989] (-532.577) (-538.550) * [-535.815] (-535.698) (-533.366) (-538.607) -- 0:00:58
477000 -- (-531.246) (-536.585) (-533.737) [-534.737] * [-538.459] (-531.866) (-535.581) (-534.712) -- 0:00:58
477500 -- (-534.507) [-539.013] (-538.439) (-533.363) * [-533.901] (-537.754) (-538.002) (-532.690) -- 0:00:57
478000 -- (-537.827) (-538.670) (-532.947) [-533.995] * (-540.311) (-537.086) [-538.520] (-532.966) -- 0:00:58
478500 -- (-537.751) [-536.267] (-536.245) (-537.558) * (-544.038) (-536.494) (-541.106) [-533.289] -- 0:00:58
479000 -- (-542.891) [-533.366] (-540.429) (-534.756) * (-531.482) [-534.112] (-539.819) (-537.217) -- 0:00:58
479500 -- (-532.857) [-533.106] (-535.000) (-537.062) * [-532.752] (-536.648) (-541.749) (-539.280) -- 0:00:58
480000 -- (-536.393) (-538.420) [-535.797] (-534.608) * (-537.917) (-537.526) (-542.849) [-538.869] -- 0:00:58
Average standard deviation of split frequencies: 0.003923
480500 -- (-535.924) (-534.540) (-539.824) [-534.503] * (-534.695) [-539.522] (-535.890) (-539.108) -- 0:00:58
481000 -- (-533.157) (-536.566) (-542.473) [-542.569] * (-536.094) (-536.616) [-533.106] (-533.996) -- 0:00:58
481500 -- (-534.902) [-537.603] (-539.519) (-540.650) * (-536.379) (-535.627) (-540.404) [-532.632] -- 0:00:58
482000 -- (-541.149) [-535.418] (-540.185) (-540.477) * (-547.008) [-535.201] (-536.561) (-534.221) -- 0:00:58
482500 -- (-533.888) (-534.774) (-538.912) [-538.936] * (-534.479) (-533.688) (-531.843) [-536.057] -- 0:00:57
483000 -- [-533.357] (-535.205) (-540.444) (-532.894) * (-535.776) [-535.093] (-532.657) (-537.380) -- 0:00:57
483500 -- (-533.617) (-538.778) [-533.123] (-538.568) * (-535.143) (-534.186) (-542.396) [-537.369] -- 0:00:57
484000 -- (-538.239) (-535.767) [-539.945] (-538.619) * (-533.389) [-537.604] (-533.313) (-541.009) -- 0:00:57
484500 -- (-532.885) (-537.248) [-534.523] (-542.974) * [-535.068] (-534.851) (-544.566) (-541.089) -- 0:00:57
485000 -- [-538.324] (-541.136) (-538.682) (-541.528) * [-542.924] (-537.815) (-536.761) (-543.546) -- 0:00:57
Average standard deviation of split frequencies: 0.002587
485500 -- (-536.340) (-537.548) [-534.621] (-536.485) * (-536.154) (-540.223) (-536.335) [-543.224] -- 0:00:57
486000 -- (-533.892) (-534.121) [-537.096] (-535.035) * (-539.007) (-538.199) [-535.210] (-538.701) -- 0:00:57
486500 -- (-532.010) (-535.531) (-540.806) [-533.725] * (-541.580) [-535.314] (-535.798) (-541.574) -- 0:00:56
487000 -- [-532.548] (-540.260) (-543.719) (-537.325) * (-536.530) [-535.408] (-534.397) (-544.814) -- 0:00:56
487500 -- (-538.602) (-536.599) (-539.954) [-535.443] * (-537.922) (-532.099) [-531.438] (-536.949) -- 0:00:57
488000 -- (-532.891) [-537.045] (-539.531) (-536.125) * [-538.729] (-535.521) (-535.062) (-540.025) -- 0:00:57
488500 -- (-539.201) [-539.086] (-537.630) (-533.440) * [-536.874] (-535.616) (-533.696) (-541.849) -- 0:00:57
489000 -- (-530.272) [-539.100] (-543.224) (-539.862) * (-536.357) (-536.107) [-537.790] (-539.452) -- 0:00:57
489500 -- [-533.460] (-538.018) (-542.511) (-533.536) * [-539.893] (-534.612) (-535.189) (-534.836) -- 0:00:57
490000 -- [-541.634] (-539.188) (-544.229) (-536.868) * (-538.867) [-534.581] (-539.150) (-539.549) -- 0:00:57
Average standard deviation of split frequencies: 0.005124
490500 -- (-537.318) [-532.449] (-537.021) (-546.751) * (-539.041) (-535.496) [-538.876] (-537.209) -- 0:00:57
491000 -- [-533.570] (-537.078) (-535.735) (-538.221) * [-534.806] (-536.869) (-543.187) (-539.102) -- 0:00:57
491500 -- (-533.416) [-533.740] (-535.018) (-536.521) * (-535.302) [-536.497] (-540.737) (-540.034) -- 0:00:56
492000 -- [-543.227] (-533.716) (-532.151) (-540.072) * (-537.989) [-537.038] (-543.928) (-545.130) -- 0:00:56
492500 -- (-543.683) (-539.447) (-540.251) [-540.125] * (-535.881) [-536.599] (-540.737) (-535.052) -- 0:00:56
493000 -- (-541.623) (-533.887) [-532.515] (-537.745) * (-543.748) [-538.588] (-537.699) (-535.381) -- 0:00:56
493500 -- (-542.257) (-536.283) [-534.746] (-537.980) * [-532.718] (-532.996) (-535.645) (-537.081) -- 0:00:56
494000 -- (-539.425) [-533.477] (-538.979) (-539.306) * [-533.486] (-532.849) (-536.380) (-536.661) -- 0:00:56
494500 -- [-536.052] (-538.516) (-537.673) (-539.645) * (-531.493) (-537.509) [-534.604] (-542.230) -- 0:00:56
495000 -- [-536.675] (-539.022) (-536.677) (-538.337) * [-532.749] (-535.758) (-538.703) (-535.706) -- 0:00:56
Average standard deviation of split frequencies: 0.005702
495500 -- (-538.110) (-537.721) [-534.480] (-538.246) * (-536.562) [-535.027] (-537.757) (-539.536) -- 0:00:55
496000 -- (-535.369) (-534.473) [-533.941] (-535.518) * (-538.806) (-535.517) [-535.473] (-535.636) -- 0:00:55
496500 -- (-534.143) (-536.306) (-535.520) [-541.602] * (-535.187) [-536.352] (-535.952) (-536.414) -- 0:00:56
497000 -- (-536.276) (-533.378) (-534.382) [-537.611] * [-534.990] (-535.780) (-536.192) (-537.222) -- 0:00:56
497500 -- (-538.687) (-534.455) [-537.269] (-539.752) * [-534.333] (-537.704) (-541.321) (-535.958) -- 0:00:56
498000 -- [-539.347] (-538.967) (-540.176) (-544.266) * [-537.439] (-533.832) (-533.613) (-535.875) -- 0:00:56
498500 -- (-534.417) (-537.599) (-543.098) [-533.428] * (-540.019) (-538.332) (-532.890) [-535.817] -- 0:00:56
499000 -- (-537.736) [-534.882] (-543.437) (-539.430) * [-536.108] (-533.653) (-534.989) (-533.847) -- 0:00:56
499500 -- (-537.986) (-538.408) [-533.270] (-536.688) * (-535.521) (-533.614) (-535.498) [-532.131] -- 0:00:56
500000 -- (-532.946) [-539.190] (-533.872) (-535.061) * (-532.815) [-533.426] (-536.723) (-533.441) -- 0:00:56
Average standard deviation of split frequencies: 0.005022
500500 -- (-539.295) (-535.178) (-533.521) [-534.894] * (-534.642) [-534.315] (-541.599) (-535.111) -- 0:00:55
501000 -- (-538.725) [-532.688] (-538.295) (-536.124) * (-533.984) (-531.765) (-531.059) [-535.900] -- 0:00:55
501500 -- (-542.797) (-532.831) (-537.503) [-533.281] * (-540.598) [-535.040] (-537.923) (-535.178) -- 0:00:55
502000 -- (-537.542) (-536.605) (-535.889) [-534.028] * (-533.928) (-531.405) [-539.696] (-534.081) -- 0:00:55
502500 -- (-538.619) (-532.380) [-532.749] (-537.716) * (-535.950) (-543.699) (-532.298) [-540.133] -- 0:00:55
503000 -- (-538.308) (-534.047) [-539.027] (-538.841) * [-531.376] (-536.981) (-539.904) (-542.631) -- 0:00:55
503500 -- (-537.611) (-539.920) (-534.844) [-538.490] * (-534.708) [-535.066] (-536.024) (-535.904) -- 0:00:55
504000 -- [-536.790] (-532.946) (-535.385) (-535.809) * (-535.844) (-533.887) (-539.435) [-535.760] -- 0:00:55
504500 -- (-540.149) (-543.090) (-533.033) [-534.060] * (-530.958) (-536.989) [-535.234] (-538.541) -- 0:00:55
505000 -- (-535.611) (-539.308) (-533.186) [-534.581] * (-535.663) (-540.224) (-540.400) [-535.141] -- 0:00:54
Average standard deviation of split frequencies: 0.005590
505500 -- (-536.744) [-542.509] (-534.196) (-536.261) * [-535.092] (-533.411) (-538.437) (-537.060) -- 0:00:55
506000 -- (-536.081) (-548.474) (-531.725) [-533.835] * (-539.984) (-540.918) [-535.090] (-533.500) -- 0:00:55
506500 -- (-538.049) (-536.864) [-532.994] (-533.894) * (-546.618) (-531.792) (-535.781) [-535.892] -- 0:00:55
507000 -- [-533.452] (-532.890) (-539.473) (-539.620) * (-541.512) (-534.431) (-542.034) [-533.548] -- 0:00:55
507500 -- (-531.472) [-533.738] (-532.870) (-543.639) * (-538.224) (-537.898) (-541.879) [-535.269] -- 0:00:55
508000 -- (-533.418) (-534.487) [-533.398] (-537.040) * (-539.722) [-533.292] (-536.075) (-537.801) -- 0:00:55
508500 -- (-535.053) (-538.287) (-535.947) [-535.752] * (-533.142) (-534.936) [-535.848] (-532.625) -- 0:00:55
509000 -- [-534.031] (-534.147) (-541.334) (-541.279) * (-534.100) [-534.872] (-537.901) (-535.277) -- 0:00:54
509500 -- (-538.432) [-536.823] (-536.947) (-534.789) * [-539.367] (-541.483) (-531.664) (-538.112) -- 0:00:54
510000 -- [-534.315] (-539.000) (-534.415) (-530.341) * (-537.775) (-536.212) [-533.299] (-536.587) -- 0:00:54
Average standard deviation of split frequencies: 0.006770
510500 -- (-539.218) [-533.878] (-537.995) (-544.930) * (-539.824) [-536.470] (-537.628) (-535.502) -- 0:00:54
511000 -- (-536.454) [-533.430] (-539.074) (-540.555) * (-537.228) (-534.274) (-532.814) [-534.767] -- 0:00:54
511500 -- (-534.544) (-535.871) [-535.673] (-533.968) * [-532.075] (-535.390) (-534.463) (-536.500) -- 0:00:54
512000 -- (-533.710) [-531.926] (-535.305) (-536.170) * (-538.683) (-538.713) [-540.171] (-534.305) -- 0:00:54
512500 -- (-541.228) (-533.814) [-532.164] (-537.224) * (-538.232) (-538.002) (-538.730) [-537.778] -- 0:00:54
513000 -- (-536.081) (-537.433) [-531.728] (-541.879) * (-543.002) (-544.216) [-535.190] (-532.646) -- 0:00:54
513500 -- (-536.915) [-536.841] (-536.441) (-538.366) * (-541.366) (-535.572) [-535.344] (-533.859) -- 0:00:54
514000 -- [-533.719] (-539.249) (-535.378) (-533.276) * (-536.933) (-540.558) (-537.653) [-532.607] -- 0:00:53
514500 -- [-536.667] (-535.601) (-540.942) (-536.836) * [-538.257] (-536.544) (-534.700) (-535.442) -- 0:00:54
515000 -- [-536.740] (-532.315) (-539.265) (-541.270) * (-537.870) (-543.172) (-537.932) [-533.102] -- 0:00:54
Average standard deviation of split frequencies: 0.006090
515500 -- (-537.527) (-535.915) (-539.650) [-533.954] * (-537.777) [-536.392] (-543.298) (-537.052) -- 0:00:54
516000 -- (-534.974) (-534.250) [-536.842] (-548.200) * [-534.032] (-536.333) (-539.059) (-538.458) -- 0:00:54
516500 -- (-539.314) (-535.355) (-537.011) [-536.537] * (-536.317) (-534.890) (-538.366) [-534.588] -- 0:00:54
517000 -- (-543.433) (-533.781) [-533.868] (-535.015) * (-538.829) (-536.067) (-533.828) [-538.675] -- 0:00:54
517500 -- (-538.618) [-533.183] (-535.506) (-538.581) * (-535.904) (-538.111) (-535.315) [-534.895] -- 0:00:54
518000 -- (-536.435) (-538.540) (-539.869) [-534.354] * (-534.290) (-544.195) (-532.031) [-538.866] -- 0:00:53
518500 -- (-539.152) (-537.972) (-538.389) [-532.620] * (-538.208) (-535.977) [-535.983] (-532.771) -- 0:00:53
519000 -- (-535.055) (-535.319) (-543.095) [-536.128] * (-534.269) (-532.631) (-543.549) [-536.833] -- 0:00:53
519500 -- (-539.730) (-536.124) [-535.035] (-539.113) * (-540.324) (-535.703) [-538.955] (-535.259) -- 0:00:53
520000 -- (-536.184) (-537.394) (-539.227) [-538.681] * (-538.734) [-534.285] (-536.289) (-540.957) -- 0:00:53
Average standard deviation of split frequencies: 0.008450
520500 -- (-538.603) (-540.722) [-533.100] (-544.346) * (-536.388) (-539.321) [-538.410] (-537.492) -- 0:00:53
521000 -- (-538.072) [-533.174] (-536.970) (-540.740) * (-534.124) (-541.256) (-539.854) [-530.891] -- 0:00:53
521500 -- (-545.487) (-543.354) (-533.725) [-534.839] * (-534.163) (-535.802) (-534.194) [-536.910] -- 0:00:53
522000 -- (-547.600) (-539.774) (-535.466) [-535.388] * (-533.159) (-535.408) (-541.179) [-533.225] -- 0:00:53
522500 -- (-546.017) (-537.638) [-536.092] (-533.438) * (-533.456) [-535.903] (-539.980) (-533.737) -- 0:00:53
523000 -- [-545.154] (-533.399) (-538.001) (-538.769) * (-539.470) (-533.785) (-533.646) [-535.220] -- 0:00:52
523500 -- [-539.981] (-533.384) (-543.116) (-539.673) * [-535.271] (-535.602) (-533.600) (-537.286) -- 0:00:53
524000 -- (-541.093) (-532.239) [-535.947] (-533.761) * (-537.330) (-537.530) [-532.908] (-539.086) -- 0:00:53
524500 -- (-541.309) [-531.813] (-542.942) (-537.270) * (-534.565) (-537.128) (-532.338) [-535.393] -- 0:00:53
525000 -- [-535.072] (-532.819) (-542.811) (-531.973) * (-532.676) (-535.718) [-535.843] (-536.643) -- 0:00:53
Average standard deviation of split frequencies: 0.007170
525500 -- (-535.819) (-536.892) (-534.275) [-537.684] * (-532.718) (-537.193) (-536.255) [-537.923] -- 0:00:53
526000 -- (-534.570) (-536.931) [-533.466] (-536.446) * (-531.754) (-533.535) [-545.897] (-534.358) -- 0:00:53
526500 -- (-534.652) [-539.664] (-537.730) (-538.198) * (-541.728) (-535.310) [-536.937] (-541.564) -- 0:00:53
527000 -- (-535.978) (-540.570) [-541.322] (-536.585) * (-541.242) (-534.349) (-533.288) [-535.298] -- 0:00:52
527500 -- [-539.056] (-539.413) (-536.860) (-542.013) * (-537.354) (-539.271) (-537.256) [-537.390] -- 0:00:52
528000 -- (-537.993) [-535.356] (-535.292) (-533.366) * (-539.617) (-538.420) (-543.476) [-534.440] -- 0:00:52
528500 -- (-540.217) (-535.971) (-535.642) [-537.311] * (-540.755) (-540.829) (-536.558) [-538.166] -- 0:00:52
529000 -- (-532.373) (-533.910) [-536.432] (-542.270) * [-542.200] (-536.106) (-533.790) (-533.465) -- 0:00:52
529500 -- (-538.960) (-537.697) (-533.054) [-537.332] * [-538.396] (-536.747) (-537.747) (-535.596) -- 0:00:52
530000 -- (-541.969) (-533.965) (-535.704) [-537.161] * (-538.873) (-541.875) [-532.232] (-537.732) -- 0:00:52
Average standard deviation of split frequencies: 0.007107
530500 -- (-538.213) (-539.868) [-536.289] (-541.480) * (-540.123) (-542.896) [-530.479] (-532.595) -- 0:00:52
531000 -- (-536.765) (-534.377) [-533.432] (-541.816) * (-538.864) (-536.616) (-531.367) [-536.638] -- 0:00:52
531500 -- (-538.277) [-534.700] (-533.704) (-546.125) * (-536.885) (-536.750) [-534.863] (-537.967) -- 0:00:52
532000 -- (-531.611) [-536.333] (-530.335) (-534.343) * (-539.058) (-533.916) [-537.005] (-538.435) -- 0:00:51
532500 -- (-536.706) (-535.014) (-536.710) [-536.794] * (-538.934) [-533.959] (-534.857) (-535.171) -- 0:00:52
533000 -- (-535.727) (-538.279) (-531.900) [-533.625] * (-533.264) (-537.881) [-529.992] (-536.724) -- 0:00:52
533500 -- (-535.835) [-534.332] (-535.440) (-538.432) * (-534.782) (-538.328) [-534.625] (-533.682) -- 0:00:52
534000 -- (-536.290) (-533.971) [-536.858] (-535.060) * (-535.172) (-531.891) [-535.348] (-536.964) -- 0:00:52
534500 -- [-530.043] (-532.728) (-538.934) (-536.244) * (-536.744) (-534.853) (-535.959) [-538.080] -- 0:00:52
535000 -- (-533.329) [-532.934] (-536.618) (-538.848) * (-535.396) (-539.931) (-533.294) [-534.997] -- 0:00:52
Average standard deviation of split frequencies: 0.006450
535500 -- (-535.303) (-539.860) (-531.997) [-534.577] * [-537.217] (-534.205) (-535.304) (-536.159) -- 0:00:52
536000 -- (-533.784) (-537.165) (-536.286) [-540.329] * [-533.166] (-538.761) (-535.272) (-541.662) -- 0:00:51
536500 -- (-538.932) (-534.211) (-532.555) [-535.006] * (-534.072) (-535.275) (-535.347) [-539.429] -- 0:00:51
537000 -- [-535.310] (-535.965) (-537.359) (-536.752) * [-536.313] (-537.081) (-545.662) (-533.629) -- 0:00:51
537500 -- (-534.202) [-534.260] (-535.627) (-539.162) * (-537.036) (-538.524) [-537.015] (-535.950) -- 0:00:51
538000 -- (-535.054) [-534.407] (-541.620) (-542.156) * [-535.844] (-535.464) (-547.808) (-543.714) -- 0:00:51
538500 -- (-539.729) (-533.476) [-536.238] (-540.724) * (-531.689) (-538.684) (-534.986) [-538.182] -- 0:00:51
539000 -- [-537.526] (-534.712) (-531.894) (-538.275) * [-535.734] (-535.087) (-537.536) (-535.193) -- 0:00:51
539500 -- (-535.175) [-534.268] (-536.163) (-542.429) * (-536.365) (-537.120) (-537.558) [-536.205] -- 0:00:51
540000 -- [-537.528] (-538.041) (-533.970) (-537.998) * (-535.760) (-542.733) (-539.250) [-535.160] -- 0:00:51
Average standard deviation of split frequencies: 0.006975
540500 -- (-534.595) (-536.653) [-541.658] (-539.427) * (-535.446) (-538.464) [-545.443] (-536.656) -- 0:00:51
541000 -- [-535.345] (-538.229) (-535.960) (-536.997) * [-534.680] (-541.726) (-539.720) (-539.397) -- 0:00:50
541500 -- (-533.750) (-532.266) (-535.164) [-531.218] * [-533.678] (-545.661) (-545.207) (-538.721) -- 0:00:51
542000 -- [-537.923] (-536.887) (-534.127) (-538.163) * (-534.423) (-535.572) (-534.038) [-535.281] -- 0:00:51
542500 -- (-536.434) (-535.690) [-534.905] (-538.056) * (-536.346) (-536.275) [-535.119] (-538.648) -- 0:00:51
543000 -- (-536.340) (-536.026) (-534.172) [-538.153] * (-537.456) (-541.995) (-536.698) [-534.779] -- 0:00:51
543500 -- [-537.745] (-538.958) (-539.791) (-534.933) * (-535.384) [-533.143] (-535.462) (-546.728) -- 0:00:51
544000 -- (-535.985) (-542.862) (-530.943) [-536.457] * (-533.759) (-538.150) (-534.148) [-533.621] -- 0:00:51
544500 -- (-532.894) (-543.236) [-534.831] (-535.194) * [-532.724] (-534.673) (-535.758) (-534.563) -- 0:00:51
545000 -- (-535.084) (-538.684) [-533.883] (-536.204) * [-534.857] (-537.852) (-536.238) (-534.376) -- 0:00:50
Average standard deviation of split frequencies: 0.008058
545500 -- (-534.654) [-536.246] (-536.578) (-533.048) * (-536.332) (-535.651) (-532.140) [-534.214] -- 0:00:50
546000 -- (-536.109) (-537.539) [-534.639] (-537.035) * (-533.123) [-537.437] (-539.886) (-538.044) -- 0:00:50
546500 -- (-540.908) (-536.043) [-533.105] (-536.351) * (-532.415) [-537.201] (-538.504) (-534.676) -- 0:00:50
547000 -- (-539.611) (-535.147) [-536.091] (-535.976) * (-530.268) (-540.891) [-537.859] (-534.169) -- 0:00:50
547500 -- (-539.299) (-533.754) (-538.042) [-535.542] * (-534.953) (-539.608) [-538.461] (-530.939) -- 0:00:50
548000 -- (-545.840) [-538.707] (-536.157) (-536.222) * [-534.595] (-537.622) (-534.895) (-537.051) -- 0:00:50
548500 -- (-538.196) (-540.012) (-535.548) [-537.195] * [-535.227] (-534.646) (-538.334) (-536.134) -- 0:00:50
549000 -- (-535.905) (-539.037) [-534.743] (-541.349) * [-532.619] (-534.951) (-537.616) (-534.752) -- 0:00:50
549500 -- (-541.630) (-537.225) [-535.535] (-541.393) * (-541.761) (-537.417) (-536.159) [-532.427] -- 0:00:50
550000 -- (-537.123) (-535.161) [-532.787] (-536.246) * [-535.801] (-535.587) (-534.952) (-533.963) -- 0:00:49
Average standard deviation of split frequencies: 0.007990
550500 -- (-537.406) [-533.647] (-538.243) (-535.377) * [-538.073] (-536.472) (-534.475) (-537.158) -- 0:00:50
551000 -- [-534.487] (-537.206) (-540.181) (-539.573) * (-542.354) (-536.156) [-539.702] (-536.895) -- 0:00:50
551500 -- (-532.644) (-537.960) [-538.952] (-535.739) * (-538.855) (-536.436) (-533.809) [-538.832] -- 0:00:50
552000 -- [-534.616] (-536.221) (-542.143) (-539.287) * (-539.146) (-533.115) [-537.385] (-533.888) -- 0:00:50
552500 -- (-535.055) [-533.233] (-534.871) (-537.384) * (-533.521) (-535.189) [-532.579] (-534.476) -- 0:00:50
553000 -- (-544.250) (-536.452) (-536.581) [-534.101] * (-535.853) (-539.764) [-533.597] (-539.138) -- 0:00:50
553500 -- (-536.457) [-534.146] (-543.948) (-537.015) * (-531.336) (-541.849) (-537.566) [-536.680] -- 0:00:50
554000 -- [-538.683] (-532.974) (-536.893) (-538.308) * (-535.859) (-539.988) [-533.714] (-548.725) -- 0:00:49
554500 -- (-532.433) (-544.451) [-535.197] (-534.584) * (-540.294) [-535.266] (-531.969) (-538.107) -- 0:00:49
555000 -- (-542.094) (-535.101) (-531.494) [-540.859] * [-536.515] (-534.707) (-538.646) (-536.595) -- 0:00:49
Average standard deviation of split frequencies: 0.007913
555500 -- (-531.898) (-539.365) (-535.883) [-547.263] * [-534.875] (-542.520) (-534.616) (-542.263) -- 0:00:49
556000 -- (-532.429) (-539.513) (-538.643) [-536.216] * (-537.317) [-540.478] (-537.268) (-542.701) -- 0:00:49
556500 -- (-534.191) (-535.466) [-531.824] (-537.613) * (-539.115) (-539.543) [-530.298] (-535.151) -- 0:00:49
557000 -- (-534.741) (-535.319) [-540.830] (-537.613) * (-540.863) (-532.586) (-532.037) [-550.880] -- 0:00:49
557500 -- [-534.949] (-534.563) (-537.547) (-536.405) * (-539.113) [-532.684] (-537.097) (-537.959) -- 0:00:49
558000 -- [-539.041] (-535.404) (-532.977) (-536.754) * (-533.880) (-535.068) [-542.224] (-540.804) -- 0:00:49
558500 -- (-539.118) (-536.382) [-534.361] (-536.517) * [-536.945] (-543.681) (-536.323) (-543.945) -- 0:00:49
559000 -- (-544.524) (-535.154) [-538.217] (-537.096) * [-536.233] (-532.093) (-537.153) (-536.838) -- 0:00:48
559500 -- (-538.804) (-533.204) [-537.753] (-537.186) * (-539.602) (-541.351) [-539.825] (-543.925) -- 0:00:49
560000 -- (-540.008) (-536.997) (-533.142) [-533.779] * (-540.287) [-537.520] (-537.043) (-537.796) -- 0:00:49
Average standard deviation of split frequencies: 0.007287
560500 -- (-538.777) [-534.312] (-538.800) (-536.397) * (-534.204) [-537.531] (-538.396) (-538.758) -- 0:00:49
561000 -- (-534.357) (-534.927) (-537.050) [-535.941] * (-536.690) [-540.156] (-539.276) (-539.661) -- 0:00:49
561500 -- (-536.195) (-538.123) [-535.989] (-535.496) * (-538.145) [-536.305] (-538.840) (-542.212) -- 0:00:49
562000 -- (-536.961) (-535.568) (-540.198) [-537.418] * (-542.899) (-533.083) (-534.219) [-533.525] -- 0:00:49
562500 -- (-535.065) (-542.095) (-537.561) [-534.093] * [-531.581] (-535.194) (-536.447) (-539.596) -- 0:00:49
563000 -- (-537.055) (-533.539) (-536.606) [-538.374] * [-539.538] (-534.145) (-536.974) (-536.927) -- 0:00:48
563500 -- (-537.316) (-534.967) (-538.637) [-534.487] * (-534.009) (-535.418) (-541.280) [-537.339] -- 0:00:48
564000 -- (-537.979) (-535.372) (-535.430) [-530.896] * (-537.621) [-533.957] (-535.985) (-535.618) -- 0:00:48
564500 -- (-535.420) (-537.429) (-537.011) [-536.889] * (-539.629) [-534.771] (-537.144) (-539.095) -- 0:00:48
565000 -- [-534.738] (-538.293) (-535.702) (-536.695) * (-535.542) [-534.665] (-542.730) (-537.214) -- 0:00:48
Average standard deviation of split frequencies: 0.007773
565500 -- (-536.176) (-533.920) (-534.619) [-544.027] * (-540.007) [-532.683] (-541.322) (-545.588) -- 0:00:48
566000 -- [-533.644] (-537.465) (-540.835) (-546.715) * [-539.330] (-539.173) (-542.704) (-538.676) -- 0:00:48
566500 -- (-542.616) [-536.240] (-544.854) (-540.846) * [-536.242] (-539.216) (-539.157) (-540.380) -- 0:00:48
567000 -- (-538.112) [-535.665] (-535.290) (-537.939) * (-537.099) (-533.334) [-537.297] (-539.884) -- 0:00:48
567500 -- [-535.020] (-534.554) (-537.582) (-545.961) * [-535.555] (-537.166) (-537.470) (-540.820) -- 0:00:48
568000 -- [-539.237] (-536.529) (-537.560) (-538.555) * [-536.537] (-533.437) (-534.429) (-547.706) -- 0:00:47
568500 -- (-536.742) (-539.115) [-537.573] (-541.948) * (-533.410) (-538.756) [-536.047] (-538.760) -- 0:00:47
569000 -- (-532.805) (-532.501) [-536.613] (-539.614) * (-543.322) (-535.520) (-532.790) [-534.684] -- 0:00:48
569500 -- (-536.434) (-536.015) [-534.648] (-537.190) * (-534.455) (-539.935) (-537.892) [-536.435] -- 0:00:48
570000 -- [-536.894] (-540.923) (-535.792) (-543.664) * (-538.526) (-542.191) (-533.790) [-537.735] -- 0:00:48
Average standard deviation of split frequencies: 0.006608
570500 -- [-536.848] (-538.209) (-538.118) (-545.005) * [-540.257] (-536.446) (-536.252) (-535.582) -- 0:00:48
571000 -- (-535.898) (-540.846) (-546.161) [-536.099] * (-538.677) [-537.739] (-536.302) (-540.473) -- 0:00:48
571500 -- [-533.209] (-540.019) (-541.048) (-541.678) * [-538.498] (-534.173) (-536.745) (-540.270) -- 0:00:47
572000 -- (-535.092) [-534.717] (-535.710) (-534.303) * (-542.731) [-536.662] (-537.020) (-538.302) -- 0:00:47
572500 -- [-536.478] (-535.843) (-540.652) (-535.714) * (-535.619) (-537.513) [-536.269] (-535.919) -- 0:00:47
573000 -- [-537.264] (-532.397) (-532.646) (-534.767) * (-533.037) [-539.321] (-538.192) (-537.144) -- 0:00:47
573500 -- (-531.960) (-532.590) (-535.017) [-535.232] * (-534.343) [-533.001] (-535.428) (-539.868) -- 0:00:47
574000 -- (-537.635) (-536.451) (-531.652) [-534.710] * (-534.788) [-531.700] (-532.877) (-539.034) -- 0:00:47
574500 -- (-536.231) (-539.752) [-538.936] (-538.941) * (-531.676) (-532.451) [-534.090] (-534.911) -- 0:00:47
575000 -- [-538.599] (-539.089) (-536.737) (-536.965) * [-535.069] (-538.078) (-542.366) (-534.576) -- 0:00:47
Average standard deviation of split frequencies: 0.006547
575500 -- (-533.712) (-536.217) (-539.726) [-533.627] * [-535.476] (-537.275) (-541.962) (-535.845) -- 0:00:47
576000 -- (-535.630) [-534.097] (-541.783) (-533.882) * (-540.262) [-540.671] (-538.411) (-545.403) -- 0:00:47
576500 -- (-532.808) (-539.462) (-537.161) [-536.867] * (-537.488) [-540.154] (-537.041) (-534.078) -- 0:00:47
577000 -- (-536.128) [-533.734] (-536.874) (-533.784) * (-537.022) (-539.025) (-535.497) [-534.502] -- 0:00:46
577500 -- (-535.722) (-533.280) (-537.065) [-534.394] * [-536.570] (-537.660) (-539.535) (-532.587) -- 0:00:46
578000 -- (-535.627) (-532.956) (-536.212) [-534.680] * [-537.318] (-541.117) (-539.292) (-533.836) -- 0:00:47
578500 -- [-532.411] (-532.805) (-534.645) (-532.673) * (-537.067) (-539.895) (-543.735) [-530.496] -- 0:00:47
579000 -- (-532.731) (-541.111) [-535.782] (-534.293) * [-538.073] (-536.901) (-541.364) (-535.505) -- 0:00:47
579500 -- [-540.805] (-537.564) (-534.703) (-535.195) * (-538.771) [-540.347] (-539.448) (-535.260) -- 0:00:47
580000 -- (-539.250) [-534.414] (-536.832) (-537.899) * (-538.601) [-539.982] (-540.448) (-536.290) -- 0:00:47
Average standard deviation of split frequencies: 0.004871
580500 -- (-536.143) [-535.923] (-540.260) (-532.459) * (-540.007) (-537.786) (-539.631) [-534.739] -- 0:00:46
581000 -- (-537.439) (-534.590) (-538.347) [-537.225] * (-533.931) (-540.058) [-537.406] (-538.140) -- 0:00:46
581500 -- (-533.569) [-539.745] (-533.935) (-539.080) * (-535.276) (-542.645) (-539.478) [-533.243] -- 0:00:46
582000 -- [-531.915] (-535.715) (-531.516) (-542.847) * (-540.181) (-532.925) (-535.345) [-533.908] -- 0:00:46
582500 -- (-534.875) (-535.897) (-535.330) [-533.831] * (-536.955) [-533.874] (-534.912) (-533.308) -- 0:00:46
583000 -- (-542.760) (-541.756) (-535.723) [-532.740] * [-539.804] (-533.956) (-534.375) (-533.044) -- 0:00:46
583500 -- (-541.173) (-537.165) [-532.466] (-537.099) * (-537.905) [-535.361] (-532.055) (-543.594) -- 0:00:46
584000 -- (-538.890) (-535.364) [-535.133] (-540.299) * [-537.904] (-539.979) (-539.049) (-537.372) -- 0:00:46
584500 -- [-534.067] (-538.281) (-534.685) (-537.072) * (-542.622) (-543.830) (-534.845) [-533.310] -- 0:00:46
585000 -- [-533.544] (-544.226) (-539.914) (-534.061) * [-537.338] (-536.844) (-541.463) (-534.972) -- 0:00:46
Average standard deviation of split frequencies: 0.004827
585500 -- (-537.756) [-533.803] (-540.150) (-536.950) * (-539.468) (-532.492) [-537.490] (-537.722) -- 0:00:46
586000 -- (-534.178) (-534.834) [-539.500] (-535.182) * [-536.801] (-535.385) (-538.627) (-533.381) -- 0:00:45
586500 -- (-534.397) (-540.339) (-537.399) [-538.537] * (-537.936) (-531.018) (-536.532) [-534.406] -- 0:00:45
587000 -- (-540.079) (-533.385) (-544.349) [-537.209] * (-538.572) (-537.461) (-536.216) [-533.583] -- 0:00:46
587500 -- [-534.278] (-536.859) (-538.098) (-541.877) * (-536.652) [-534.932] (-532.189) (-537.537) -- 0:00:46
588000 -- (-536.330) (-534.430) (-534.682) [-533.585] * (-535.367) (-533.829) (-538.674) [-535.448] -- 0:00:46
588500 -- (-535.100) (-536.351) [-533.014] (-537.490) * (-537.694) [-534.159] (-534.474) (-534.085) -- 0:00:46
589000 -- (-543.415) (-535.347) (-537.300) [-540.181] * (-534.506) [-536.991] (-532.305) (-537.520) -- 0:00:46
589500 -- (-538.396) [-540.523] (-537.600) (-538.758) * (-537.607) (-539.482) (-533.223) [-535.955] -- 0:00:45
590000 -- [-537.106] (-538.648) (-537.578) (-540.250) * [-538.326] (-537.765) (-536.856) (-538.328) -- 0:00:45
Average standard deviation of split frequencies: 0.004256
590500 -- (-535.527) [-539.727] (-541.225) (-541.553) * (-532.405) [-536.922] (-533.607) (-538.506) -- 0:00:45
591000 -- [-532.232] (-534.961) (-538.830) (-539.337) * (-536.494) (-536.636) [-538.725] (-535.835) -- 0:00:45
591500 -- (-541.154) (-535.507) [-537.637] (-537.405) * [-538.162] (-534.606) (-536.698) (-536.960) -- 0:00:45
592000 -- (-534.329) (-538.171) (-534.471) [-540.496] * [-535.277] (-539.950) (-540.734) (-538.198) -- 0:00:45
592500 -- [-535.100] (-537.323) (-532.908) (-536.286) * (-535.705) [-537.545] (-543.323) (-534.469) -- 0:00:45
593000 -- (-538.145) (-539.567) (-532.865) [-532.078] * (-535.522) (-536.089) (-538.980) [-532.651] -- 0:00:45
593500 -- [-536.750] (-537.561) (-532.989) (-534.265) * (-532.399) (-537.405) [-531.987] (-538.052) -- 0:00:45
594000 -- (-539.345) (-540.784) [-542.521] (-538.296) * (-541.148) (-537.349) (-532.349) [-535.690] -- 0:00:45
594500 -- (-542.355) (-539.334) (-531.748) [-536.800] * (-533.309) (-536.960) (-537.465) [-536.806] -- 0:00:45
595000 -- (-537.942) [-538.468] (-538.000) (-537.625) * [-538.019] (-536.101) (-533.455) (-533.681) -- 0:00:44
Average standard deviation of split frequencies: 0.004218
595500 -- (-536.161) (-532.882) (-539.213) [-537.190] * (-538.225) [-540.176] (-533.574) (-534.977) -- 0:00:44
596000 -- [-538.327] (-539.294) (-541.922) (-546.145) * (-543.940) [-536.384] (-534.881) (-533.176) -- 0:00:45
596500 -- [-532.802] (-534.965) (-535.372) (-544.031) * (-534.251) (-534.649) (-538.185) [-537.963] -- 0:00:45
597000 -- (-538.560) (-535.109) [-537.017] (-534.541) * (-538.238) [-534.914] (-533.716) (-539.760) -- 0:00:45
597500 -- (-537.180) (-533.235) [-537.727] (-535.490) * (-534.464) (-541.084) (-536.157) [-535.976] -- 0:00:45
598000 -- (-533.051) [-533.543] (-537.521) (-535.458) * (-538.867) (-539.606) [-537.073] (-539.905) -- 0:00:45
598500 -- (-535.401) [-533.741] (-538.709) (-534.364) * (-532.014) (-538.235) (-540.149) [-535.130] -- 0:00:44
599000 -- [-535.056] (-535.338) (-541.708) (-541.830) * (-540.146) (-534.406) [-533.060] (-538.449) -- 0:00:44
599500 -- (-539.565) (-533.745) [-547.225] (-537.915) * [-534.569] (-539.120) (-533.566) (-543.263) -- 0:00:44
600000 -- (-534.380) [-535.138] (-535.968) (-536.871) * [-536.035] (-533.051) (-538.097) (-539.565) -- 0:00:44
Average standard deviation of split frequencies: 0.001570
600500 -- (-537.934) [-534.772] (-546.141) (-535.762) * (-538.104) [-536.197] (-536.562) (-534.447) -- 0:00:44
601000 -- [-533.862] (-544.852) (-543.762) (-541.369) * (-541.873) (-536.223) [-538.532] (-537.597) -- 0:00:44
601500 -- (-537.948) (-537.288) (-539.123) [-536.394] * (-538.367) (-532.401) (-538.680) [-537.632] -- 0:00:44
602000 -- [-536.641] (-538.219) (-534.633) (-533.016) * (-544.720) (-534.652) (-540.843) [-535.983] -- 0:00:44
602500 -- (-533.049) (-534.263) (-536.921) [-533.393] * (-535.827) [-534.932] (-536.447) (-532.666) -- 0:00:44
603000 -- (-531.219) (-532.585) [-532.271] (-533.471) * [-536.073] (-539.293) (-536.147) (-545.617) -- 0:00:44
603500 -- (-534.160) (-535.059) (-536.494) [-536.363] * (-537.793) [-534.380] (-535.583) (-536.618) -- 0:00:44
604000 -- (-533.608) [-536.771] (-537.127) (-531.995) * (-538.312) (-533.748) (-537.983) [-539.828] -- 0:00:43
604500 -- (-536.751) (-535.642) [-533.196] (-534.884) * [-533.969] (-535.808) (-533.501) (-534.685) -- 0:00:43
605000 -- (-532.267) (-544.220) (-540.355) [-533.334] * [-532.186] (-536.249) (-538.305) (-532.864) -- 0:00:44
Average standard deviation of split frequencies: 0.002593
605500 -- [-541.438] (-534.806) (-535.125) (-536.695) * (-534.888) (-539.039) (-537.349) [-533.082] -- 0:00:44
606000 -- (-531.694) (-534.227) (-537.716) [-538.362] * (-539.638) (-534.465) [-539.372] (-534.402) -- 0:00:44
606500 -- (-535.952) [-539.869] (-536.160) (-540.957) * (-536.488) (-530.640) (-542.492) [-532.477] -- 0:00:44
607000 -- (-536.823) (-536.535) (-534.947) [-536.803] * [-544.802] (-539.541) (-538.880) (-537.234) -- 0:00:44
607500 -- (-534.689) [-534.925] (-539.701) (-535.334) * (-538.443) (-536.090) (-539.973) [-536.091] -- 0:00:43
608000 -- [-533.842] (-541.620) (-549.693) (-534.452) * [-537.980] (-536.009) (-539.161) (-537.505) -- 0:00:43
608500 -- (-535.937) (-536.042) [-534.736] (-533.868) * (-536.143) (-537.964) (-539.474) [-533.181] -- 0:00:43
609000 -- [-535.041] (-536.876) (-533.500) (-542.306) * (-539.977) (-535.353) (-540.405) [-538.785] -- 0:00:43
609500 -- (-536.073) (-533.842) (-533.266) [-536.857] * (-536.826) (-534.497) (-538.663) [-535.315] -- 0:00:43
610000 -- (-535.737) [-534.201] (-539.371) (-540.556) * (-536.850) [-532.976] (-533.756) (-535.363) -- 0:00:43
Average standard deviation of split frequencies: 0.002059
610500 -- (-536.150) (-537.416) [-532.843] (-539.467) * (-535.944) (-532.705) (-534.920) [-534.690] -- 0:00:43
611000 -- [-533.149] (-536.510) (-535.041) (-539.813) * (-537.629) (-535.365) [-532.987] (-536.473) -- 0:00:43
611500 -- (-532.792) (-536.433) (-534.162) [-541.525] * (-542.537) (-538.158) [-539.785] (-535.356) -- 0:00:43
612000 -- (-536.407) [-537.525] (-536.352) (-546.983) * (-535.919) [-534.329] (-541.913) (-537.390) -- 0:00:43
612500 -- (-536.783) (-532.296) (-538.169) [-534.589] * (-535.771) (-535.181) [-536.310] (-535.351) -- 0:00:43
613000 -- (-534.250) [-534.139] (-537.581) (-535.446) * [-539.921] (-535.899) (-536.769) (-535.850) -- 0:00:42
613500 -- (-535.601) (-535.664) (-545.650) [-534.961] * [-533.101] (-533.614) (-532.283) (-537.977) -- 0:00:42
614000 -- (-535.000) [-541.079] (-536.960) (-537.640) * (-537.431) [-538.441] (-534.931) (-536.522) -- 0:00:43
614500 -- [-535.970] (-535.417) (-536.118) (-534.690) * (-541.698) (-532.609) [-537.441] (-540.543) -- 0:00:43
615000 -- (-538.391) (-536.583) (-539.777) [-542.121] * [-534.480] (-536.498) (-539.442) (-536.769) -- 0:00:43
Average standard deviation of split frequencies: 0.002041
615500 -- (-535.241) [-533.238] (-535.470) (-537.349) * (-534.690) [-538.385] (-538.212) (-534.196) -- 0:00:43
616000 -- (-534.857) [-538.119] (-536.762) (-535.663) * (-535.238) [-533.040] (-536.683) (-534.364) -- 0:00:43
616500 -- [-538.639] (-532.788) (-533.224) (-538.902) * (-538.801) [-533.369] (-538.308) (-531.724) -- 0:00:42
617000 -- (-533.037) (-537.382) (-536.607) [-532.999] * (-536.306) (-534.692) (-536.791) [-536.293] -- 0:00:42
617500 -- (-534.320) [-535.601] (-542.937) (-533.050) * (-535.346) (-535.699) [-536.978] (-539.481) -- 0:00:42
618000 -- (-538.469) [-533.439] (-535.873) (-531.285) * (-535.379) (-537.331) (-537.375) [-531.861] -- 0:00:42
618500 -- (-533.765) (-536.083) [-533.603] (-539.822) * (-532.548) [-530.701] (-533.325) (-534.619) -- 0:00:42
619000 -- (-534.502) (-539.910) [-535.946] (-542.886) * (-534.268) [-534.255] (-534.804) (-532.867) -- 0:00:42
619500 -- (-544.376) [-533.852] (-535.872) (-535.529) * (-536.654) [-532.898] (-537.514) (-537.953) -- 0:00:42
620000 -- (-543.646) (-535.699) [-536.799] (-536.204) * [-533.451] (-534.297) (-544.069) (-537.359) -- 0:00:42
Average standard deviation of split frequencies: 0.002025
620500 -- (-535.284) (-536.070) (-534.561) [-534.185] * (-535.681) [-532.939] (-541.744) (-534.750) -- 0:00:42
621000 -- (-538.646) (-545.153) (-531.996) [-536.118] * (-534.248) [-535.007] (-534.979) (-532.278) -- 0:00:42
621500 -- [-536.008] (-531.072) (-542.209) (-531.724) * (-535.326) (-539.899) (-538.740) [-538.583] -- 0:00:42
622000 -- (-534.971) (-534.410) [-534.478] (-540.526) * [-533.656] (-537.719) (-539.194) (-538.260) -- 0:00:41
622500 -- [-534.806] (-535.869) (-534.565) (-537.290) * (-532.636) [-538.074] (-539.682) (-534.287) -- 0:00:41
623000 -- [-533.776] (-531.642) (-534.262) (-537.661) * [-532.684] (-538.321) (-537.321) (-536.978) -- 0:00:42
623500 -- [-533.294] (-540.238) (-536.537) (-538.564) * (-530.342) [-532.595] (-536.935) (-534.466) -- 0:00:42
624000 -- (-533.638) (-539.626) [-540.954] (-533.405) * [-536.825] (-537.911) (-535.314) (-533.836) -- 0:00:42
624500 -- [-539.521] (-532.899) (-535.666) (-533.044) * (-532.025) (-537.057) (-536.240) [-532.829] -- 0:00:42
625000 -- (-536.047) [-536.523] (-539.593) (-533.878) * [-536.698] (-538.869) (-543.413) (-535.032) -- 0:00:42
Average standard deviation of split frequencies: 0.001506
625500 -- (-533.997) (-539.291) [-537.197] (-536.364) * (-536.853) (-541.658) (-535.461) [-537.484] -- 0:00:41
626000 -- (-537.742) (-542.358) (-536.131) [-538.509] * [-533.491] (-533.375) (-536.248) (-543.882) -- 0:00:41
626500 -- (-539.683) (-543.474) (-536.988) [-534.216] * (-531.962) [-533.914] (-532.150) (-540.892) -- 0:00:41
627000 -- (-536.937) (-535.999) (-538.179) [-535.914] * (-537.584) (-537.360) [-538.360] (-540.399) -- 0:00:41
627500 -- [-543.191] (-540.450) (-535.024) (-541.243) * (-533.464) (-535.423) [-541.957] (-542.280) -- 0:00:41
628000 -- (-540.180) [-534.276] (-536.110) (-541.800) * (-541.932) (-535.969) [-533.848] (-534.472) -- 0:00:41
628500 -- (-538.150) [-533.960] (-539.297) (-538.751) * (-540.410) [-535.832] (-537.259) (-542.425) -- 0:00:41
629000 -- (-535.474) (-540.549) [-534.412] (-538.886) * (-537.578) [-534.051] (-534.031) (-531.533) -- 0:00:41
629500 -- (-535.541) (-536.113) [-532.168] (-537.102) * [-535.860] (-538.314) (-535.479) (-531.701) -- 0:00:41
630000 -- (-533.306) (-538.850) (-531.952) [-532.964] * (-536.587) (-532.568) (-538.271) [-532.380] -- 0:00:41
Average standard deviation of split frequencies: 0.002492
630500 -- (-535.129) (-537.656) [-536.703] (-535.211) * (-537.604) [-534.844] (-531.741) (-532.725) -- 0:00:41
631000 -- (-534.409) (-537.493) (-541.593) [-541.573] * [-542.658] (-533.947) (-534.000) (-533.637) -- 0:00:40
631500 -- (-534.006) [-534.076] (-540.336) (-536.197) * (-536.027) (-535.547) [-536.972] (-538.775) -- 0:00:40
632000 -- [-533.583] (-534.084) (-535.164) (-538.936) * (-538.560) [-536.034] (-536.339) (-540.372) -- 0:00:40
632500 -- (-534.125) [-533.276] (-535.991) (-536.160) * (-541.449) (-538.786) (-539.910) [-533.226] -- 0:00:41
633000 -- [-535.160] (-536.002) (-533.595) (-533.091) * [-539.569] (-541.436) (-545.309) (-538.582) -- 0:00:41
633500 -- (-536.185) (-537.165) [-530.587] (-533.977) * (-537.539) (-533.577) (-536.918) [-537.820] -- 0:00:41
634000 -- (-547.119) [-532.802] (-534.176) (-538.755) * [-536.028] (-538.561) (-533.847) (-535.760) -- 0:00:40
634500 -- (-540.656) (-537.548) (-533.700) [-538.428] * (-540.178) (-536.166) (-532.783) [-536.803] -- 0:00:40
635000 -- [-536.917] (-534.937) (-534.524) (-541.589) * (-538.857) [-533.967] (-534.157) (-536.468) -- 0:00:40
Average standard deviation of split frequencies: 0.003459
635500 -- [-532.317] (-545.490) (-534.090) (-538.735) * (-535.300) (-540.726) [-533.018] (-537.328) -- 0:00:40
636000 -- [-538.038] (-543.741) (-536.217) (-539.905) * (-536.815) (-539.664) [-537.231] (-532.542) -- 0:00:40
636500 -- [-532.560] (-532.249) (-544.941) (-537.422) * (-538.022) (-533.331) [-536.978] (-538.620) -- 0:00:40
637000 -- (-534.444) (-536.243) (-534.455) [-532.049] * [-534.881] (-538.717) (-538.431) (-535.978) -- 0:00:40
637500 -- (-532.255) (-538.214) (-532.499) [-535.237] * (-540.042) (-540.890) [-538.785] (-543.282) -- 0:00:40
638000 -- (-544.000) (-545.134) [-534.148] (-534.064) * (-533.274) (-534.606) (-536.965) [-533.732] -- 0:00:40
638500 -- [-541.718] (-534.727) (-537.353) (-539.658) * (-538.669) (-535.534) [-534.034] (-536.750) -- 0:00:40
639000 -- (-544.717) (-533.039) [-541.355] (-534.040) * (-539.228) (-537.609) (-539.624) [-533.196] -- 0:00:40
639500 -- (-539.980) (-535.267) (-536.282) [-533.549] * (-537.008) (-537.398) (-533.334) [-536.237] -- 0:00:40
640000 -- (-539.211) (-537.715) [-543.242] (-535.739) * [-532.499] (-545.708) (-530.906) (-541.400) -- 0:00:39
Average standard deviation of split frequencies: 0.004415
640500 -- (-538.226) (-538.198) (-540.903) [-540.075] * (-535.668) [-541.326] (-541.680) (-535.890) -- 0:00:39
641000 -- (-532.161) (-537.329) [-538.569] (-536.319) * (-535.356) (-542.927) (-538.659) [-532.492] -- 0:00:39
641500 -- (-535.566) (-540.162) [-538.129] (-536.403) * (-537.726) (-532.864) [-539.956] (-537.436) -- 0:00:40
642000 -- (-536.380) [-533.992] (-533.881) (-538.561) * (-541.337) (-535.332) [-536.793] (-532.192) -- 0:00:40
642500 -- (-536.819) (-544.059) (-536.295) [-532.902] * (-542.133) (-543.788) (-533.673) [-535.861] -- 0:00:40
643000 -- (-543.895) (-541.438) [-535.791] (-544.934) * (-533.786) [-540.376] (-538.149) (-533.264) -- 0:00:39
643500 -- (-536.318) [-538.408] (-537.517) (-538.643) * (-539.736) (-539.896) (-537.725) [-534.254] -- 0:00:39
644000 -- (-537.067) (-544.717) [-533.400] (-531.508) * [-531.172] (-534.940) (-533.471) (-534.843) -- 0:00:39
644500 -- (-536.925) (-537.596) (-540.548) [-534.245] * (-535.998) (-534.694) [-539.259] (-537.586) -- 0:00:39
645000 -- [-533.192] (-540.463) (-536.692) (-537.245) * [-536.858] (-541.323) (-534.722) (-533.533) -- 0:00:39
Average standard deviation of split frequencies: 0.005351
645500 -- (-534.543) (-538.440) [-537.836] (-538.529) * (-540.959) (-544.229) (-539.485) [-535.022] -- 0:00:39
646000 -- (-539.200) [-538.991] (-536.499) (-537.190) * (-537.613) (-540.249) [-533.272] (-533.603) -- 0:00:39
646500 -- (-540.115) (-538.843) [-535.558] (-536.144) * (-536.449) [-537.448] (-535.050) (-542.035) -- 0:00:39
647000 -- (-535.242) (-533.844) (-539.866) [-535.234] * (-534.429) (-537.989) [-536.275] (-540.601) -- 0:00:39
647500 -- (-535.898) (-536.600) (-538.422) [-536.192] * (-537.575) (-535.732) (-534.202) [-537.890] -- 0:00:39
648000 -- (-536.159) (-535.334) (-544.304) [-533.588] * [-533.670] (-533.413) (-545.646) (-535.109) -- 0:00:39
648500 -- [-536.556] (-533.369) (-539.751) (-535.697) * [-532.373] (-536.213) (-537.675) (-538.438) -- 0:00:39
649000 -- (-535.614) [-536.965] (-542.105) (-539.863) * (-535.099) (-532.086) [-534.953] (-536.614) -- 0:00:38
649500 -- (-535.985) (-539.218) (-544.223) [-533.155] * (-535.050) (-536.546) (-537.138) [-536.066] -- 0:00:38
650000 -- (-535.814) (-539.081) (-539.743) [-535.988] * [-535.948] (-537.043) (-533.413) (-532.280) -- 0:00:38
Average standard deviation of split frequencies: 0.004347
650500 -- [-534.343] (-541.125) (-536.437) (-535.498) * (-536.411) (-542.057) [-531.969] (-533.246) -- 0:00:39
651000 -- (-531.397) (-539.261) [-535.124] (-535.583) * (-541.880) (-537.080) (-530.429) [-536.580] -- 0:00:39
651500 -- (-544.393) (-537.608) (-540.358) [-532.580] * (-535.537) [-534.109] (-539.586) (-535.172) -- 0:00:39
652000 -- (-539.464) (-541.125) (-539.749) [-533.213] * (-541.472) (-534.880) [-538.403] (-536.507) -- 0:00:38
652500 -- (-543.617) (-534.635) [-538.384] (-540.304) * (-542.612) [-536.597] (-533.485) (-533.820) -- 0:00:38
653000 -- (-539.768) [-537.236] (-542.170) (-541.010) * [-533.533] (-542.547) (-533.256) (-535.956) -- 0:00:38
653500 -- (-539.557) (-535.443) (-541.676) [-538.717] * (-540.894) (-534.060) (-536.960) [-535.137] -- 0:00:38
654000 -- [-541.230] (-539.128) (-537.410) (-538.381) * (-537.328) [-539.485] (-549.167) (-538.499) -- 0:00:38
654500 -- (-540.826) [-539.819] (-540.170) (-535.951) * [-536.713] (-531.999) (-536.990) (-536.566) -- 0:00:38
655000 -- [-536.547] (-536.430) (-537.020) (-535.074) * (-535.309) (-535.694) [-533.161] (-536.131) -- 0:00:38
Average standard deviation of split frequencies: 0.005270
655500 -- (-535.721) [-538.517] (-531.911) (-541.196) * [-535.919] (-540.191) (-535.909) (-539.027) -- 0:00:38
656000 -- [-533.285] (-540.273) (-537.268) (-534.138) * (-532.166) (-538.509) [-537.896] (-537.064) -- 0:00:38
656500 -- (-533.911) (-538.374) (-540.188) [-533.347] * [-534.076] (-534.655) (-539.585) (-543.572) -- 0:00:38
657000 -- [-537.173] (-542.172) (-536.253) (-537.745) * (-535.503) (-538.288) [-533.918] (-546.770) -- 0:00:38
657500 -- [-535.794] (-537.042) (-534.068) (-537.555) * (-535.613) (-536.549) [-530.264] (-542.120) -- 0:00:38
658000 -- (-535.717) [-533.108] (-536.089) (-532.471) * (-534.196) (-536.957) (-535.564) [-539.530] -- 0:00:37
658500 -- (-533.690) (-533.866) (-538.130) [-535.099] * [-531.348] (-539.690) (-532.967) (-539.643) -- 0:00:38
659000 -- [-533.811] (-537.451) (-535.813) (-535.082) * (-536.955) (-535.578) [-539.035] (-539.057) -- 0:00:38
659500 -- (-545.069) [-535.379] (-536.809) (-539.251) * (-533.113) (-534.392) (-541.150) [-534.719] -- 0:00:38
660000 -- (-538.153) (-536.582) (-538.499) [-533.586] * (-546.386) [-533.922] (-539.997) (-534.983) -- 0:00:38
Average standard deviation of split frequencies: 0.004281
660500 -- (-536.313) (-543.639) (-539.383) [-530.706] * (-534.099) (-542.521) [-540.558] (-538.113) -- 0:00:38
661000 -- (-535.561) [-540.209] (-542.834) (-533.494) * (-535.941) (-536.774) (-536.950) [-535.814] -- 0:00:37
661500 -- [-538.574] (-536.303) (-535.869) (-533.550) * (-535.108) [-536.364] (-534.362) (-538.446) -- 0:00:37
662000 -- (-531.275) (-541.695) (-531.266) [-538.696] * (-538.254) [-534.297] (-541.877) (-539.719) -- 0:00:37
662500 -- (-535.065) (-544.506) [-531.260] (-540.472) * (-536.922) (-533.734) [-536.003] (-534.282) -- 0:00:37
663000 -- (-542.738) [-535.039] (-536.298) (-535.420) * (-535.367) (-539.390) (-537.845) [-531.869] -- 0:00:37
663500 -- (-534.705) (-535.770) (-532.530) [-538.577] * (-539.820) (-535.793) (-544.436) [-535.375] -- 0:00:37
664000 -- [-536.247] (-540.910) (-537.276) (-533.208) * (-534.066) (-537.247) (-540.254) [-539.037] -- 0:00:37
664500 -- (-537.605) [-539.070] (-533.693) (-537.317) * (-533.465) (-539.890) [-535.930] (-537.084) -- 0:00:37
665000 -- (-532.013) (-543.513) (-536.303) [-534.116] * (-537.202) (-534.653) [-535.695] (-535.561) -- 0:00:37
Average standard deviation of split frequencies: 0.004247
665500 -- (-538.702) (-543.975) (-538.103) [-536.715] * (-537.205) (-541.867) [-531.143] (-535.675) -- 0:00:37
666000 -- (-538.219) (-535.281) [-535.169] (-536.115) * (-534.432) (-535.000) (-541.663) [-540.169] -- 0:00:37
666500 -- (-536.704) (-536.134) (-540.025) [-544.445] * (-535.226) (-548.903) [-535.521] (-540.354) -- 0:00:37
667000 -- (-536.471) [-533.901] (-538.116) (-541.437) * [-533.074] (-534.716) (-535.439) (-536.410) -- 0:00:36
667500 -- (-537.922) [-535.169] (-535.562) (-539.585) * (-533.928) (-540.649) [-535.884] (-536.748) -- 0:00:37
668000 -- (-542.991) (-532.771) (-536.957) [-533.726] * (-533.398) (-537.196) (-536.506) [-541.665] -- 0:00:37
668500 -- [-533.476] (-536.600) (-535.994) (-539.635) * (-531.274) (-537.796) (-535.150) [-537.331] -- 0:00:37
669000 -- (-539.856) (-533.174) [-532.238] (-536.228) * (-533.649) [-538.358] (-548.241) (-538.684) -- 0:00:37
669500 -- [-533.965] (-538.016) (-535.780) (-539.021) * (-536.560) (-540.524) (-542.710) [-533.585] -- 0:00:37
670000 -- (-536.426) [-532.263] (-537.943) (-536.355) * (-532.409) (-536.989) (-547.750) [-539.462] -- 0:00:36
Average standard deviation of split frequencies: 0.003749
670500 -- [-537.052] (-534.867) (-530.517) (-536.436) * [-535.597] (-539.588) (-540.730) (-535.344) -- 0:00:36
671000 -- (-535.510) (-538.915) (-534.727) [-535.559] * (-539.245) (-547.716) [-538.816] (-537.809) -- 0:00:36
671500 -- [-535.903] (-534.748) (-535.363) (-535.765) * [-535.672] (-534.954) (-536.185) (-540.779) -- 0:00:36
672000 -- (-532.270) [-539.690] (-532.600) (-540.403) * (-539.519) [-539.723] (-537.229) (-536.929) -- 0:00:36
672500 -- (-537.864) (-539.229) [-535.321] (-533.005) * [-538.656] (-537.182) (-538.550) (-535.849) -- 0:00:36
673000 -- (-534.861) [-532.484] (-537.616) (-536.823) * (-540.728) [-536.724] (-536.336) (-535.764) -- 0:00:36
673500 -- (-534.918) [-533.747] (-537.875) (-531.193) * (-538.343) (-541.740) [-538.470] (-532.951) -- 0:00:36
674000 -- [-532.185] (-534.852) (-531.950) (-534.293) * (-540.697) [-537.863] (-540.220) (-533.399) -- 0:00:36
674500 -- (-539.202) (-533.268) [-532.627] (-540.089) * (-546.749) [-535.579] (-534.216) (-532.626) -- 0:00:36
675000 -- (-539.005) [-541.894] (-536.924) (-543.351) * (-540.473) (-536.533) [-536.978] (-531.933) -- 0:00:36
Average standard deviation of split frequencies: 0.003254
675500 -- (-537.400) (-532.063) [-532.117] (-538.356) * (-535.451) (-540.914) (-538.314) [-533.326] -- 0:00:36
676000 -- (-540.264) (-533.419) [-532.108] (-531.896) * (-544.992) (-532.585) [-539.874] (-539.970) -- 0:00:35
676500 -- (-536.214) [-535.030] (-535.142) (-539.932) * (-536.011) (-538.572) (-537.993) [-541.429] -- 0:00:36
677000 -- (-542.815) (-538.794) (-546.696) [-532.414] * (-536.430) (-541.818) (-538.675) [-534.748] -- 0:00:36
677500 -- (-535.582) [-533.202] (-538.844) (-536.119) * (-535.140) (-540.186) (-535.160) [-537.143] -- 0:00:36
678000 -- [-535.474] (-535.696) (-537.378) (-532.997) * (-538.732) (-533.859) [-532.910] (-533.251) -- 0:00:36
678500 -- (-535.165) (-532.606) [-535.442] (-532.015) * (-539.951) (-535.655) [-530.611] (-532.626) -- 0:00:36
679000 -- (-531.487) (-536.748) [-534.237] (-534.938) * (-532.667) (-532.059) (-534.413) [-538.363] -- 0:00:35
679500 -- [-535.274] (-533.079) (-537.764) (-532.609) * [-533.829] (-538.450) (-542.517) (-533.314) -- 0:00:35
680000 -- (-539.557) [-534.073] (-534.676) (-541.343) * [-534.065] (-538.166) (-542.007) (-537.725) -- 0:00:35
Average standard deviation of split frequencies: 0.004617
680500 -- [-534.050] (-535.396) (-535.413) (-534.961) * (-532.902) (-535.630) [-532.957] (-536.082) -- 0:00:35
681000 -- [-535.800] (-539.587) (-533.804) (-541.245) * (-534.417) (-533.149) (-544.582) [-534.387] -- 0:00:35
681500 -- (-534.791) (-535.095) (-535.355) [-542.950] * (-533.129) (-535.586) [-538.960] (-533.863) -- 0:00:35
682000 -- (-540.399) (-540.318) (-537.671) [-535.080] * (-533.422) (-535.335) [-546.995] (-537.623) -- 0:00:35
682500 -- (-540.857) (-540.307) (-537.887) [-532.734] * [-534.459] (-532.480) (-548.469) (-538.431) -- 0:00:35
683000 -- (-541.883) (-539.657) [-532.984] (-532.964) * (-538.991) [-530.969] (-543.135) (-537.013) -- 0:00:35
683500 -- [-533.529] (-536.474) (-532.051) (-536.751) * (-534.991) (-535.730) (-541.713) [-537.019] -- 0:00:35
684000 -- (-531.956) (-537.092) [-536.281] (-532.341) * [-536.782] (-534.213) (-538.585) (-536.143) -- 0:00:35
684500 -- (-544.193) (-540.333) [-537.346] (-533.194) * (-531.961) [-537.892] (-544.220) (-539.154) -- 0:00:35
685000 -- (-539.188) [-537.271] (-535.929) (-539.688) * (-533.242) [-534.511] (-535.759) (-532.404) -- 0:00:35
Average standard deviation of split frequencies: 0.005956
685500 -- (-536.118) (-537.594) [-535.169] (-539.589) * (-540.432) (-535.827) [-533.939] (-532.864) -- 0:00:35
686000 -- (-535.802) [-538.051] (-539.843) (-540.198) * (-539.350) (-534.936) (-538.508) [-535.697] -- 0:00:35
686500 -- (-538.452) (-537.832) [-535.620] (-533.580) * (-533.552) [-531.769] (-536.740) (-540.518) -- 0:00:35
687000 -- (-533.609) (-534.116) (-542.572) [-534.327] * [-534.730] (-532.768) (-541.096) (-533.986) -- 0:00:35
687500 -- [-539.350] (-536.365) (-536.699) (-533.421) * (-534.531) [-532.936] (-537.072) (-537.988) -- 0:00:35
688000 -- [-537.329] (-531.649) (-539.694) (-541.820) * (-533.889) (-535.097) (-534.949) [-531.272] -- 0:00:34
688500 -- [-536.799] (-532.066) (-542.298) (-534.587) * (-537.282) (-537.574) [-531.018] (-532.819) -- 0:00:34
689000 -- (-537.465) (-531.278) (-543.474) [-548.192] * (-539.502) (-534.386) [-533.791] (-532.993) -- 0:00:34
689500 -- (-536.224) [-533.989] (-534.095) (-539.457) * (-536.357) [-537.821] (-540.910) (-533.973) -- 0:00:34
690000 -- [-539.544] (-537.028) (-540.907) (-539.677) * (-536.135) (-544.538) (-532.548) [-534.997] -- 0:00:34
Average standard deviation of split frequencies: 0.004550
690500 -- (-537.387) [-532.889] (-534.871) (-541.433) * (-543.230) (-537.755) [-533.694] (-535.294) -- 0:00:34
691000 -- [-536.080] (-531.156) (-534.168) (-538.639) * (-537.581) [-532.462] (-536.351) (-534.860) -- 0:00:34
691500 -- (-534.222) [-536.793] (-541.265) (-532.387) * (-540.021) (-539.771) (-534.394) [-534.991] -- 0:00:34
692000 -- (-544.511) (-538.508) [-542.322] (-533.072) * (-547.915) [-537.612] (-539.204) (-533.781) -- 0:00:34
692500 -- [-534.341] (-536.131) (-532.801) (-535.630) * [-539.749] (-535.750) (-534.910) (-536.012) -- 0:00:34
693000 -- (-538.509) (-532.683) [-536.404] (-535.918) * (-538.046) (-536.418) [-534.423] (-537.772) -- 0:00:34
693500 -- (-538.544) (-537.051) [-538.835] (-536.997) * [-534.012] (-537.756) (-532.603) (-537.033) -- 0:00:34
694000 -- (-539.159) [-536.756] (-537.326) (-543.839) * (-532.610) (-544.827) [-535.031] (-540.260) -- 0:00:34
694500 -- (-539.513) (-538.818) [-541.992] (-536.282) * (-531.117) (-541.082) [-533.738] (-535.578) -- 0:00:34
695000 -- (-539.651) (-540.563) (-532.906) [-536.688] * [-534.789] (-540.995) (-533.662) (-532.034) -- 0:00:34
Average standard deviation of split frequencies: 0.004967
695500 -- (-541.753) (-532.095) [-535.093] (-533.043) * [-532.668] (-535.436) (-537.172) (-534.107) -- 0:00:34
696000 -- (-537.575) (-534.049) (-539.035) [-534.371] * (-534.412) (-545.735) [-536.794] (-536.656) -- 0:00:34
696500 -- [-533.914] (-538.015) (-541.812) (-537.644) * (-533.072) (-542.820) (-536.781) [-538.661] -- 0:00:33
697000 -- [-535.173] (-538.122) (-535.720) (-534.687) * (-542.421) (-543.921) (-536.172) [-534.510] -- 0:00:33
697500 -- (-533.153) [-535.359] (-536.191) (-543.592) * (-534.440) (-534.560) (-537.112) [-533.201] -- 0:00:33
698000 -- [-534.182] (-535.677) (-536.843) (-533.922) * (-538.560) (-539.690) [-536.718] (-537.842) -- 0:00:33
698500 -- (-531.303) [-534.199] (-538.580) (-534.196) * [-537.401] (-536.469) (-544.003) (-537.283) -- 0:00:33
699000 -- (-538.719) (-538.909) (-540.891) [-535.478] * (-535.098) (-537.491) [-533.364] (-536.058) -- 0:00:33
699500 -- (-537.837) (-538.262) (-545.882) [-534.130] * [-537.924] (-534.017) (-535.976) (-538.101) -- 0:00:33
700000 -- [-538.068] (-539.130) (-540.375) (-539.080) * [-533.289] (-539.495) (-539.790) (-534.756) -- 0:00:33
Average standard deviation of split frequencies: 0.004934
700500 -- (-533.990) (-534.527) [-540.677] (-534.065) * (-535.477) (-539.347) [-536.740] (-533.824) -- 0:00:33
701000 -- (-537.930) [-539.266] (-541.611) (-538.249) * (-534.521) (-535.626) [-540.451] (-531.620) -- 0:00:33
701500 -- [-535.689] (-539.195) (-537.832) (-536.169) * (-534.541) (-544.494) [-534.797] (-536.214) -- 0:00:33
702000 -- (-532.410) [-535.617] (-537.292) (-539.824) * (-540.307) (-541.193) (-537.650) [-533.149] -- 0:00:33
702500 -- (-535.171) (-539.756) (-538.744) [-540.510] * (-538.377) (-542.669) [-537.589] (-535.138) -- 0:00:33
703000 -- (-536.477) (-539.054) [-537.838] (-543.877) * (-535.836) (-538.658) [-534.869] (-536.467) -- 0:00:33
703500 -- (-535.175) (-544.630) [-531.565] (-541.232) * (-537.966) (-535.201) (-533.117) [-534.984] -- 0:00:33
704000 -- [-535.557] (-543.644) (-535.824) (-535.157) * (-533.416) [-532.346] (-539.163) (-539.507) -- 0:00:33
704500 -- (-536.283) (-538.358) (-533.461) [-535.543] * (-538.866) (-536.343) [-530.828] (-538.294) -- 0:00:33
705000 -- (-537.385) [-537.397] (-538.795) (-544.756) * (-538.419) (-533.123) [-534.850] (-539.465) -- 0:00:33
Average standard deviation of split frequencies: 0.004897
705500 -- (-530.347) [-535.017] (-535.113) (-534.268) * (-537.479) (-536.206) [-532.038] (-539.121) -- 0:00:32
706000 -- [-537.906] (-534.169) (-537.561) (-537.205) * (-535.324) (-532.505) (-537.912) [-534.173] -- 0:00:32
706500 -- (-536.552) [-533.980] (-541.497) (-536.338) * (-533.246) (-538.016) [-537.656] (-533.625) -- 0:00:32
707000 -- (-535.771) (-544.436) (-538.979) [-537.025] * (-542.698) (-538.236) [-534.872] (-537.500) -- 0:00:32
707500 -- (-536.621) (-543.262) (-537.067) [-534.702] * [-536.791] (-539.093) (-535.929) (-536.174) -- 0:00:32
708000 -- (-539.101) [-534.516] (-541.674) (-534.432) * (-538.236) (-538.365) (-537.767) [-533.023] -- 0:00:32
708500 -- (-546.033) (-535.457) (-540.895) [-536.080] * [-534.590] (-545.421) (-533.434) (-532.287) -- 0:00:32
709000 -- (-544.030) (-533.796) (-542.526) [-535.168] * [-533.584] (-541.189) (-538.326) (-532.060) -- 0:00:32
709500 -- [-537.453] (-537.240) (-539.253) (-533.994) * [-534.935] (-539.904) (-540.378) (-535.200) -- 0:00:32
710000 -- (-537.782) [-538.869] (-533.345) (-533.308) * (-537.960) (-543.737) (-537.655) [-531.866] -- 0:00:32
Average standard deviation of split frequencies: 0.004864
710500 -- (-534.906) (-541.212) (-535.945) [-536.205] * (-538.694) (-545.410) [-542.058] (-533.051) -- 0:00:32
711000 -- (-540.936) (-538.209) (-535.531) [-533.107] * [-535.962] (-544.614) (-534.777) (-542.682) -- 0:00:32
711500 -- [-537.335] (-536.236) (-538.711) (-536.009) * (-534.047) (-539.299) (-540.711) [-537.407] -- 0:00:32
712000 -- (-538.694) (-534.530) (-537.994) [-545.764] * (-540.629) [-532.642] (-534.466) (-538.218) -- 0:00:32
712500 -- [-534.117] (-534.402) (-532.704) (-545.059) * (-537.577) [-537.918] (-535.130) (-535.178) -- 0:00:32
713000 -- (-539.538) [-533.818] (-533.809) (-544.027) * (-535.427) (-536.011) [-535.610] (-536.657) -- 0:00:32
713500 -- (-537.251) (-537.940) [-538.933] (-534.314) * (-536.096) [-540.936] (-540.740) (-540.971) -- 0:00:32
714000 -- (-539.899) (-536.363) [-541.485] (-534.435) * [-535.713] (-536.839) (-533.907) (-536.260) -- 0:00:32
714500 -- (-539.962) (-532.906) (-536.357) [-537.805] * (-538.960) [-536.254] (-538.226) (-540.634) -- 0:00:31
715000 -- [-540.354] (-539.902) (-536.074) (-533.424) * (-537.140) (-533.086) (-535.241) [-533.951] -- 0:00:31
Average standard deviation of split frequencies: 0.004389
715500 -- (-535.442) (-538.035) [-536.997] (-537.999) * [-534.582] (-536.141) (-538.590) (-539.032) -- 0:00:31
716000 -- (-535.102) (-535.239) (-537.614) [-537.942] * (-538.377) (-535.433) [-533.794] (-538.731) -- 0:00:31
716500 -- (-538.305) (-535.841) [-532.066] (-532.240) * (-540.841) [-533.983] (-536.634) (-541.429) -- 0:00:31
717000 -- [-541.248] (-544.506) (-532.028) (-534.644) * (-537.446) [-535.653] (-531.463) (-544.596) -- 0:00:31
717500 -- (-538.541) (-541.018) [-534.146] (-535.187) * (-543.607) [-535.111] (-534.505) (-535.000) -- 0:00:31
718000 -- (-536.151) (-535.962) [-533.839] (-539.844) * (-537.239) (-548.204) [-535.895] (-537.373) -- 0:00:31
718500 -- (-533.578) (-532.664) [-531.363] (-534.507) * (-536.048) (-535.947) (-538.489) [-533.475] -- 0:00:31
719000 -- (-536.636) (-541.154) [-536.288] (-532.903) * (-535.188) [-534.222] (-540.501) (-533.662) -- 0:00:31
719500 -- [-533.798] (-537.585) (-539.758) (-535.157) * (-535.153) (-537.582) (-539.335) [-536.646] -- 0:00:31
720000 -- [-533.124] (-537.237) (-541.400) (-540.520) * (-530.734) (-536.672) (-538.588) [-535.242] -- 0:00:31
Average standard deviation of split frequencies: 0.004361
720500 -- (-545.098) [-534.252] (-534.192) (-539.061) * [-535.759] (-535.149) (-540.941) (-538.915) -- 0:00:31
721000 -- [-541.795] (-539.321) (-536.812) (-535.766) * (-535.635) (-533.882) (-537.232) [-532.527] -- 0:00:31
721500 -- (-536.338) [-533.411] (-539.545) (-541.569) * (-534.618) [-534.884] (-537.152) (-534.441) -- 0:00:31
722000 -- (-540.926) (-536.434) [-532.920] (-533.721) * [-533.413] (-537.948) (-536.216) (-535.133) -- 0:00:31
722500 -- (-537.825) (-536.219) [-536.012] (-533.288) * [-534.692] (-534.729) (-537.515) (-540.048) -- 0:00:31
723000 -- (-537.688) [-533.867] (-530.911) (-535.836) * [-534.574] (-538.339) (-538.000) (-535.513) -- 0:00:31
723500 -- (-545.570) (-542.815) (-532.113) [-540.072] * (-536.406) [-531.300] (-533.108) (-537.794) -- 0:00:30
724000 -- (-538.117) (-544.803) [-537.429] (-539.861) * (-535.275) (-532.595) (-534.336) [-536.086] -- 0:00:30
724500 -- [-532.741] (-538.951) (-539.437) (-536.903) * (-535.421) (-533.781) [-532.727] (-534.656) -- 0:00:30
725000 -- (-535.191) (-545.065) (-533.654) [-539.139] * (-534.301) [-535.857] (-534.976) (-533.351) -- 0:00:30
Average standard deviation of split frequencies: 0.003896
725500 -- (-533.612) (-543.786) (-534.741) [-534.270] * (-537.993) (-539.729) (-536.899) [-535.098] -- 0:00:30
726000 -- (-539.765) (-541.572) [-536.542] (-534.349) * (-541.175) [-533.484] (-535.195) (-532.507) -- 0:00:30
726500 -- (-532.403) (-540.722) (-540.272) [-530.939] * (-533.993) (-534.693) [-538.759] (-533.430) -- 0:00:30
727000 -- (-537.306) (-542.010) [-539.378] (-536.142) * (-541.650) (-543.817) [-534.709] (-533.648) -- 0:00:30
727500 -- (-541.526) (-542.400) (-535.248) [-531.944] * (-533.429) (-535.916) [-538.605] (-538.750) -- 0:00:30
728000 -- (-542.392) (-544.051) (-536.472) [-533.142] * (-531.325) (-538.873) (-538.879) [-537.582] -- 0:00:30
728500 -- [-534.271] (-536.498) (-537.706) (-532.358) * [-535.930] (-537.962) (-538.596) (-533.076) -- 0:00:30
729000 -- (-536.514) (-535.718) [-533.607] (-534.588) * [-532.584] (-535.568) (-533.375) (-533.817) -- 0:00:30
729500 -- (-537.083) [-533.336] (-534.093) (-533.246) * (-537.138) (-538.102) [-535.067] (-534.877) -- 0:00:30
730000 -- (-533.192) (-538.076) [-533.782] (-531.266) * (-536.693) (-537.169) [-532.291] (-538.467) -- 0:00:30
Average standard deviation of split frequencies: 0.004731
730500 -- (-534.325) (-534.304) (-536.101) [-540.906] * (-536.217) [-534.667] (-531.653) (-534.515) -- 0:00:30
731000 -- (-540.047) (-539.913) [-540.409] (-536.289) * [-538.388] (-532.591) (-534.363) (-536.297) -- 0:00:30
731500 -- [-538.231] (-544.106) (-538.022) (-539.201) * (-531.731) [-535.196] (-539.843) (-536.149) -- 0:00:30
732000 -- (-545.769) (-537.936) [-534.994] (-540.584) * (-537.447) (-531.994) (-537.732) [-532.308] -- 0:00:30
732500 -- [-540.809] (-538.442) (-533.703) (-545.920) * (-539.990) (-535.587) [-536.376] (-536.230) -- 0:00:29
733000 -- [-535.473] (-536.187) (-546.143) (-539.311) * (-537.142) [-534.647] (-538.128) (-531.574) -- 0:00:29
733500 -- (-540.343) [-535.608] (-536.962) (-537.077) * (-533.767) [-534.220] (-545.789) (-535.146) -- 0:00:29
734000 -- [-534.933] (-536.280) (-537.405) (-534.181) * (-536.975) (-536.756) (-536.033) [-542.364] -- 0:00:29
734500 -- (-539.322) (-535.934) (-534.926) [-534.408] * (-538.049) (-534.895) [-538.362] (-537.764) -- 0:00:29
735000 -- (-537.115) (-538.408) [-533.032] (-532.695) * (-535.684) (-533.507) [-538.368] (-541.114) -- 0:00:29
Average standard deviation of split frequencies: 0.005978
735500 -- (-536.799) (-538.354) (-548.457) [-531.082] * (-534.230) (-531.575) [-534.778] (-536.544) -- 0:00:29
736000 -- (-538.969) [-535.708] (-535.400) (-533.665) * (-541.615) (-536.760) [-535.208] (-546.039) -- 0:00:29
736500 -- [-534.340] (-535.613) (-534.915) (-539.088) * (-536.011) [-533.161] (-539.992) (-545.088) -- 0:00:29
737000 -- (-535.688) [-534.356] (-540.540) (-534.553) * (-543.391) [-534.709] (-537.573) (-539.242) -- 0:00:29
737500 -- (-542.974) [-535.865] (-538.505) (-533.791) * (-539.754) [-536.197] (-537.790) (-539.813) -- 0:00:29
738000 -- [-539.272] (-530.923) (-543.101) (-535.114) * (-540.552) [-535.401] (-534.102) (-534.897) -- 0:00:29
738500 -- (-538.683) (-537.863) (-536.021) [-537.713] * (-538.077) (-536.681) (-540.161) [-537.720] -- 0:00:29
739000 -- (-535.640) (-535.785) (-538.500) [-535.167] * [-542.981] (-537.495) (-538.436) (-534.630) -- 0:00:29
739500 -- (-535.667) (-536.101) (-536.106) [-533.292] * (-539.076) (-534.127) [-535.577] (-537.438) -- 0:00:29
740000 -- [-537.094] (-535.151) (-536.156) (-532.651) * (-535.721) [-539.526] (-537.236) (-533.451) -- 0:00:29
Average standard deviation of split frequencies: 0.005940
740500 -- [-533.183] (-539.448) (-541.542) (-540.706) * (-541.982) (-534.782) [-534.243] (-540.027) -- 0:00:29
741000 -- [-533.430] (-536.115) (-538.715) (-536.241) * [-535.067] (-536.607) (-535.138) (-540.506) -- 0:00:29
741500 -- (-533.038) (-540.213) [-531.193] (-537.318) * [-536.130] (-535.520) (-537.627) (-545.124) -- 0:00:28
742000 -- (-545.096) (-538.615) (-536.053) [-534.076] * (-534.933) [-533.449] (-542.501) (-540.964) -- 0:00:28
742500 -- (-539.261) (-539.391) (-537.559) [-533.937] * (-533.406) [-536.088] (-538.764) (-541.835) -- 0:00:28
743000 -- (-538.914) [-541.499] (-536.568) (-533.910) * (-537.361) (-542.110) (-535.370) [-532.691] -- 0:00:28
743500 -- [-540.780] (-538.386) (-536.885) (-534.473) * [-537.711] (-536.401) (-536.991) (-534.985) -- 0:00:28
744000 -- (-546.741) (-536.336) [-535.086] (-538.328) * (-537.246) (-534.770) [-537.130] (-542.012) -- 0:00:28
744500 -- (-540.615) (-539.539) (-540.201) [-534.155] * (-537.598) (-535.697) [-532.730] (-533.130) -- 0:00:28
745000 -- (-538.378) [-535.361] (-536.761) (-533.892) * [-536.770] (-536.652) (-534.037) (-536.182) -- 0:00:28
Average standard deviation of split frequencies: 0.006319
745500 -- (-540.088) (-532.155) (-538.793) [-531.591] * (-531.516) [-536.060] (-534.928) (-534.951) -- 0:00:28
746000 -- [-536.629] (-546.861) (-533.069) (-538.324) * (-531.864) (-535.927) [-538.839] (-533.991) -- 0:00:28
746500 -- (-536.712) [-535.718] (-537.818) (-541.164) * (-533.028) [-540.204] (-533.826) (-535.418) -- 0:00:28
747000 -- (-542.794) (-539.667) [-532.223] (-534.875) * (-533.315) (-531.078) (-536.151) [-530.997] -- 0:00:28
747500 -- (-538.316) [-538.718] (-531.914) (-534.358) * (-537.916) [-533.718] (-540.910) (-534.845) -- 0:00:28
748000 -- (-538.264) [-538.752] (-536.536) (-541.247) * (-537.007) [-535.608] (-537.877) (-539.324) -- 0:00:28
748500 -- (-536.030) (-536.014) (-532.270) [-536.883] * (-545.251) [-533.297] (-536.972) (-540.296) -- 0:00:28
749000 -- (-535.694) (-540.696) [-537.139] (-537.941) * (-535.879) (-533.531) [-534.589] (-534.684) -- 0:00:28
749500 -- (-538.734) (-535.341) [-533.943] (-539.356) * (-531.445) (-534.755) (-533.755) [-534.615] -- 0:00:28
750000 -- (-535.442) (-533.288) (-536.015) [-537.253] * (-542.270) (-539.944) (-538.053) [-533.096] -- 0:00:28
Average standard deviation of split frequencies: 0.005861
750500 -- (-537.289) (-535.207) [-537.466] (-532.834) * (-539.469) (-539.986) [-535.412] (-537.441) -- 0:00:27
751000 -- (-534.873) (-537.735) (-542.192) [-532.911] * (-532.543) (-535.235) [-532.684] (-536.767) -- 0:00:27
751500 -- (-536.717) (-531.679) (-541.381) [-535.538] * (-531.001) (-537.912) (-536.186) [-538.744] -- 0:00:27
752000 -- (-541.193) (-536.042) (-538.467) [-537.353] * (-534.604) (-533.881) (-532.841) [-535.097] -- 0:00:27
752500 -- (-546.772) (-533.542) (-543.411) [-535.904] * (-534.947) (-532.786) [-535.070] (-544.464) -- 0:00:27
753000 -- (-539.214) [-533.265] (-539.768) (-533.282) * (-537.277) [-535.391] (-535.601) (-535.787) -- 0:00:27
753500 -- (-536.570) (-538.629) (-544.717) [-537.342] * (-534.217) [-536.235] (-534.164) (-545.014) -- 0:00:27
754000 -- (-537.969) (-536.166) [-534.532] (-537.411) * (-536.182) [-535.407] (-538.541) (-542.165) -- 0:00:27
754500 -- (-537.187) [-532.140] (-534.892) (-538.865) * (-539.773) [-533.774] (-533.943) (-540.677) -- 0:00:27
755000 -- (-536.047) [-534.153] (-540.212) (-535.998) * (-546.708) (-545.592) [-534.323] (-541.293) -- 0:00:27
Average standard deviation of split frequencies: 0.005820
755500 -- (-533.502) [-534.961] (-539.177) (-539.833) * [-533.483] (-537.199) (-536.333) (-533.354) -- 0:00:27
756000 -- [-539.914] (-536.257) (-537.065) (-533.960) * (-539.453) (-538.454) (-541.953) [-534.131] -- 0:00:27
756500 -- [-533.416] (-533.638) (-538.928) (-531.941) * [-533.937] (-540.893) (-540.821) (-536.054) -- 0:00:27
757000 -- (-535.135) (-538.954) [-533.976] (-533.473) * (-539.447) (-540.504) [-538.116] (-539.319) -- 0:00:27
757500 -- [-536.100] (-538.524) (-533.981) (-535.720) * (-537.677) (-533.085) (-534.583) [-538.857] -- 0:00:27
758000 -- (-539.274) (-541.658) [-535.274] (-537.631) * [-537.285] (-536.998) (-534.263) (-539.704) -- 0:00:27
758500 -- (-539.016) (-538.147) [-537.054] (-539.131) * [-537.683] (-537.172) (-543.295) (-537.519) -- 0:00:27
759000 -- (-536.931) (-535.648) [-533.865] (-541.814) * [-531.787] (-533.026) (-534.810) (-534.606) -- 0:00:26
759500 -- (-537.466) [-540.272] (-537.296) (-535.747) * (-532.686) (-538.636) [-530.896] (-536.527) -- 0:00:26
760000 -- (-537.762) [-536.127] (-536.087) (-531.309) * (-539.667) (-536.441) [-533.482] (-535.648) -- 0:00:26
Average standard deviation of split frequencies: 0.005784
760500 -- [-536.496] (-537.081) (-545.139) (-537.671) * (-538.695) (-534.627) [-532.722] (-540.156) -- 0:00:26
761000 -- (-538.357) (-533.507) (-530.803) [-538.309] * [-534.726] (-536.960) (-533.174) (-534.128) -- 0:00:26
761500 -- (-534.608) [-540.025] (-533.705) (-540.649) * (-542.216) (-533.846) (-539.560) [-535.316] -- 0:00:26
762000 -- (-538.490) (-533.843) (-534.936) [-537.600] * (-535.288) (-535.011) (-535.639) [-534.361] -- 0:00:26
762500 -- (-536.695) [-534.575] (-536.437) (-538.155) * (-540.261) (-536.304) [-532.439] (-540.881) -- 0:00:26
763000 -- [-537.042] (-537.426) (-536.569) (-538.539) * [-539.475] (-532.433) (-536.809) (-532.067) -- 0:00:26
763500 -- (-538.589) [-538.262] (-543.593) (-540.127) * (-535.194) (-536.283) (-540.776) [-532.687] -- 0:00:26
764000 -- (-532.370) [-537.215] (-534.328) (-539.647) * [-533.495] (-531.990) (-535.486) (-531.308) -- 0:00:26
764500 -- (-536.917) (-537.382) (-535.296) [-538.303] * (-533.991) (-534.478) [-534.722] (-536.841) -- 0:00:26
765000 -- (-537.512) (-538.384) [-534.941] (-535.600) * (-536.691) (-531.136) (-534.169) [-530.937] -- 0:00:26
Average standard deviation of split frequencies: 0.004103
765500 -- (-543.798) (-538.342) (-536.109) [-533.790] * [-537.065] (-535.993) (-532.841) (-534.206) -- 0:00:26
766000 -- [-535.173] (-537.637) (-533.540) (-537.080) * (-535.153) [-535.975] (-547.003) (-534.183) -- 0:00:26
766500 -- (-535.620) (-533.141) [-535.806] (-534.164) * (-533.980) (-539.224) (-536.029) [-537.163] -- 0:00:26
767000 -- (-534.271) (-538.494) (-538.247) [-531.335] * (-536.372) (-537.878) [-536.558] (-539.534) -- 0:00:26
767500 -- (-540.426) [-531.273] (-538.076) (-536.881) * (-538.299) (-536.243) (-535.949) [-540.197] -- 0:00:26
768000 -- [-535.832] (-535.019) (-533.114) (-544.361) * [-540.622] (-539.878) (-534.973) (-537.627) -- 0:00:25
768500 -- (-540.789) (-536.630) (-534.544) [-540.194] * [-535.305] (-540.687) (-536.761) (-537.511) -- 0:00:25
769000 -- [-536.588] (-535.669) (-534.351) (-542.181) * (-533.841) (-537.885) (-536.534) [-537.151] -- 0:00:25
769500 -- (-537.343) [-533.604] (-536.509) (-537.567) * (-533.961) (-540.099) [-536.808] (-536.624) -- 0:00:25
770000 -- (-533.954) [-534.137] (-543.850) (-539.606) * (-532.202) [-536.194] (-535.056) (-537.590) -- 0:00:25
Average standard deviation of split frequencies: 0.004486
770500 -- (-534.178) (-531.477) (-538.864) [-542.146] * [-538.298] (-537.459) (-538.483) (-534.227) -- 0:00:25
771000 -- (-545.989) (-534.254) (-535.971) [-533.820] * (-540.633) (-544.551) (-545.432) [-533.658] -- 0:00:25
771500 -- (-537.653) [-534.746] (-541.412) (-541.515) * (-535.404) (-536.539) (-537.655) [-541.640] -- 0:00:25
772000 -- (-536.975) (-539.052) (-537.118) [-536.830] * (-533.709) (-545.007) [-533.157] (-546.224) -- 0:00:25
772500 -- (-538.280) (-534.399) [-532.789] (-536.716) * [-537.997] (-536.111) (-536.850) (-537.085) -- 0:00:25
773000 -- (-539.594) [-534.303] (-535.533) (-539.290) * (-535.690) (-535.510) (-535.195) [-542.117] -- 0:00:25
773500 -- (-540.747) (-536.208) (-540.886) [-536.734] * (-542.886) (-535.501) (-537.376) [-536.043] -- 0:00:25
774000 -- (-544.272) (-534.424) [-532.215] (-536.538) * [-541.712] (-535.433) (-541.846) (-536.178) -- 0:00:25
774500 -- (-538.395) (-536.165) [-537.512] (-537.581) * (-540.783) (-536.467) (-535.832) [-538.403] -- 0:00:25
775000 -- [-536.399] (-533.705) (-537.616) (-533.774) * (-535.790) [-536.694] (-532.991) (-532.117) -- 0:00:25
Average standard deviation of split frequencies: 0.004860
775500 -- (-540.799) (-537.359) (-533.030) [-531.334] * (-536.998) [-535.098] (-535.521) (-543.414) -- 0:00:25
776000 -- [-537.907] (-537.897) (-536.046) (-533.064) * (-534.398) (-533.217) [-533.739] (-535.602) -- 0:00:25
776500 -- (-544.211) [-537.734] (-541.706) (-535.529) * (-539.574) (-537.115) [-536.524] (-540.066) -- 0:00:25
777000 -- (-540.779) (-536.690) [-534.685] (-538.615) * (-536.284) (-540.485) [-538.731] (-541.176) -- 0:00:24
777500 -- [-536.156] (-536.856) (-537.974) (-547.855) * (-544.771) [-531.940] (-539.473) (-532.984) -- 0:00:24
778000 -- [-530.733] (-535.447) (-533.588) (-540.234) * (-539.992) (-535.014) [-532.509] (-541.589) -- 0:00:24
778500 -- [-534.756] (-532.836) (-532.513) (-535.238) * (-539.902) [-533.519] (-538.940) (-540.009) -- 0:00:24
779000 -- (-533.964) (-534.430) (-538.609) [-538.339] * [-533.384] (-536.643) (-542.715) (-540.674) -- 0:00:24
779500 -- (-533.216) (-533.694) [-534.899] (-534.395) * (-537.778) (-533.744) (-536.656) [-533.456] -- 0:00:24
780000 -- (-532.785) (-543.754) (-533.937) [-535.046] * [-533.387] (-536.940) (-541.333) (-537.108) -- 0:00:24
Average standard deviation of split frequencies: 0.005636
780500 -- (-538.211) (-539.206) [-536.549] (-536.498) * (-532.916) (-532.999) [-532.210] (-539.343) -- 0:00:24
781000 -- (-531.496) [-538.898] (-533.728) (-533.393) * (-536.849) [-534.914] (-535.810) (-536.336) -- 0:00:24
781500 -- [-530.665] (-534.311) (-534.098) (-538.121) * (-536.699) [-536.749] (-537.447) (-536.545) -- 0:00:24
782000 -- [-535.017] (-535.260) (-532.945) (-542.678) * (-547.906) (-539.014) (-538.317) [-534.611] -- 0:00:24
782500 -- [-537.088] (-536.603) (-532.825) (-535.114) * (-537.434) (-538.109) [-541.862] (-542.031) -- 0:00:24
783000 -- (-539.147) (-540.174) (-537.936) [-537.819] * (-534.910) (-535.874) [-532.265] (-536.203) -- 0:00:24
783500 -- (-536.965) [-530.703] (-534.001) (-540.840) * (-536.337) (-535.038) (-532.755) [-534.955] -- 0:00:24
784000 -- (-536.657) (-538.618) [-533.489] (-531.993) * (-533.960) (-539.326) [-533.111] (-540.923) -- 0:00:24
784500 -- (-533.234) [-532.658] (-538.514) (-537.794) * (-536.740) (-534.815) (-534.437) [-536.031] -- 0:00:24
785000 -- (-533.451) (-544.813) [-539.306] (-542.481) * (-535.865) [-539.370] (-536.610) (-534.907) -- 0:00:24
Average standard deviation of split frequencies: 0.005198
785500 -- (-550.084) (-536.454) (-535.869) [-536.104] * (-535.944) [-538.014] (-537.020) (-536.448) -- 0:00:24
786000 -- (-538.351) (-536.903) [-540.331] (-538.783) * (-532.015) [-537.735] (-538.341) (-536.530) -- 0:00:23
786500 -- (-537.860) (-533.076) (-539.023) [-534.813] * (-538.678) (-538.034) (-539.913) [-533.794] -- 0:00:23
787000 -- (-538.853) (-536.236) (-537.602) [-534.687] * (-535.635) [-532.798] (-535.672) (-531.591) -- 0:00:23
787500 -- (-532.747) (-537.852) [-532.544] (-533.212) * (-541.726) (-536.330) [-533.323] (-540.661) -- 0:00:23
788000 -- (-538.511) (-538.531) [-534.781] (-540.569) * (-537.463) (-540.895) [-532.271] (-538.765) -- 0:00:23
788500 -- [-538.166] (-533.386) (-535.475) (-534.184) * (-534.846) [-534.836] (-532.697) (-544.713) -- 0:00:23
789000 -- (-535.322) (-531.818) [-531.878] (-541.974) * (-538.901) [-538.141] (-533.805) (-539.544) -- 0:00:23
789500 -- (-535.110) [-542.798] (-538.002) (-543.582) * (-531.726) (-538.225) (-534.412) [-537.287] -- 0:00:23
790000 -- (-537.556) (-539.268) (-534.126) [-540.274] * (-537.760) [-536.549] (-541.702) (-545.159) -- 0:00:23
Average standard deviation of split frequencies: 0.004372
790500 -- (-533.799) (-539.278) (-539.726) [-544.065] * [-531.816] (-538.092) (-535.603) (-540.791) -- 0:00:23
791000 -- (-537.155) [-534.243] (-534.499) (-539.415) * [-537.171] (-538.791) (-541.997) (-534.746) -- 0:00:23
791500 -- (-537.099) (-532.557) (-535.189) [-533.722] * (-535.057) (-542.473) [-532.160] (-540.125) -- 0:00:23
792000 -- (-539.978) [-538.050] (-537.859) (-536.459) * [-536.920] (-535.492) (-536.169) (-542.665) -- 0:00:23
792500 -- (-537.020) [-542.535] (-531.436) (-538.034) * [-535.899] (-532.295) (-535.581) (-549.590) -- 0:00:23
793000 -- (-532.117) (-537.358) (-544.619) [-537.755] * [-532.349] (-535.876) (-534.687) (-541.729) -- 0:00:23
793500 -- (-536.132) (-539.749) (-539.860) [-536.001] * [-536.975] (-537.057) (-535.383) (-537.356) -- 0:00:23
794000 -- (-533.838) (-533.832) (-533.914) [-532.820] * (-538.788) (-541.749) (-536.235) [-536.619] -- 0:00:23
794500 -- (-533.207) [-536.964] (-531.544) (-542.429) * (-538.916) (-536.534) [-535.160] (-536.527) -- 0:00:23
795000 -- (-539.433) [-539.308] (-537.701) (-536.622) * (-540.644) (-540.044) (-530.992) [-533.161] -- 0:00:22
Average standard deviation of split frequencies: 0.004343
795500 -- (-540.701) (-533.613) [-533.951] (-540.376) * (-540.928) (-536.860) [-532.980] (-540.765) -- 0:00:22
796000 -- (-535.159) (-535.126) [-534.419] (-533.790) * (-538.018) (-536.108) [-530.492] (-533.002) -- 0:00:22
796500 -- (-532.261) (-536.063) [-537.071] (-534.373) * (-541.242) (-537.064) [-534.840] (-535.294) -- 0:00:22
797000 -- [-535.538] (-538.870) (-538.439) (-534.006) * (-537.417) [-532.894] (-541.904) (-536.317) -- 0:00:22
797500 -- (-539.374) (-540.546) [-536.602] (-535.509) * [-541.685] (-537.258) (-535.188) (-537.660) -- 0:00:22
798000 -- (-540.198) (-539.473) [-536.104] (-537.179) * (-542.506) [-538.081] (-535.354) (-538.429) -- 0:00:22
798500 -- [-537.825] (-541.839) (-533.057) (-537.338) * (-534.359) (-546.314) (-535.779) [-534.784] -- 0:00:22
799000 -- (-541.057) (-535.796) [-531.733] (-535.768) * (-535.924) (-539.151) (-541.972) [-536.976] -- 0:00:22
799500 -- (-536.199) (-539.258) (-531.043) [-535.188] * (-535.935) (-531.427) [-535.951] (-534.278) -- 0:00:22
800000 -- (-539.633) (-536.483) (-539.904) [-535.128] * [-538.954] (-531.033) (-537.500) (-535.110) -- 0:00:22
Average standard deviation of split frequencies: 0.005495
800500 -- (-541.241) [-537.441] (-540.441) (-536.932) * (-539.724) (-534.237) [-535.079] (-536.481) -- 0:00:22
801000 -- (-537.197) (-534.619) [-536.126] (-542.280) * [-536.377] (-535.964) (-535.206) (-535.610) -- 0:00:22
801500 -- (-540.869) [-535.223] (-534.443) (-533.952) * [-536.226] (-540.299) (-535.691) (-539.567) -- 0:00:22
802000 -- (-538.158) [-532.228] (-537.796) (-533.677) * (-532.164) [-536.178] (-538.337) (-532.808) -- 0:00:22
802500 -- (-538.952) [-530.066] (-535.425) (-534.945) * (-535.789) (-534.312) [-537.112] (-534.952) -- 0:00:22
803000 -- (-535.498) [-535.263] (-538.729) (-542.791) * (-534.441) [-534.354] (-538.879) (-543.594) -- 0:00:22
803500 -- (-538.004) (-536.844) [-535.099] (-537.997) * [-533.451] (-532.992) (-540.540) (-537.973) -- 0:00:22
804000 -- (-537.563) [-540.254] (-539.530) (-535.083) * (-535.637) (-540.891) (-540.412) [-536.438] -- 0:00:21
804500 -- (-533.373) (-531.726) [-537.419] (-537.010) * (-537.463) (-541.939) (-537.056) [-530.644] -- 0:00:21
805000 -- (-535.060) [-534.452] (-534.327) (-536.723) * (-538.758) (-536.697) (-554.785) [-535.906] -- 0:00:21
Average standard deviation of split frequencies: 0.004289
805500 -- (-538.515) [-535.293] (-535.907) (-539.910) * [-533.007] (-535.163) (-543.326) (-533.744) -- 0:00:21
806000 -- (-541.938) [-531.486] (-536.234) (-535.489) * (-537.868) [-533.277] (-539.463) (-536.075) -- 0:00:21
806500 -- (-538.147) [-532.896] (-535.674) (-538.792) * (-538.064) (-537.085) [-538.625] (-535.141) -- 0:00:21
807000 -- (-538.077) [-533.539] (-535.933) (-537.250) * [-535.566] (-531.933) (-535.906) (-535.136) -- 0:00:21
807500 -- [-534.575] (-536.323) (-539.640) (-539.726) * (-536.887) (-542.354) [-530.283] (-534.842) -- 0:00:21
808000 -- [-535.080] (-535.053) (-534.568) (-543.703) * (-537.623) (-534.306) [-535.300] (-537.813) -- 0:00:21
808500 -- (-534.824) (-533.351) [-532.738] (-544.441) * [-534.635] (-536.289) (-535.100) (-539.356) -- 0:00:21
809000 -- [-537.468] (-537.545) (-541.503) (-537.964) * (-534.916) (-535.795) (-532.281) [-535.899] -- 0:00:21
809500 -- (-535.142) [-535.294] (-536.592) (-538.635) * [-532.800] (-537.777) (-534.782) (-534.785) -- 0:00:21
810000 -- (-536.664) (-535.148) [-535.772] (-542.548) * [-535.407] (-536.901) (-542.840) (-531.898) -- 0:00:21
Average standard deviation of split frequencies: 0.005040
810500 -- (-540.603) [-535.502] (-538.349) (-538.546) * (-541.562) (-538.683) (-533.589) [-534.860] -- 0:00:21
811000 -- (-539.209) [-545.100] (-538.142) (-540.180) * (-537.304) (-537.544) [-542.674] (-535.418) -- 0:00:21
811500 -- (-535.367) [-538.494] (-537.080) (-537.025) * (-537.552) (-532.565) [-535.519] (-539.471) -- 0:00:21
812000 -- [-536.885] (-535.548) (-545.682) (-533.613) * (-538.059) (-534.702) [-537.388] (-547.382) -- 0:00:21
812500 -- [-537.465] (-546.992) (-543.779) (-540.233) * (-535.675) (-534.712) (-532.099) [-538.225] -- 0:00:21
813000 -- (-535.687) (-544.532) [-546.064] (-541.628) * [-537.061] (-536.106) (-541.988) (-539.079) -- 0:00:20
813500 -- (-535.247) (-546.550) (-542.447) [-535.192] * (-539.424) (-536.939) (-536.164) [-539.876] -- 0:00:20
814000 -- [-533.991] (-541.712) (-542.251) (-532.989) * [-536.396] (-533.347) (-534.739) (-532.909) -- 0:00:20
814500 -- [-537.846] (-544.559) (-538.322) (-534.272) * (-540.844) [-534.957] (-534.314) (-535.915) -- 0:00:20
815000 -- (-541.317) (-541.735) (-537.876) [-534.067] * (-535.769) [-532.224] (-540.406) (-536.882) -- 0:00:20
Average standard deviation of split frequencies: 0.005007
815500 -- (-533.949) (-538.054) (-536.574) [-535.582] * [-535.448] (-532.979) (-535.710) (-537.115) -- 0:00:20
816000 -- (-532.159) [-537.168] (-535.533) (-538.463) * (-535.984) [-534.129] (-534.825) (-537.368) -- 0:00:20
816500 -- (-531.128) (-534.159) [-533.411] (-541.141) * [-537.198] (-535.620) (-541.959) (-541.471) -- 0:00:20
817000 -- [-534.816] (-534.220) (-542.946) (-537.545) * (-546.584) [-536.307] (-538.554) (-535.902) -- 0:00:20
817500 -- (-534.689) [-537.200] (-537.050) (-535.170) * (-536.365) [-531.752] (-543.053) (-542.753) -- 0:00:20
818000 -- [-535.139] (-534.213) (-543.230) (-539.701) * (-535.171) [-540.186] (-537.778) (-540.780) -- 0:00:20
818500 -- (-536.232) (-538.009) (-540.763) [-536.800] * [-532.646] (-539.569) (-538.144) (-536.899) -- 0:00:20
819000 -- (-538.334) [-537.372] (-534.879) (-542.925) * (-534.967) (-543.715) (-537.331) [-534.617] -- 0:00:20
819500 -- (-539.617) [-534.722] (-535.071) (-538.870) * (-531.833) [-539.149] (-533.375) (-539.658) -- 0:00:20
820000 -- (-538.359) (-539.813) (-535.343) [-535.693] * [-536.592] (-537.735) (-534.780) (-533.178) -- 0:00:20
Average standard deviation of split frequencies: 0.005361
820500 -- (-536.025) (-545.055) [-534.389] (-535.888) * [-536.925] (-534.898) (-537.017) (-535.862) -- 0:00:20
821000 -- (-535.461) (-538.357) [-535.592] (-538.314) * (-538.302) (-532.742) (-538.176) [-534.983] -- 0:00:20
821500 -- (-543.467) (-539.565) (-539.596) [-533.594] * (-539.658) (-534.667) (-534.933) [-534.691] -- 0:00:19
822000 -- (-543.385) (-536.688) (-536.867) [-536.651] * (-541.351) (-539.023) (-539.964) [-541.429] -- 0:00:19
822500 -- [-541.728] (-537.794) (-538.915) (-532.960) * (-539.737) (-534.871) [-532.536] (-538.258) -- 0:00:19
823000 -- [-536.399] (-536.080) (-538.899) (-536.957) * (-539.626) (-534.547) [-534.967] (-536.883) -- 0:00:19
823500 -- (-540.455) (-534.610) [-537.859] (-532.314) * [-533.858] (-542.917) (-541.715) (-534.510) -- 0:00:19
824000 -- (-533.620) [-533.707] (-538.676) (-536.913) * [-535.032] (-539.444) (-534.043) (-544.183) -- 0:00:19
824500 -- (-538.599) [-534.170] (-539.108) (-536.045) * (-535.270) (-535.694) [-535.219] (-534.453) -- 0:00:19
825000 -- (-539.995) (-533.788) (-541.787) [-533.741] * [-535.519] (-541.376) (-536.746) (-535.924) -- 0:00:19
Average standard deviation of split frequencies: 0.005707
825500 -- [-534.516] (-536.614) (-542.132) (-539.665) * [-534.877] (-534.528) (-534.151) (-537.983) -- 0:00:19
826000 -- [-539.229] (-534.567) (-541.295) (-539.320) * [-534.275] (-537.339) (-541.763) (-542.269) -- 0:00:19
826500 -- (-541.936) (-534.659) (-534.671) [-534.694] * (-536.477) (-538.899) [-532.626] (-538.879) -- 0:00:19
827000 -- (-540.611) (-539.800) (-536.753) [-536.780] * [-535.467] (-535.561) (-537.594) (-543.825) -- 0:00:19
827500 -- (-536.302) [-536.824] (-534.589) (-538.529) * (-539.983) [-544.482] (-540.619) (-544.943) -- 0:00:19
828000 -- (-535.976) (-533.845) (-542.716) [-535.276] * (-545.082) (-540.537) (-533.313) [-541.659] -- 0:00:19
828500 -- (-537.443) [-539.887] (-535.674) (-536.186) * [-535.906] (-536.070) (-539.208) (-537.897) -- 0:00:19
829000 -- [-533.186] (-535.762) (-542.361) (-541.832) * (-536.323) [-538.661] (-539.061) (-534.821) -- 0:00:19
829500 -- (-538.717) (-534.929) [-536.658] (-534.476) * (-536.263) (-536.305) [-532.259] (-538.249) -- 0:00:19
830000 -- [-534.193] (-537.494) (-538.048) (-536.489) * (-544.600) [-537.023] (-535.562) (-539.048) -- 0:00:19
Average standard deviation of split frequencies: 0.005675
830500 -- (-539.845) (-534.221) (-539.850) [-533.358] * (-537.758) (-549.327) (-535.406) [-536.058] -- 0:00:18
831000 -- (-538.381) (-537.146) (-539.122) [-538.575] * (-539.943) (-538.298) (-536.112) [-536.229] -- 0:00:18
831500 -- (-536.690) (-537.121) (-538.962) [-532.286] * (-540.299) (-537.576) [-532.245] (-534.407) -- 0:00:18
832000 -- (-538.173) (-533.988) (-539.112) [-530.232] * (-538.491) (-539.055) (-536.230) [-533.088] -- 0:00:18
832500 -- (-537.277) (-533.222) (-539.984) [-535.055] * [-531.024] (-540.810) (-534.252) (-544.055) -- 0:00:18
833000 -- (-539.525) (-535.398) [-533.506] (-534.962) * (-533.205) [-534.499] (-532.570) (-534.957) -- 0:00:18
833500 -- (-544.593) [-535.555] (-537.520) (-535.435) * (-536.341) (-537.045) [-533.744] (-534.582) -- 0:00:18
834000 -- (-540.022) (-539.767) (-537.120) [-536.085] * [-539.874] (-538.798) (-532.988) (-540.337) -- 0:00:18
834500 -- (-535.768) [-538.713] (-540.801) (-533.451) * (-537.795) (-533.062) [-536.832] (-540.895) -- 0:00:18
835000 -- (-540.247) [-535.748] (-535.664) (-539.123) * (-540.702) (-535.477) (-541.231) [-536.379] -- 0:00:18
Average standard deviation of split frequencies: 0.006391
835500 -- (-541.336) (-539.059) [-539.388] (-536.021) * (-537.934) (-538.813) [-536.548] (-538.506) -- 0:00:18
836000 -- [-537.167] (-533.147) (-533.274) (-535.194) * [-536.240] (-537.405) (-536.502) (-540.667) -- 0:00:18
836500 -- (-533.410) (-538.541) (-539.375) [-534.315] * (-534.379) (-540.503) (-546.355) [-535.168] -- 0:00:18
837000 -- [-533.514] (-534.160) (-537.726) (-535.414) * (-537.957) (-534.495) [-540.959] (-533.066) -- 0:00:18
837500 -- (-536.627) (-533.726) (-535.693) [-532.072] * (-535.727) (-539.874) [-537.550] (-534.062) -- 0:00:18
838000 -- (-535.595) (-532.955) [-534.442] (-537.438) * (-535.443) (-539.369) (-539.808) [-534.085] -- 0:00:18
838500 -- (-538.198) (-540.027) [-535.534] (-534.117) * [-537.259] (-537.923) (-532.868) (-536.208) -- 0:00:18
839000 -- (-542.375) [-534.835] (-548.309) (-537.900) * (-533.505) (-531.873) (-536.743) [-538.707] -- 0:00:18
839500 -- (-531.430) (-540.999) (-539.743) [-536.893] * (-538.911) [-536.126] (-533.381) (-535.652) -- 0:00:17
840000 -- (-538.536) [-542.002] (-545.194) (-533.276) * [-535.958] (-540.718) (-534.599) (-532.601) -- 0:00:17
Average standard deviation of split frequencies: 0.006355
840500 -- (-535.848) (-536.969) (-536.408) [-534.289] * (-538.081) [-538.101] (-539.350) (-536.570) -- 0:00:17
841000 -- [-535.361] (-535.891) (-534.794) (-539.673) * (-536.878) [-539.037] (-536.988) (-539.879) -- 0:00:17
841500 -- [-537.677] (-537.262) (-537.877) (-531.159) * (-534.912) (-535.844) [-535.219] (-533.223) -- 0:00:17
842000 -- (-535.540) (-539.455) [-538.378] (-537.836) * (-539.752) [-531.702] (-540.146) (-543.576) -- 0:00:17
842500 -- (-537.628) (-537.301) [-535.047] (-538.110) * (-537.398) (-533.652) (-533.321) [-539.888] -- 0:00:17
843000 -- (-535.252) (-535.347) (-549.961) [-534.277] * (-538.062) [-537.394] (-546.367) (-537.251) -- 0:00:17
843500 -- (-538.159) [-532.014] (-542.059) (-537.698) * (-534.742) (-534.819) [-538.433] (-536.220) -- 0:00:17
844000 -- (-535.965) (-535.026) (-538.440) [-537.521] * [-534.025] (-541.644) (-544.397) (-531.592) -- 0:00:17
844500 -- (-531.501) (-540.167) (-538.977) [-536.216] * [-539.539] (-536.380) (-544.089) (-541.404) -- 0:00:17
845000 -- (-540.032) (-539.360) [-537.597] (-534.862) * (-540.558) [-536.577] (-535.273) (-536.009) -- 0:00:17
Average standard deviation of split frequencies: 0.007430
845500 -- (-534.234) [-534.698] (-540.192) (-548.010) * (-536.239) [-532.962] (-533.588) (-536.368) -- 0:00:17
846000 -- [-538.323] (-535.747) (-543.107) (-536.628) * [-539.986] (-539.152) (-536.556) (-534.644) -- 0:00:17
846500 -- (-533.843) (-543.281) [-538.013] (-536.971) * (-537.591) [-537.330] (-536.863) (-533.965) -- 0:00:17
847000 -- (-534.674) (-537.995) [-536.938] (-539.005) * [-534.680] (-538.878) (-534.786) (-537.418) -- 0:00:17
847500 -- (-535.959) (-537.634) (-534.457) [-537.616] * (-537.862) [-540.529] (-535.579) (-538.424) -- 0:00:17
848000 -- (-534.761) (-535.730) [-532.542] (-540.708) * [-536.550] (-532.989) (-538.762) (-537.386) -- 0:00:17
848500 -- [-537.007] (-534.496) (-534.350) (-535.947) * (-540.009) [-534.605] (-541.015) (-540.352) -- 0:00:16
849000 -- (-536.489) (-540.908) [-535.968] (-538.869) * (-532.894) [-533.010] (-539.172) (-537.606) -- 0:00:16
849500 -- [-532.780] (-535.023) (-536.608) (-544.036) * (-535.088) [-531.510] (-533.920) (-534.639) -- 0:00:16
850000 -- (-534.250) (-541.864) (-534.813) [-536.331] * (-542.856) (-532.739) (-538.839) [-538.839] -- 0:00:16
Average standard deviation of split frequencies: 0.005911
850500 -- (-541.596) [-537.739] (-533.909) (-537.282) * (-532.654) [-531.314] (-534.163) (-537.241) -- 0:00:16
851000 -- [-532.467] (-539.354) (-533.630) (-542.408) * (-538.954) [-536.557] (-538.337) (-535.916) -- 0:00:16
851500 -- (-541.303) (-534.741) (-532.939) [-542.294] * [-535.947] (-539.345) (-540.798) (-535.461) -- 0:00:16
852000 -- (-534.848) (-537.218) (-535.354) [-533.938] * [-532.844] (-531.826) (-539.293) (-535.733) -- 0:00:16
852500 -- (-538.510) [-539.685] (-534.052) (-537.512) * (-541.450) (-535.961) (-535.566) [-535.948] -- 0:00:16
853000 -- (-533.820) (-535.328) (-539.675) [-534.513] * (-542.742) [-537.448] (-536.666) (-535.784) -- 0:00:16
853500 -- (-542.503) (-538.677) (-535.961) [-537.374] * (-545.159) [-532.426] (-539.786) (-536.193) -- 0:00:16
854000 -- (-539.338) [-535.449] (-535.325) (-531.489) * (-541.510) [-531.102] (-540.921) (-540.683) -- 0:00:16
854500 -- (-540.366) (-539.014) [-533.248] (-537.396) * (-540.276) [-536.078] (-534.226) (-547.027) -- 0:00:16
855000 -- (-533.227) [-534.115] (-531.612) (-540.450) * (-537.724) (-532.826) [-532.502] (-540.815) -- 0:00:16
Average standard deviation of split frequencies: 0.005507
855500 -- (-536.052) (-536.022) (-531.456) [-535.637] * (-533.074) [-536.607] (-537.518) (-544.169) -- 0:00:16
856000 -- [-534.169] (-535.846) (-532.600) (-536.539) * (-533.722) [-534.912] (-532.778) (-542.529) -- 0:00:16
856500 -- [-537.442] (-536.762) (-533.158) (-537.216) * (-535.774) [-534.356] (-533.170) (-536.704) -- 0:00:16
857000 -- [-534.960] (-534.807) (-533.451) (-536.023) * (-534.922) [-533.061] (-534.013) (-537.369) -- 0:00:16
857500 -- (-533.228) (-536.235) (-533.355) [-540.742] * (-534.299) (-535.695) (-539.186) [-532.652] -- 0:00:15
858000 -- [-536.493] (-538.053) (-535.242) (-541.746) * (-537.058) (-540.120) [-538.365] (-538.294) -- 0:00:15
858500 -- (-533.826) [-533.263] (-537.522) (-536.495) * [-532.882] (-538.061) (-537.406) (-534.267) -- 0:00:15
859000 -- (-536.032) (-531.834) [-535.362] (-536.225) * (-540.233) [-536.553] (-538.676) (-538.195) -- 0:00:15
859500 -- (-537.142) [-532.529] (-534.331) (-539.527) * (-535.253) (-536.111) [-535.007] (-539.653) -- 0:00:15
860000 -- (-538.692) (-540.841) [-534.255] (-537.998) * [-534.336] (-546.281) (-536.274) (-538.816) -- 0:00:15
Average standard deviation of split frequencies: 0.005477
860500 -- [-534.649] (-540.368) (-537.444) (-538.859) * (-533.286) (-545.181) [-534.485] (-541.653) -- 0:00:15
861000 -- [-530.229] (-532.134) (-535.896) (-533.462) * (-536.896) (-538.287) [-532.156] (-538.600) -- 0:00:15
861500 -- (-533.080) [-541.340] (-545.613) (-530.577) * (-540.754) (-535.300) [-533.655] (-534.796) -- 0:00:15
862000 -- (-538.950) (-535.721) [-533.487] (-533.859) * (-536.415) (-535.704) (-535.788) [-533.387] -- 0:00:15
862500 -- (-536.716) (-539.020) (-541.109) [-535.374] * (-540.392) (-536.681) [-538.466] (-540.506) -- 0:00:15
863000 -- (-535.101) [-539.956] (-540.806) (-535.689) * (-543.465) (-534.855) (-540.568) [-536.487] -- 0:00:15
863500 -- (-535.682) [-534.896] (-540.248) (-542.834) * (-538.332) [-534.380] (-543.789) (-534.367) -- 0:00:15
864000 -- [-534.319] (-544.128) (-534.787) (-534.587) * (-534.492) (-534.120) (-539.517) [-533.914] -- 0:00:15
864500 -- (-531.034) [-534.510] (-533.830) (-535.974) * (-535.365) (-533.676) [-534.294] (-534.646) -- 0:00:15
865000 -- [-532.388] (-537.462) (-540.144) (-533.367) * (-534.890) [-533.121] (-539.696) (-534.578) -- 0:00:15
Average standard deviation of split frequencies: 0.005806
865500 -- [-533.327] (-540.531) (-545.850) (-535.009) * (-536.817) [-533.460] (-537.571) (-534.577) -- 0:00:15
866000 -- (-537.705) (-534.432) [-540.162] (-531.924) * [-538.890] (-535.935) (-536.765) (-538.007) -- 0:00:15
866500 -- (-533.274) [-533.349] (-535.216) (-530.417) * (-546.749) (-533.902) [-535.512] (-530.284) -- 0:00:14
867000 -- (-538.804) [-531.999] (-536.767) (-535.621) * (-537.411) [-530.599] (-536.780) (-533.895) -- 0:00:14
867500 -- [-537.912] (-535.690) (-537.648) (-536.829) * (-534.145) (-536.009) (-530.218) [-539.214] -- 0:00:14
868000 -- (-535.745) (-535.502) (-531.765) [-540.757] * (-537.849) (-537.668) (-539.347) [-534.360] -- 0:00:14
868500 -- [-534.817] (-537.752) (-538.915) (-540.612) * (-535.909) (-541.588) (-531.126) [-532.481] -- 0:00:14
869000 -- (-531.712) (-545.667) [-535.081] (-536.561) * (-537.746) [-540.179] (-542.287) (-536.682) -- 0:00:14
869500 -- (-533.623) (-536.399) [-534.863] (-536.519) * (-533.654) (-533.584) [-533.038] (-541.645) -- 0:00:14
870000 -- (-538.978) [-534.735] (-534.444) (-533.427) * (-538.982) (-537.903) [-536.902] (-542.116) -- 0:00:14
Average standard deviation of split frequencies: 0.004692
870500 -- (-536.051) (-539.616) (-536.048) [-532.945] * (-538.527) (-536.390) [-535.139] (-533.962) -- 0:00:14
871000 -- [-535.368] (-533.702) (-530.902) (-537.834) * (-538.612) (-544.651) [-532.586] (-541.268) -- 0:00:14
871500 -- (-538.305) (-536.688) (-532.584) [-534.326] * (-535.995) (-545.476) [-535.011] (-536.277) -- 0:00:14
872000 -- (-541.064) [-536.735] (-538.755) (-541.640) * (-535.192) (-541.224) (-538.140) [-538.840] -- 0:00:14
872500 -- (-539.100) [-534.803] (-544.743) (-543.862) * (-533.991) (-543.632) (-534.438) [-532.304] -- 0:00:14
873000 -- (-538.083) [-538.531] (-540.065) (-543.079) * (-538.929) (-543.268) [-533.939] (-536.382) -- 0:00:14
873500 -- (-536.648) (-533.645) [-534.501] (-537.140) * [-537.427] (-538.518) (-535.044) (-541.426) -- 0:00:14
874000 -- [-536.762] (-539.918) (-533.419) (-541.303) * (-534.449) (-533.433) (-542.706) [-533.154] -- 0:00:14
874500 -- (-539.292) (-537.472) [-533.397] (-543.164) * (-532.842) (-533.013) [-535.908] (-537.459) -- 0:00:14
875000 -- [-539.384] (-539.909) (-538.366) (-532.713) * (-542.340) (-535.344) (-535.704) [-535.947] -- 0:00:14
Average standard deviation of split frequencies: 0.004305
875500 -- (-540.175) (-537.496) (-543.162) [-535.422] * [-536.134] (-541.483) (-538.085) (-537.452) -- 0:00:13
876000 -- (-535.618) [-531.449] (-536.330) (-534.523) * (-532.400) [-531.926] (-538.779) (-535.911) -- 0:00:13
876500 -- (-536.884) (-538.687) [-538.662] (-535.345) * (-530.502) (-537.574) (-535.537) [-533.454] -- 0:00:13
877000 -- (-537.752) (-541.114) [-534.207] (-543.922) * (-537.509) [-535.182] (-535.643) (-535.168) -- 0:00:13
877500 -- [-534.201] (-533.286) (-537.912) (-534.340) * (-533.083) (-535.772) (-533.547) [-538.680] -- 0:00:13
878000 -- (-530.204) (-535.939) (-544.869) [-534.046] * [-537.868] (-540.329) (-537.086) (-536.585) -- 0:00:13
878500 -- (-538.541) [-534.554] (-539.058) (-541.729) * (-536.882) (-538.222) (-538.164) [-537.339] -- 0:00:13
879000 -- (-534.282) (-533.771) (-545.480) [-535.886] * (-536.391) (-535.613) (-539.505) [-539.880] -- 0:00:13
879500 -- (-535.188) [-539.231] (-534.745) (-554.777) * [-537.931] (-533.781) (-533.290) (-534.272) -- 0:00:13
880000 -- [-532.548] (-531.540) (-536.980) (-538.323) * (-539.443) (-532.608) [-535.092] (-536.034) -- 0:00:13
Average standard deviation of split frequencies: 0.004639
880500 -- (-539.288) (-533.679) (-537.147) [-532.286] * [-538.400] (-536.846) (-530.753) (-532.593) -- 0:00:13
881000 -- [-536.348] (-534.046) (-533.038) (-533.592) * (-531.625) [-534.233] (-538.846) (-535.280) -- 0:00:13
881500 -- [-537.203] (-539.847) (-536.047) (-535.375) * (-534.603) (-534.173) (-535.227) [-537.996] -- 0:00:13
882000 -- [-537.288] (-538.815) (-537.389) (-535.388) * (-540.836) (-536.802) [-534.796] (-537.624) -- 0:00:13
882500 -- (-538.835) (-535.722) [-533.752] (-533.809) * [-537.885] (-536.610) (-535.133) (-536.724) -- 0:00:13
883000 -- (-540.759) (-535.358) (-537.333) [-532.219] * (-533.790) [-536.123] (-532.334) (-536.132) -- 0:00:13
883500 -- (-538.160) [-535.088] (-535.296) (-533.824) * (-535.936) [-534.300] (-535.884) (-538.133) -- 0:00:13
884000 -- (-542.229) (-537.529) [-536.372] (-535.865) * [-535.123] (-543.254) (-535.377) (-537.791) -- 0:00:12
884500 -- [-543.717] (-536.552) (-533.528) (-533.311) * (-535.511) (-534.117) (-534.566) [-540.590] -- 0:00:12
885000 -- (-539.090) [-535.039] (-537.586) (-532.179) * (-541.820) (-541.577) (-535.037) [-532.692] -- 0:00:12
Average standard deviation of split frequencies: 0.006385
885500 -- (-540.525) (-534.227) [-537.857] (-534.244) * (-540.939) (-540.561) (-538.058) [-533.530] -- 0:00:12
886000 -- (-541.046) [-537.588] (-540.167) (-536.908) * (-539.676) (-531.313) (-532.554) [-536.430] -- 0:00:12
886500 -- (-538.117) (-538.814) (-534.928) [-540.203] * (-536.766) (-538.137) (-531.566) [-536.436] -- 0:00:12
887000 -- (-537.476) (-537.721) [-536.437] (-538.315) * [-533.713] (-536.791) (-534.684) (-538.591) -- 0:00:12
887500 -- (-535.518) (-538.956) [-534.795] (-536.235) * (-539.990) (-539.635) (-536.606) [-535.390] -- 0:00:12
888000 -- (-537.912) (-536.559) (-532.025) [-539.104] * (-541.227) (-537.642) (-535.227) [-537.255] -- 0:00:12
888500 -- (-533.761) (-540.479) [-533.694] (-539.121) * [-535.628] (-532.541) (-537.143) (-541.254) -- 0:00:12
889000 -- (-536.262) (-540.995) [-538.999] (-538.787) * (-540.306) (-537.561) (-533.462) [-538.190] -- 0:00:12
889500 -- (-538.392) (-536.967) [-534.684] (-540.779) * (-531.868) [-535.195] (-539.306) (-535.873) -- 0:00:12
890000 -- (-539.532) [-541.129] (-540.161) (-535.502) * (-537.295) (-536.804) [-532.520] (-541.369) -- 0:00:12
Average standard deviation of split frequencies: 0.005293
890500 -- (-536.995) [-535.664] (-536.228) (-537.181) * (-537.052) (-534.969) [-531.488] (-536.388) -- 0:00:12
891000 -- (-533.426) [-534.248] (-534.613) (-536.034) * (-536.527) (-535.675) [-539.977] (-535.488) -- 0:00:12
891500 -- (-537.353) (-532.856) (-535.500) [-535.377] * (-538.689) [-542.201] (-532.651) (-536.788) -- 0:00:12
892000 -- [-532.663] (-533.497) (-535.928) (-538.466) * (-538.008) [-536.156] (-536.905) (-536.850) -- 0:00:12
892500 -- (-531.112) (-535.615) (-532.932) [-539.263] * (-537.644) (-545.176) (-532.585) [-533.955] -- 0:00:12
893000 -- (-541.563) (-536.716) [-536.682] (-539.209) * (-536.134) [-540.665] (-533.212) (-534.788) -- 0:00:11
893500 -- (-545.536) (-538.594) (-536.979) [-536.107] * (-539.159) (-532.347) [-532.782] (-537.592) -- 0:00:11
894000 -- (-542.689) (-539.150) (-541.363) [-534.657] * (-532.862) [-536.139] (-533.145) (-540.589) -- 0:00:11
894500 -- (-533.456) (-544.509) [-536.819] (-536.367) * [-532.577] (-543.786) (-538.557) (-535.551) -- 0:00:11
895000 -- (-540.637) (-532.952) [-531.752] (-541.412) * (-538.023) [-532.082] (-537.672) (-535.615) -- 0:00:11
Average standard deviation of split frequencies: 0.005963
895500 -- (-537.773) (-536.606) (-538.963) [-531.617] * (-534.882) [-539.264] (-535.128) (-533.368) -- 0:00:11
896000 -- (-534.582) [-534.774] (-536.915) (-537.730) * (-536.104) (-537.002) [-532.690] (-538.242) -- 0:00:11
896500 -- (-536.128) (-536.192) [-537.198] (-537.989) * (-536.880) [-538.047] (-536.428) (-534.760) -- 0:00:11
897000 -- (-539.011) (-534.929) [-530.721] (-542.847) * (-535.414) [-537.451] (-537.787) (-534.887) -- 0:00:11
897500 -- (-542.641) (-539.571) [-537.864] (-534.474) * (-536.859) (-546.806) [-534.563] (-535.751) -- 0:00:11
898000 -- [-538.543] (-535.318) (-534.424) (-536.385) * (-532.603) (-539.384) (-533.769) [-540.201] -- 0:00:11
898500 -- (-537.696) (-537.114) [-539.995] (-532.802) * [-532.652] (-539.784) (-536.602) (-541.495) -- 0:00:11
899000 -- (-539.880) [-533.305] (-537.091) (-538.887) * (-530.484) [-535.387] (-538.897) (-534.316) -- 0:00:11
899500 -- [-537.036] (-534.126) (-537.069) (-534.786) * (-533.956) (-539.237) (-540.048) [-535.354] -- 0:00:11
900000 -- (-544.422) [-533.066] (-536.962) (-535.002) * (-538.669) (-538.406) [-536.650] (-537.359) -- 0:00:11
Average standard deviation of split frequencies: 0.004187
900500 -- (-538.556) (-542.437) [-531.479] (-541.944) * (-535.317) (-539.109) (-538.610) [-539.274] -- 0:00:11
901000 -- (-538.483) [-535.519] (-537.673) (-535.145) * (-532.513) (-538.450) (-538.790) [-535.302] -- 0:00:11
901500 -- (-540.571) (-539.285) [-537.267] (-536.005) * (-533.332) [-536.071] (-534.207) (-534.102) -- 0:00:11
902000 -- [-535.400] (-538.635) (-535.415) (-546.610) * (-531.537) [-534.411] (-535.401) (-534.417) -- 0:00:10
902500 -- (-534.551) [-532.864] (-547.693) (-541.314) * [-537.248] (-536.637) (-536.500) (-535.730) -- 0:00:10
903000 -- (-534.331) [-537.577] (-543.498) (-533.945) * (-536.711) (-538.288) [-531.853] (-537.151) -- 0:00:10
903500 -- (-541.050) (-534.224) (-541.561) [-536.572] * [-532.146] (-532.649) (-533.268) (-535.511) -- 0:00:10
904000 -- (-536.561) (-534.054) [-538.971] (-537.860) * (-531.458) [-537.087] (-536.934) (-533.042) -- 0:00:10
904500 -- (-534.562) (-534.140) (-534.118) [-535.241] * [-531.609] (-534.898) (-534.959) (-541.428) -- 0:00:10
905000 -- [-534.078] (-534.397) (-539.957) (-537.644) * [-535.328] (-534.357) (-539.444) (-538.025) -- 0:00:10
Average standard deviation of split frequencies: 0.005203
905500 -- (-541.368) [-539.609] (-538.853) (-538.944) * [-538.584] (-535.625) (-533.119) (-535.992) -- 0:00:10
906000 -- (-535.544) [-537.027] (-538.651) (-533.251) * [-530.711] (-533.325) (-534.150) (-541.595) -- 0:00:10
906500 -- [-534.739] (-540.507) (-535.284) (-533.612) * (-531.239) (-537.268) (-532.751) [-538.800] -- 0:00:10
907000 -- [-537.279] (-536.198) (-540.387) (-538.722) * (-536.891) (-535.904) [-533.445] (-535.288) -- 0:00:10
907500 -- (-537.979) (-538.084) [-538.775] (-544.856) * (-535.318) [-531.559] (-540.487) (-533.434) -- 0:00:10
908000 -- (-539.046) (-533.542) [-537.249] (-544.476) * [-532.328] (-532.423) (-540.779) (-540.494) -- 0:00:10
908500 -- [-535.515] (-534.765) (-541.727) (-538.961) * [-532.892] (-533.596) (-543.733) (-538.882) -- 0:00:10
909000 -- (-536.107) [-534.503] (-539.226) (-536.359) * (-538.706) (-535.173) [-537.520] (-539.280) -- 0:00:10
909500 -- (-535.430) (-536.530) (-532.551) [-533.159] * (-537.221) [-545.570] (-534.195) (-536.645) -- 0:00:10
910000 -- [-532.869] (-535.974) (-530.794) (-536.105) * (-536.999) [-538.863] (-547.133) (-538.610) -- 0:00:10
Average standard deviation of split frequencies: 0.005176
910500 -- (-534.756) [-537.037] (-541.432) (-538.247) * [-540.469] (-536.697) (-542.542) (-539.799) -- 0:00:10
911000 -- (-535.687) (-539.117) (-538.022) [-532.773] * (-542.899) [-534.433] (-535.796) (-535.442) -- 0:00:09
911500 -- (-537.813) (-541.602) [-541.774] (-542.696) * (-547.732) [-541.586] (-537.880) (-536.460) -- 0:00:09
912000 -- [-535.928] (-543.125) (-544.682) (-535.003) * (-539.031) [-538.602] (-534.041) (-539.649) -- 0:00:09
912500 -- (-534.452) (-534.403) [-537.821] (-535.452) * (-540.683) [-536.557] (-531.944) (-535.972) -- 0:00:09
913000 -- (-533.161) [-534.673] (-544.392) (-537.154) * (-541.637) (-538.215) (-536.077) [-532.132] -- 0:00:09
913500 -- (-539.268) (-535.397) [-536.198] (-536.708) * (-540.181) (-539.829) (-539.792) [-538.443] -- 0:00:09
914000 -- (-549.699) [-538.239] (-535.454) (-536.450) * (-540.416) [-535.579] (-542.692) (-535.811) -- 0:00:09
914500 -- (-536.830) [-537.538] (-536.669) (-535.870) * (-537.139) (-537.717) (-548.439) [-532.702] -- 0:00:09
915000 -- (-537.461) (-537.713) (-535.806) [-533.277] * (-531.515) [-538.103] (-545.214) (-536.489) -- 0:00:09
Average standard deviation of split frequencies: 0.006176
915500 -- [-533.148] (-544.152) (-534.473) (-541.454) * (-533.296) (-538.355) [-537.895] (-536.850) -- 0:00:09
916000 -- (-534.551) (-537.060) (-534.628) [-537.451] * [-534.506] (-536.104) (-541.276) (-538.416) -- 0:00:09
916500 -- [-537.622] (-537.049) (-538.011) (-534.455) * (-539.603) (-534.396) [-545.337] (-537.772) -- 0:00:09
917000 -- (-531.440) (-534.059) (-531.849) [-535.399] * (-536.152) (-530.265) [-532.492] (-534.142) -- 0:00:09
917500 -- (-535.332) (-542.639) (-538.455) [-536.223] * [-531.333] (-534.973) (-538.569) (-536.180) -- 0:00:09
918000 -- [-532.982] (-540.470) (-535.935) (-535.822) * (-536.240) [-536.420] (-537.808) (-537.825) -- 0:00:09
918500 -- (-534.892) [-534.370] (-540.257) (-537.162) * (-534.778) (-540.207) [-544.623] (-542.103) -- 0:00:09
919000 -- (-535.402) (-536.522) (-541.265) [-532.292] * (-534.089) (-539.188) (-534.147) [-538.151] -- 0:00:08
919500 -- (-534.006) [-534.849] (-537.180) (-540.783) * (-534.674) [-534.523] (-540.298) (-533.884) -- 0:00:09
920000 -- (-532.996) [-534.320] (-536.649) (-538.510) * (-535.511) (-535.071) [-536.642] (-538.589) -- 0:00:08
Average standard deviation of split frequencies: 0.006144
920500 -- (-533.492) [-537.296] (-537.586) (-533.328) * [-536.786] (-535.605) (-533.524) (-537.147) -- 0:00:08
921000 -- (-532.483) (-538.114) [-539.152] (-537.291) * (-532.438) (-537.611) [-534.703] (-535.816) -- 0:00:08
921500 -- (-536.552) (-542.702) [-531.531] (-536.998) * (-536.754) (-540.988) (-534.260) [-535.761] -- 0:00:08
922000 -- (-539.283) (-535.906) [-536.596] (-536.061) * [-534.078] (-539.182) (-536.307) (-535.804) -- 0:00:08
922500 -- (-538.540) (-541.177) (-542.039) [-540.504] * (-544.497) [-539.637] (-532.634) (-539.824) -- 0:00:08
923000 -- (-535.022) (-538.289) [-538.561] (-540.740) * (-544.808) (-534.634) [-535.759] (-537.249) -- 0:00:08
923500 -- [-533.686] (-540.330) (-538.167) (-534.379) * (-533.201) [-538.227] (-539.242) (-534.367) -- 0:00:08
924000 -- (-536.389) (-532.627) (-536.967) [-534.574] * (-536.962) (-534.937) (-535.969) [-532.813] -- 0:00:08
924500 -- (-538.789) (-533.186) [-534.419] (-537.587) * [-533.690] (-535.250) (-541.232) (-533.163) -- 0:00:08
925000 -- [-538.559] (-534.863) (-538.968) (-536.556) * (-534.397) (-546.130) (-538.037) [-533.431] -- 0:00:08
Average standard deviation of split frequencies: 0.006448
925500 -- (-537.473) (-542.339) (-537.674) [-533.737] * (-540.678) [-536.496] (-538.065) (-536.577) -- 0:00:08
926000 -- (-541.694) (-536.265) (-534.750) [-539.897] * (-531.476) [-532.527] (-537.046) (-534.623) -- 0:00:08
926500 -- (-533.312) (-541.069) [-535.250] (-536.508) * (-539.535) [-534.233] (-535.805) (-538.494) -- 0:00:08
927000 -- [-538.487] (-534.969) (-537.996) (-545.030) * (-540.902) [-537.191] (-536.882) (-531.732) -- 0:00:08
927500 -- (-538.625) (-533.098) (-534.091) [-538.564] * (-538.188) (-535.772) [-536.947] (-531.328) -- 0:00:08
928000 -- [-534.484] (-534.778) (-538.587) (-535.962) * (-537.628) (-533.696) [-537.969] (-533.760) -- 0:00:07
928500 -- (-534.814) (-535.086) (-533.476) [-533.851] * (-533.172) [-536.318] (-535.082) (-535.341) -- 0:00:08
929000 -- (-535.779) [-533.254] (-536.968) (-536.696) * (-535.637) [-538.309] (-533.698) (-535.220) -- 0:00:07
929500 -- (-538.956) (-539.682) [-535.370] (-537.413) * [-533.469] (-542.070) (-539.130) (-534.995) -- 0:00:07
930000 -- (-536.551) (-544.180) (-535.955) [-536.124] * (-531.955) [-536.551] (-536.696) (-536.194) -- 0:00:07
Average standard deviation of split frequencies: 0.006754
930500 -- (-536.016) [-539.060] (-536.075) (-535.225) * [-535.970] (-536.039) (-541.360) (-539.115) -- 0:00:07
931000 -- [-538.878] (-535.761) (-534.170) (-536.014) * (-534.441) (-537.018) (-536.440) [-532.814] -- 0:00:07
931500 -- [-537.996] (-538.861) (-540.496) (-543.181) * (-538.549) (-537.535) (-536.296) [-535.457] -- 0:00:07
932000 -- (-543.126) (-535.222) (-534.923) [-533.382] * (-548.789) (-536.041) [-537.905] (-538.911) -- 0:00:07
932500 -- (-536.351) (-539.414) [-533.545] (-539.094) * (-546.670) [-539.833] (-541.359) (-535.677) -- 0:00:07
933000 -- (-537.756) (-540.863) [-535.536] (-533.823) * (-537.400) (-535.307) [-536.074] (-541.235) -- 0:00:07
933500 -- (-539.263) [-535.088] (-532.944) (-534.146) * (-538.785) [-535.802] (-534.077) (-535.474) -- 0:00:07
934000 -- (-543.011) [-539.198] (-535.717) (-533.757) * (-541.703) (-538.524) [-538.562] (-534.472) -- 0:00:07
934500 -- (-540.720) (-532.157) (-536.870) [-538.394] * (-537.431) (-533.311) (-543.556) [-535.295] -- 0:00:07
935000 -- [-541.235] (-537.799) (-543.816) (-538.722) * (-532.785) [-532.707] (-535.613) (-537.820) -- 0:00:07
Average standard deviation of split frequencies: 0.006044
935500 -- (-539.412) [-533.147] (-537.494) (-542.050) * [-542.858] (-535.908) (-533.467) (-537.741) -- 0:00:07
936000 -- (-537.895) [-536.988] (-539.116) (-545.855) * (-534.972) (-537.330) (-536.351) [-535.892] -- 0:00:07
936500 -- [-532.028] (-534.331) (-540.799) (-538.896) * (-540.144) [-538.210] (-536.449) (-539.053) -- 0:00:07
937000 -- (-533.462) [-536.060] (-540.813) (-532.935) * (-536.763) [-536.551] (-530.536) (-538.746) -- 0:00:06
937500 -- [-536.925] (-533.612) (-542.164) (-537.046) * (-539.028) (-543.546) (-534.418) [-539.054] -- 0:00:06
938000 -- [-538.602] (-533.814) (-539.360) (-545.841) * (-537.356) (-543.540) [-532.928] (-540.075) -- 0:00:06
938500 -- (-544.890) (-536.603) [-535.497] (-536.753) * (-530.971) [-540.585] (-535.841) (-539.168) -- 0:00:06
939000 -- (-544.568) [-535.628] (-539.966) (-538.373) * (-535.549) [-531.781] (-538.654) (-541.016) -- 0:00:06
939500 -- (-540.552) (-540.094) [-534.499] (-538.155) * [-535.119] (-535.904) (-533.993) (-535.993) -- 0:00:06
940000 -- (-536.672) (-540.243) (-535.562) [-540.835] * (-534.671) [-534.272] (-536.460) (-533.936) -- 0:00:06
Average standard deviation of split frequencies: 0.006014
940500 -- [-536.741] (-536.170) (-547.039) (-542.039) * [-538.166] (-537.043) (-534.688) (-536.443) -- 0:00:06
941000 -- (-540.302) (-535.141) [-537.929] (-537.739) * (-547.598) (-538.931) (-536.456) [-536.550] -- 0:00:06
941500 -- [-537.519] (-534.563) (-539.021) (-535.922) * (-540.354) [-533.839] (-535.209) (-538.862) -- 0:00:06
942000 -- (-536.755) (-537.330) (-538.567) [-534.125] * (-538.626) (-540.798) [-539.969] (-536.925) -- 0:00:06
942500 -- (-538.161) [-539.627] (-541.386) (-543.852) * (-539.986) (-538.794) [-534.894] (-538.106) -- 0:00:06
943000 -- [-534.298] (-536.989) (-539.463) (-535.856) * (-541.245) (-532.970) [-532.823] (-539.082) -- 0:00:06
943500 -- (-535.292) (-534.387) (-537.323) [-535.638] * (-540.586) [-532.108] (-532.037) (-537.580) -- 0:00:06
944000 -- (-541.649) [-532.335] (-536.650) (-537.283) * (-534.132) (-542.631) [-540.516] (-538.423) -- 0:00:06
944500 -- (-547.378) (-537.553) [-541.297] (-541.289) * [-535.295] (-537.042) (-533.461) (-540.332) -- 0:00:06
945000 -- [-538.783] (-541.985) (-535.122) (-533.531) * (-540.411) (-537.161) (-543.128) [-535.999] -- 0:00:06
Average standard deviation of split frequencies: 0.006644
945500 -- (-539.819) (-537.594) [-538.852] (-533.768) * (-539.205) (-540.799) [-538.144] (-547.307) -- 0:00:06
946000 -- (-539.783) (-533.044) (-538.982) [-538.562] * [-537.715] (-538.234) (-536.018) (-543.083) -- 0:00:05
946500 -- (-540.029) [-533.564] (-542.736) (-540.564) * (-533.131) (-540.062) [-533.576] (-538.893) -- 0:00:05
947000 -- [-538.795] (-535.258) (-542.664) (-538.120) * (-538.017) (-535.961) (-536.590) [-541.727] -- 0:00:05
947500 -- (-548.415) [-535.880] (-538.407) (-541.877) * (-535.940) [-536.028] (-534.987) (-538.752) -- 0:00:05
948000 -- (-531.996) [-536.028] (-539.142) (-537.534) * (-541.846) (-539.673) (-536.968) [-534.386] -- 0:00:05
948500 -- (-536.417) (-531.552) (-540.060) [-537.011] * (-537.594) (-538.156) (-536.802) [-534.732] -- 0:00:05
949000 -- (-540.732) [-534.195] (-541.071) (-538.372) * (-536.588) [-535.191] (-535.746) (-539.100) -- 0:00:05
949500 -- (-534.774) [-533.886] (-539.881) (-537.387) * [-542.189] (-532.923) (-542.789) (-533.395) -- 0:00:05
950000 -- (-537.044) (-540.008) (-534.248) [-536.288] * [-533.506] (-538.860) (-545.165) (-538.786) -- 0:00:05
Average standard deviation of split frequencies: 0.005950
950500 -- (-540.584) (-536.683) (-539.038) [-535.994] * (-539.465) (-537.087) (-536.103) [-536.146] -- 0:00:05
951000 -- (-537.181) (-538.123) [-536.036] (-531.407) * (-533.720) (-539.862) [-538.459] (-533.376) -- 0:00:05
951500 -- (-536.491) (-541.470) (-538.769) [-532.501] * [-536.796] (-535.065) (-532.169) (-534.921) -- 0:00:05
952000 -- (-537.989) (-538.513) (-540.049) [-536.601] * (-540.304) [-534.429] (-532.748) (-538.128) -- 0:00:05
952500 -- (-536.220) (-537.718) (-537.934) [-538.057] * (-531.346) (-544.810) [-532.125] (-533.465) -- 0:00:05
953000 -- (-535.674) (-546.145) (-535.618) [-534.214] * (-541.739) [-537.956] (-536.665) (-540.930) -- 0:00:05
953500 -- (-537.017) (-535.552) [-533.736] (-536.810) * (-535.830) (-539.525) [-532.678] (-535.556) -- 0:00:05
954000 -- (-536.040) (-539.127) [-536.046] (-536.116) * (-537.663) (-538.565) [-534.100] (-532.155) -- 0:00:05
954500 -- (-533.737) (-537.885) [-533.468] (-537.045) * [-532.769] (-538.343) (-537.681) (-538.006) -- 0:00:05
955000 -- (-539.179) [-535.542] (-538.395) (-536.129) * [-535.112] (-536.715) (-535.599) (-534.981) -- 0:00:04
Average standard deviation of split frequencies: 0.006903
955500 -- [-541.917] (-539.280) (-540.433) (-535.253) * (-538.763) (-536.260) [-534.723] (-537.057) -- 0:00:04
956000 -- (-535.166) [-534.760] (-540.814) (-540.038) * [-537.431] (-533.052) (-537.913) (-536.267) -- 0:00:04
956500 -- (-536.477) (-535.819) (-545.072) [-539.849] * [-534.719] (-538.839) (-536.356) (-539.608) -- 0:00:04
957000 -- (-540.314) (-532.987) [-533.602] (-532.790) * [-532.991] (-535.161) (-534.525) (-539.146) -- 0:00:04
957500 -- (-532.569) [-534.794] (-531.399) (-533.340) * (-536.741) (-538.680) [-538.044] (-538.494) -- 0:00:04
958000 -- (-543.962) (-534.154) [-533.592] (-535.341) * [-533.714] (-534.090) (-536.682) (-536.314) -- 0:00:04
958500 -- [-533.495] (-531.635) (-535.499) (-532.871) * (-538.683) (-538.916) [-535.092] (-533.419) -- 0:00:04
959000 -- [-537.358] (-535.862) (-538.598) (-538.064) * (-536.148) (-535.229) [-532.780] (-537.309) -- 0:00:04
959500 -- [-536.923] (-531.412) (-538.536) (-541.642) * (-535.343) (-535.526) (-534.905) [-533.548] -- 0:00:04
960000 -- (-537.107) (-536.703) (-535.582) [-537.522] * (-540.524) [-532.018] (-536.021) (-540.574) -- 0:00:04
Average standard deviation of split frequencies: 0.006543
960500 -- (-535.698) [-536.311] (-536.707) (-536.404) * [-536.627] (-537.508) (-536.221) (-537.391) -- 0:00:04
961000 -- (-536.239) (-539.554) (-539.407) [-533.554] * [-537.729] (-535.408) (-537.520) (-535.638) -- 0:00:04
961500 -- (-536.172) (-534.263) [-538.019] (-533.678) * [-536.873] (-531.725) (-534.209) (-534.993) -- 0:00:04
962000 -- (-536.969) (-542.280) (-537.517) [-534.153] * (-538.774) [-533.438] (-537.016) (-541.058) -- 0:00:04
962500 -- [-538.365] (-543.232) (-536.685) (-538.710) * (-536.706) [-539.787] (-540.134) (-534.545) -- 0:00:04
963000 -- [-540.089] (-537.895) (-535.437) (-537.537) * [-533.040] (-539.443) (-546.077) (-534.754) -- 0:00:04
963500 -- (-535.820) (-539.065) (-532.053) [-535.393] * (-536.792) (-537.118) (-541.402) [-536.362] -- 0:00:04
964000 -- (-533.302) (-539.343) (-532.029) [-535.642] * (-536.970) (-537.902) (-536.661) [-539.772] -- 0:00:03
964500 -- [-533.488] (-537.758) (-537.669) (-533.106) * (-541.549) (-535.275) (-540.199) [-532.849] -- 0:00:03
965000 -- (-539.997) [-538.447] (-540.659) (-536.457) * (-540.571) [-536.080] (-536.361) (-538.472) -- 0:00:03
Average standard deviation of split frequencies: 0.006181
965500 -- (-536.202) (-531.884) (-534.376) [-534.222] * (-537.816) (-537.793) (-544.335) [-540.044] -- 0:00:03
966000 -- (-541.051) (-537.851) (-535.282) [-535.040] * (-537.389) [-533.259] (-534.247) (-536.136) -- 0:00:03
966500 -- (-544.175) (-538.321) (-538.471) [-533.062] * [-538.381] (-535.569) (-534.620) (-531.407) -- 0:00:03
967000 -- (-542.532) (-539.853) [-532.924] (-538.841) * [-536.325] (-540.508) (-536.725) (-541.611) -- 0:00:03
967500 -- (-545.025) [-535.320] (-539.012) (-542.729) * (-533.537) [-533.595] (-539.275) (-535.506) -- 0:00:03
968000 -- (-536.512) (-537.678) (-543.480) [-531.933] * (-535.877) (-531.143) [-538.501] (-534.375) -- 0:00:03
968500 -- (-545.180) [-535.304] (-537.172) (-543.962) * (-541.126) [-532.094] (-534.999) (-541.450) -- 0:00:03
969000 -- (-535.960) (-530.731) [-541.580] (-538.916) * (-537.241) (-532.347) [-538.575] (-538.272) -- 0:00:03
969500 -- (-535.353) (-537.041) (-535.858) [-536.236] * (-536.751) (-534.354) [-534.081] (-540.232) -- 0:00:03
970000 -- (-536.717) [-534.968] (-534.581) (-537.109) * (-537.064) [-540.573] (-535.799) (-540.570) -- 0:00:03
Average standard deviation of split frequencies: 0.005828
970500 -- (-540.929) [-537.833] (-541.930) (-537.615) * (-541.668) (-543.912) [-535.502] (-536.873) -- 0:00:03
971000 -- (-532.202) (-537.087) [-535.828] (-541.289) * (-538.452) (-539.017) [-532.992] (-540.331) -- 0:00:03
971500 -- (-537.327) (-541.925) [-534.773] (-538.065) * (-539.686) (-539.439) [-535.368] (-541.430) -- 0:00:03
972000 -- (-534.354) (-538.109) (-536.282) [-534.317] * (-533.775) (-539.390) [-537.616] (-543.916) -- 0:00:03
972500 -- (-538.662) (-538.188) (-537.843) [-535.487] * (-539.153) (-532.911) (-536.317) [-543.025] -- 0:00:03
973000 -- (-536.266) (-537.731) (-534.832) [-537.643] * (-539.282) (-539.826) [-533.462] (-537.838) -- 0:00:02
973500 -- (-535.324) (-536.790) [-537.364] (-539.907) * (-543.096) (-538.962) [-531.922] (-534.524) -- 0:00:02
974000 -- (-536.027) (-538.250) [-534.207] (-539.964) * (-547.001) (-536.541) [-532.539] (-537.235) -- 0:00:02
974500 -- (-534.050) [-535.804] (-539.363) (-535.147) * (-537.211) (-536.499) (-534.795) [-534.505] -- 0:00:02
975000 -- (-532.718) [-537.373] (-542.961) (-533.580) * [-537.055] (-534.490) (-537.242) (-535.064) -- 0:00:02
Average standard deviation of split frequencies: 0.005796
975500 -- (-536.461) [-534.066] (-538.466) (-536.441) * (-549.911) (-541.325) [-533.037] (-531.681) -- 0:00:02
976000 -- (-537.464) [-534.111] (-540.418) (-537.978) * [-540.059] (-537.544) (-539.697) (-536.273) -- 0:00:02
976500 -- (-534.231) (-533.593) [-544.821] (-536.249) * (-536.330) (-535.223) (-533.636) [-531.881] -- 0:00:02
977000 -- (-545.393) [-536.871] (-536.839) (-537.480) * (-535.513) [-536.542] (-536.830) (-532.940) -- 0:00:02
977500 -- (-538.187) [-538.799] (-541.859) (-542.213) * (-540.998) [-534.222] (-538.343) (-533.911) -- 0:00:02
978000 -- (-536.209) (-541.181) (-535.903) [-534.385] * (-541.809) (-544.222) (-534.283) [-536.288] -- 0:00:02
978500 -- [-533.695] (-535.224) (-535.180) (-534.345) * (-540.027) [-535.095] (-534.812) (-535.454) -- 0:00:02
979000 -- (-536.893) (-536.405) (-535.505) [-540.848] * [-537.414] (-534.196) (-539.209) (-534.174) -- 0:00:02
979500 -- (-540.311) (-539.619) (-535.009) [-535.518] * (-540.562) (-536.864) (-539.177) [-535.125] -- 0:00:02
980000 -- (-538.629) (-535.107) (-535.195) [-537.520] * [-530.427] (-543.826) (-539.109) (-532.463) -- 0:00:02
Average standard deviation of split frequencies: 0.004807
980500 -- (-538.637) (-530.705) (-539.340) [-536.739] * [-531.192] (-537.030) (-533.054) (-533.091) -- 0:00:02
981000 -- (-540.888) [-535.901] (-536.785) (-535.746) * (-533.312) (-535.014) [-535.857] (-538.317) -- 0:00:02
981500 -- (-544.536) (-541.182) [-535.118] (-535.615) * (-537.080) [-535.320] (-541.403) (-536.045) -- 0:00:02
982000 -- (-540.785) (-538.681) [-531.761] (-540.010) * [-535.301] (-543.384) (-547.808) (-536.122) -- 0:00:01
982500 -- (-540.973) (-534.684) (-530.623) [-535.685] * [-533.838] (-539.103) (-541.121) (-546.072) -- 0:00:01
983000 -- (-542.331) (-539.637) (-531.853) [-537.247] * (-537.037) (-537.001) [-533.784] (-534.895) -- 0:00:01
983500 -- (-550.445) (-540.027) (-530.891) [-536.430] * (-531.685) (-539.166) [-532.048] (-533.634) -- 0:00:01
984000 -- (-543.350) (-534.894) (-541.855) [-531.833] * (-535.133) (-537.690) (-534.686) [-532.207] -- 0:00:01
984500 -- (-540.080) (-542.897) (-540.191) [-535.525] * (-540.277) [-538.937] (-540.966) (-533.022) -- 0:00:01
985000 -- (-537.026) (-535.851) (-533.727) [-539.365] * [-536.487] (-535.259) (-537.854) (-537.073) -- 0:00:01
Average standard deviation of split frequencies: 0.005100
985500 -- (-538.773) (-538.768) (-540.200) [-533.697] * [-538.574] (-541.425) (-535.245) (-535.397) -- 0:00:01
986000 -- (-534.279) (-533.325) [-538.799] (-532.199) * (-534.332) [-538.122] (-534.419) (-538.764) -- 0:00:01
986500 -- (-532.345) [-535.169] (-534.587) (-535.797) * (-538.748) [-542.487] (-541.341) (-536.173) -- 0:00:01
987000 -- (-533.901) (-534.667) [-532.577] (-534.102) * (-535.822) (-535.108) [-537.585] (-537.276) -- 0:00:01
987500 -- [-531.455] (-533.997) (-532.961) (-535.711) * [-537.802] (-535.957) (-542.532) (-531.507) -- 0:00:01
988000 -- (-542.739) (-533.609) (-534.272) [-532.080] * (-537.609) (-536.478) (-537.358) [-532.780] -- 0:00:01
988500 -- (-534.460) (-535.266) [-534.342] (-535.350) * (-542.557) (-535.119) [-538.103] (-536.151) -- 0:00:01
989000 -- (-536.637) (-536.371) [-537.095] (-545.928) * (-539.965) (-537.672) (-533.757) [-534.874] -- 0:00:01
989500 -- (-539.041) (-538.249) [-536.328] (-536.742) * (-542.961) (-537.515) [-536.868] (-534.248) -- 0:00:01
990000 -- [-537.748] (-541.806) (-538.481) (-531.027) * (-539.814) [-535.426] (-535.489) (-539.446) -- 0:00:01
Average standard deviation of split frequencies: 0.005393
990500 -- (-536.154) [-537.132] (-539.311) (-537.657) * [-536.573] (-538.013) (-537.755) (-537.763) -- 0:00:01
991000 -- (-537.493) [-537.234] (-534.066) (-541.696) * (-538.827) (-544.502) (-535.074) [-537.740] -- 0:00:00
991500 -- [-536.415] (-542.070) (-537.344) (-534.690) * (-537.254) (-538.589) [-544.390] (-537.790) -- 0:00:00
992000 -- (-536.241) (-536.184) (-541.681) [-533.732] * (-535.726) (-537.039) (-537.321) [-535.133] -- 0:00:00
992500 -- (-535.232) (-537.492) (-540.591) [-532.520] * (-537.210) (-540.782) (-531.883) [-535.252] -- 0:00:00
993000 -- (-538.538) (-536.931) (-541.323) [-533.007] * [-534.183] (-540.226) (-537.826) (-533.338) -- 0:00:00
993500 -- (-535.457) (-538.653) [-535.566] (-535.277) * (-536.541) (-543.742) [-532.751] (-534.648) -- 0:00:00
994000 -- (-538.476) [-536.754] (-534.705) (-536.196) * (-533.956) (-542.678) (-534.722) [-543.738] -- 0:00:00
994500 -- [-536.435] (-533.585) (-535.657) (-536.813) * (-542.202) [-536.468] (-533.998) (-532.609) -- 0:00:00
995000 -- (-537.100) [-534.626] (-536.690) (-540.608) * (-537.336) [-534.659] (-533.361) (-533.935) -- 0:00:00
Average standard deviation of split frequencies: 0.005364
995500 -- (-541.830) (-532.486) (-536.762) [-534.615] * (-539.598) [-532.862] (-532.391) (-538.081) -- 0:00:00
996000 -- [-535.249] (-536.949) (-539.345) (-538.424) * [-542.590] (-538.363) (-535.715) (-541.235) -- 0:00:00
996500 -- (-537.893) [-535.649] (-532.106) (-536.362) * (-533.178) [-535.766] (-547.083) (-537.397) -- 0:00:00
997000 -- (-535.537) (-540.051) (-538.998) [-537.821] * (-538.296) [-537.935] (-539.959) (-533.972) -- 0:00:00
997500 -- (-536.004) (-533.466) (-537.271) [-533.222] * (-536.031) (-536.777) [-534.697] (-535.742) -- 0:00:00
998000 -- [-533.013] (-535.497) (-536.418) (-541.917) * [-538.060] (-545.308) (-538.651) (-534.973) -- 0:00:00
998500 -- (-534.035) [-538.271] (-536.397) (-542.862) * (-535.648) (-535.694) [-532.363] (-544.942) -- 0:00:00
999000 -- [-534.527] (-538.326) (-536.621) (-539.242) * (-536.924) [-534.514] (-535.367) (-542.950) -- 0:00:00
999500 -- [-536.430] (-541.882) (-542.520) (-532.947) * (-533.030) [-545.071] (-536.431) (-539.303) -- 0:00:00
1000000 -- [-540.983] (-536.989) (-538.873) (-541.700) * (-537.951) [-537.804] (-541.995) (-541.425) -- 0:00:00
Average standard deviation of split frequencies: 0.006281
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -540.982622 -- 12.899259
Chain 1 -- -540.982622 -- 12.899259
Chain 2 -- -536.989204 -- 13.475884
Chain 2 -- -536.989204 -- 13.475884
Chain 3 -- -538.872997 -- 10.576942
Chain 3 -- -538.872997 -- 10.576942
Chain 4 -- -541.700165 -- 9.041844
Chain 4 -- -541.700165 -- 9.041844
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -537.950550 -- 12.469495
Chain 1 -- -537.950548 -- 12.469495
Chain 2 -- -537.803994 -- 8.902845
Chain 2 -- -537.803994 -- 8.902845
Chain 3 -- -541.995274 -- 12.462934
Chain 3 -- -541.995274 -- 12.462934
Chain 4 -- -541.424682 -- 10.275797
Chain 4 -- -541.424682 -- 10.275797
Analysis completed in 1 mins 51 seconds
Analysis used 110.85 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -528.80
Likelihood of best state for "cold" chain of run 2 was -528.80
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
68.5 % ( 51 %) Dirichlet(Revmat{all})
80.6 % ( 66 %) Slider(Revmat{all})
38.5 % ( 23 %) Dirichlet(Pi{all})
37.4 % ( 27 %) Slider(Pi{all})
60.1 % ( 28 %) Multiplier(Alpha{1,2})
49.4 % ( 24 %) Multiplier(Alpha{3})
77.7 % ( 63 %) Slider(Pinvar{all})
42.7 % ( 41 %) NNI(Tau{all},V{all})
33.6 % ( 28 %) ParsSPR(Tau{all},V{all})
26.4 % ( 27 %) Multiplier(V{all})
45.8 % ( 49 %) Nodeslider(V{all})
26.9 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
68.9 % ( 57 %) Dirichlet(Revmat{all})
80.6 % ( 57 %) Slider(Revmat{all})
38.2 % ( 19 %) Dirichlet(Pi{all})
36.8 % ( 27 %) Slider(Pi{all})
60.5 % ( 31 %) Multiplier(Alpha{1,2})
49.5 % ( 31 %) Multiplier(Alpha{3})
77.8 % ( 55 %) Slider(Pinvar{all})
42.4 % ( 31 %) NNI(Tau{all},V{all})
33.5 % ( 27 %) ParsSPR(Tau{all},V{all})
26.5 % ( 23 %) Multiplier(V{all})
46.0 % ( 47 %) Nodeslider(V{all})
26.4 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.57
2 | 166683 0.85 0.72
3 | 166397 166666 0.86
4 | 167211 166428 166615
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166560 0.85 0.72
3 | 167582 166242 0.87
4 | 166747 166421 166448
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -534.54
| 2 |
| 1 |
| 1 1 2 222 2 2 |
| 1 1 2 1 22 2 |
| 2 1 2 2 1 1 1 1 |
| 2 2 2 22 2 1 1 * 1 1 21|
|* 12 2 2 1 2 21 1 1 1 |
| 1 1 2 2 2 2 2 11 11 |
| 11 * 12 11 2 21 1 1 1 21 *2 2 |
| 2 1 1 2 2 2 1 |
| 2 22 11 21 2 1 2 1 2*2 |
| 1 1 1 2 |
| 1 1 2 1 |
| 2 1 11 2 2|
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -537.10
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.64 -541.89
2 -533.37 -543.68
--------------------------------------
TOTAL -533.49 -543.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.371916 0.009780 0.211656 0.563684 0.354313 1387.75 1444.37 1.000
r(A<->C){all} 0.229767 0.007796 0.067722 0.403865 0.221933 505.58 567.08 1.002
r(A<->G){all} 0.180828 0.005261 0.050907 0.323230 0.172141 733.91 758.46 1.000
r(A<->T){all} 0.099655 0.002970 0.008813 0.205847 0.093046 723.41 725.57 1.001
r(C<->G){all} 0.080760 0.002785 0.000931 0.181650 0.069931 571.92 703.34 1.000
r(C<->T){all} 0.296200 0.007564 0.132801 0.473416 0.292110 649.68 810.62 1.000
r(G<->T){all} 0.112790 0.002651 0.023272 0.216240 0.103428 917.70 954.73 1.000
pi(A){all} 0.249538 0.000687 0.198511 0.301542 0.248535 1136.21 1318.61 1.000
pi(C){all} 0.191857 0.000570 0.147063 0.238346 0.191139 973.43 1037.70 1.001
pi(G){all} 0.249672 0.000728 0.196624 0.301626 0.249306 1112.65 1255.57 1.000
pi(T){all} 0.308933 0.000781 0.255924 0.364509 0.308498 1093.18 1250.47 1.001
alpha{1,2} 0.151428 0.024076 0.000199 0.419809 0.115563 1256.90 1358.53 1.001
alpha{3} 1.329204 0.454405 0.316347 2.639709 1.210331 1345.80 1396.42 1.000
pinvar{all} 0.194049 0.017363 0.000061 0.436651 0.177473 1051.72 1276.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- .**.
6 -- ..**
7 -- .*.*
----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 2146 0.714857 0.009422 0.708195 0.721519 2
6 428 0.142572 0.003769 0.139907 0.145237 2
7 428 0.142572 0.005653 0.138574 0.146569 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.021684 0.000244 0.000004 0.051256 0.018615 1.000 2
length{all}[2] 0.050559 0.000397 0.014621 0.088079 0.047850 1.000 2
length{all}[3] 0.028992 0.000199 0.005538 0.056152 0.026671 1.000 2
length{all}[4] 0.254827 0.007518 0.117717 0.422926 0.237832 1.000 2
length{all}[5] 0.018465 0.000174 0.000031 0.044338 0.016210 1.000 2
length{all}[6] 0.009764 0.000105 0.000008 0.029547 0.006690 0.999 2
length{all}[7] 0.008848 0.000088 0.000014 0.028499 0.006074 1.004 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006281
Maximum standard deviation of split frequencies = 0.009422
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /------------------------------------ C2 (2)
\-----------------71----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/------ C1 (1)
|
|------------------------------------------------------------------------ C4 (4)
+
| /-------------- C2 (2)
\----+
\-------- C3 (3)
|--------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 4 ls = 231
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
60 patterns at 77 / 77 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
58560 bytes for conP
8160 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 4, (2, 3)); MP score: 42
0.008454 0.486402 0.049927 0.108249 0.057782 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -548.265908
Iterating by ming2
Initial: fx= 548.265908
x= 0.00845 0.48640 0.04993 0.10825 0.05778 0.30000 1.30000
1 h-m-p 0.0000 0.0907 42.3690 ++++YYCCCC 538.490780 5 0.0175 24 | 0/7
2 h-m-p 0.0003 0.0016 139.6375 +CYCCC 533.630143 4 0.0014 42 | 0/7
3 h-m-p 0.0002 0.0010 284.7373 +YYYCC 529.205426 4 0.0008 58 | 0/7
4 h-m-p 0.0002 0.0011 99.1738 CYCCC 528.665769 4 0.0004 75 | 0/7
5 h-m-p 0.0011 0.0266 33.5393 ++YYYYCCC 520.983284 6 0.0169 95 | 0/7
6 h-m-p 0.0001 0.0004 761.0744 CYCCCC 519.630871 5 0.0002 114 | 0/7
7 h-m-p 0.0045 0.0225 12.2181 YCCC 519.498149 3 0.0021 129 | 0/7
8 h-m-p 0.1233 8.0000 0.2104 +YYCCCC 514.842447 5 0.8391 148 | 0/7
9 h-m-p 1.0792 5.3961 0.0189 CCCCC 514.561225 4 1.3348 173 | 0/7
10 h-m-p 1.1762 8.0000 0.0214 +YC 514.485041 1 3.0042 192 | 0/7
11 h-m-p 1.6000 8.0000 0.0354 YCC 514.465702 2 0.7484 212 | 0/7
12 h-m-p 1.6000 8.0000 0.0104 YC 514.460235 1 2.6165 230 | 0/7
13 h-m-p 1.6000 8.0000 0.0156 CC 514.455715 1 1.8639 249 | 0/7
14 h-m-p 1.6000 8.0000 0.0016 C 514.455519 0 1.4630 266 | 0/7
15 h-m-p 1.6000 8.0000 0.0010 C 514.455481 0 1.6093 283 | 0/7
16 h-m-p 1.6000 8.0000 0.0001 C 514.455480 0 1.8369 300 | 0/7
17 h-m-p 1.6000 8.0000 0.0000 Y 514.455480 0 1.0945 317 | 0/7
18 h-m-p 1.6000 8.0000 0.0000 C 514.455480 0 1.6000 334 | 0/7
19 h-m-p 1.6000 8.0000 0.0000 Y 514.455480 0 1.6000 351 | 0/7
20 h-m-p 1.6000 8.0000 0.0000 Y 514.455480 0 1.6000 368 | 0/7
21 h-m-p 1.6000 8.0000 0.0000 C 514.455480 0 1.6000 385 | 0/7
22 h-m-p 1.6000 8.0000 0.0000 +Y 514.455480 0 6.4000 403 | 0/7
23 h-m-p 1.1896 8.0000 0.0000 --C 514.455480 0 0.0252 422
Out..
lnL = -514.455480
423 lfun, 423 eigenQcodon, 2115 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 4, (2, 3)); MP score: 42
0.008454 0.486402 0.049927 0.108249 0.057782 1.250219 0.755520 0.234606
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.017082
np = 8
lnL0 = -516.375425
Iterating by ming2
Initial: fx= 516.375425
x= 0.00845 0.48640 0.04993 0.10825 0.05778 1.25022 0.75552 0.23461
1 h-m-p 0.0000 0.0080 60.8094 +++YYCCC 515.307877 4 0.0009 22 | 0/8
2 h-m-p 0.0007 0.0034 57.8431 +CYCCC 510.608479 4 0.0030 41 | 0/8
3 h-m-p 0.0012 0.0060 25.0592 YYC 510.377949 2 0.0010 54 | 0/8
4 h-m-p 0.0019 0.0110 13.3363 CYCCC 510.124110 4 0.0035 72 | 0/8
5 h-m-p 0.0404 0.2267 1.1414 YC 510.119251 1 0.0053 84 | 0/8
6 h-m-p 0.0023 0.1960 2.5646 YC 510.110858 1 0.0044 96 | 0/8
7 h-m-p 0.0029 0.0529 3.9148 CC 510.101757 1 0.0031 109 | 0/8
8 h-m-p 0.0119 1.1781 1.0163 ++YYC 509.929280 2 0.1725 124 | 0/8
9 h-m-p 0.5152 2.5762 0.2591 YC 509.863739 1 0.3923 136 | 0/8
10 h-m-p 0.3956 1.9781 0.0588 CCCC 509.734797 3 0.6723 161 | 0/8
11 h-m-p 1.6000 8.0000 0.0120 YC 509.728733 1 0.8213 181 | 0/8
12 h-m-p 1.6000 8.0000 0.0014 YC 509.728669 1 0.9088 201 | 0/8
13 h-m-p 1.6000 8.0000 0.0004 Y 509.728667 0 1.0037 220 | 0/8
14 h-m-p 1.6000 8.0000 0.0001 Y 509.728667 0 1.0501 239 | 0/8
15 h-m-p 1.6000 8.0000 0.0000 Y 509.728667 0 0.8794 258 | 0/8
16 h-m-p 1.6000 8.0000 0.0000 Y 509.728667 0 0.9681 277 | 0/8
17 h-m-p 1.6000 8.0000 0.0000 -Y 509.728667 0 0.1000 297
Out..
lnL = -509.728667
298 lfun, 894 eigenQcodon, 2980 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 4, (2, 3)); MP score: 42
initial w for M2:NSpselection reset.
0.008454 0.486402 0.049927 0.108249 0.057782 1.128966 1.079469 0.409056 0.257593 2.430889
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 7.043639
np = 10
lnL0 = -523.308603
Iterating by ming2
Initial: fx= 523.308603
x= 0.00845 0.48640 0.04993 0.10825 0.05778 1.12897 1.07947 0.40906 0.25759 2.43089
1 h-m-p 0.0000 0.0146 42.3573 +++YYCCC 522.690393 4 0.0009 24 | 0/10
2 h-m-p 0.0011 0.0076 33.0633 ++ 518.946412 m 0.0076 37 | 0/10
3 h-m-p 0.0001 0.0006 99.9900 ++ 518.092530 m 0.0006 50 | 1/10
4 h-m-p 0.0003 0.0017 23.2594 ++ 517.678369 m 0.0017 63 | 1/10
5 h-m-p 0.0068 0.1674 5.6346 +CCCCC 517.121244 4 0.0330 85 | 1/10
6 h-m-p 0.0005 0.0026 10.2724 ++ 517.032928 m 0.0026 98 | 1/10
7 h-m-p 0.0063 0.5437 4.3042 +++CC 514.152350 1 0.4062 116 | 1/10
8 h-m-p 0.0170 0.0852 6.5198 +CCC 513.446894 2 0.0617 134 | 0/10
9 h-m-p 0.0003 0.0016 99.1003 +YC 513.187042 1 0.0014 149 | 0/10
10 h-m-p 0.0010 0.0050 3.5635 ++ 513.138996 m 0.0050 162 | 1/10
11 h-m-p 0.0097 2.2576 1.0773 +++CCCC 511.096136 3 0.6918 184 | 1/10
12 h-m-p 0.3110 1.5552 0.5651 CCCC 510.626849 3 0.4683 203 | 1/10
13 h-m-p 0.7804 4.5803 0.3391 CCCCC 509.974525 4 1.1309 233 | 0/10
14 h-m-p 0.8925 4.6959 0.4297 CCCCC 509.632819 4 1.0255 263 | 0/10
15 h-m-p 0.3175 3.3838 1.3878 +CCC 508.874690 2 1.1543 291 | 0/10
16 h-m-p 1.6000 8.0000 0.7318 YCCCC 507.981562 4 2.9373 311 | 0/10
17 h-m-p 0.5726 2.8628 1.0082 CCCCC 507.599932 4 1.0463 342 | 0/10
18 h-m-p 0.3008 1.5040 0.8842 ++ 507.123551 m 1.5040 355 | 1/10
19 h-m-p 1.6000 8.0000 0.1950 YCCC 506.972055 3 1.1531 383 | 1/10
20 h-m-p 0.4791 8.0000 0.4693 +YCC 506.943107 2 1.5366 409 | 1/10
21 h-m-p 1.6000 8.0000 0.1496 YCC 506.927818 2 2.9327 434 | 1/10
22 h-m-p 1.6000 8.0000 0.0942 C 506.921386 0 1.5434 456 | 1/10
23 h-m-p 1.6000 8.0000 0.0701 YC 506.912923 1 3.2006 479 | 1/10
24 h-m-p 1.1249 8.0000 0.1995 ++ 506.870459 m 8.0000 501 | 1/10
25 h-m-p 1.6000 8.0000 0.3378 CCC 506.849342 2 1.3400 527 | 1/10
26 h-m-p 1.4929 8.0000 0.3032 YCC 506.840531 2 2.7265 552 | 1/10
27 h-m-p 1.6000 8.0000 0.3374 CYC 506.836705 2 1.9328 577 | 1/10
28 h-m-p 1.6000 8.0000 0.3145 CCC 506.834734 2 2.3013 603 | 1/10
29 h-m-p 1.6000 8.0000 0.4420 CY 506.833663 1 1.7894 627 | 1/10
30 h-m-p 1.6000 8.0000 0.3316 YC 506.833147 1 2.9979 650 | 1/10
31 h-m-p 1.6000 8.0000 0.3723 CC 506.832919 1 2.2059 674 | 1/10
32 h-m-p 1.6000 8.0000 0.3493 YC 506.832839 1 2.7795 697 | 1/10
33 h-m-p 1.6000 8.0000 0.2890 Y 506.832811 0 2.6083 719 | 1/10
34 h-m-p 1.6000 8.0000 0.3156 Y 506.832793 0 3.1641 741 | 1/10
35 h-m-p 1.6000 8.0000 0.3377 C 506.832787 0 2.0487 763 | 1/10
36 h-m-p 1.6000 8.0000 0.2881 Y 506.832785 0 3.5158 785 | 1/10
37 h-m-p 1.6000 8.0000 0.3555 C 506.832784 0 2.2580 807 | 1/10
38 h-m-p 1.6000 8.0000 0.3305 Y 506.832783 0 2.8080 829 | 1/10
39 h-m-p 1.6000 8.0000 0.3304 C 506.832783 0 2.5132 851 | 1/10
40 h-m-p 1.6000 8.0000 0.3482 Y 506.832783 0 2.6485 873 | 1/10
41 h-m-p 1.6000 8.0000 0.3411 C 506.832783 0 2.5283 895 | 1/10
42 h-m-p 1.6000 8.0000 0.3530 Y 506.832783 0 2.6411 917 | 1/10
43 h-m-p 1.6000 8.0000 0.3512 C 506.832783 0 2.4943 939 | 1/10
44 h-m-p 1.6000 8.0000 0.2761 C 506.832783 0 2.2837 961 | 1/10
45 h-m-p 1.6000 8.0000 0.2972 Y 506.832783 0 3.0915 983 | 1/10
46 h-m-p 1.5104 8.0000 0.6083 Y 506.832783 0 3.5306 1005 | 1/10
47 h-m-p 1.6000 8.0000 0.5583 C 506.832783 0 1.6826 1027 | 1/10
48 h-m-p 1.6000 8.0000 0.3399 Y 506.832783 0 3.4008 1049 | 1/10
49 h-m-p 0.7661 8.0000 1.5087 --Y 506.832783 0 0.0120 1073 | 1/10
50 h-m-p 0.0160 8.0000 1.3892 --C 506.832783 0 0.0003 1088 | 1/10
51 h-m-p 0.0085 4.2450 17.5242 -------C 506.832783 0 0.0000 1108 | 1/10
52 h-m-p 0.0160 8.0000 0.9053 --Y 506.832783 0 0.0003 1123 | 1/10
53 h-m-p 0.0497 8.0000 0.0046 --Y 506.832783 0 0.0008 1147 | 1/10
54 h-m-p 0.0392 8.0000 0.0001 ----------C 506.832783 0 0.0000 1179
Out..
lnL = -506.832783
1180 lfun, 4720 eigenQcodon, 17700 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -514.362932 S = -477.014564 -31.147200
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 60 patterns 0:08
did 20 / 60 patterns 0:08
did 30 / 60 patterns 0:08
did 40 / 60 patterns 0:08
did 50 / 60 patterns 0:08
did 60 / 60 patterns 0:08
Time used: 0:08
Model 3: discrete
TREE # 1
(1, 4, (2, 3)); MP score: 42
0.008454 0.486402 0.049927 0.108249 0.057782 1.376468 0.408838 0.998206 0.082847 0.180045 0.272383
ntime & nrate & np: 5 4 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.387529
np = 11
lnL0 = -514.522500
Iterating by ming2
Initial: fx= 514.522500
x= 0.00845 0.48640 0.04993 0.10825 0.05778 1.37647 0.40884 0.99821 0.08285 0.18005 0.27238
1 h-m-p 0.0000 0.0099 76.4885 ++YCYCC 513.905090 4 0.0003 24 | 0/11
2 h-m-p 0.0008 0.0040 16.9600 YCCCCC 513.637767 5 0.0017 47 | 0/11
3 h-m-p 0.0009 0.0047 17.4388 ++ 512.867840 m 0.0047 61 | 1/11
4 h-m-p 0.0000 0.0001 3867.9985 +YCYCC 512.259736 4 0.0000 82 | 1/11
5 h-m-p 0.0086 0.0429 3.4521 CCC 512.244190 2 0.0032 100 | 0/11
6 h-m-p 0.0014 0.0582 7.7859 +CYC 512.134255 2 0.0052 118 | 0/11
7 h-m-p 0.0050 0.0251 4.8178 YCCC 512.044403 3 0.0101 137 | 0/11
8 h-m-p 0.0555 0.2776 0.6934 -YC 512.043846 1 0.0024 153 | 0/11
9 h-m-p 0.0057 2.8517 0.3974 ++YC 512.031011 1 0.1764 181 | 0/11
10 h-m-p 0.4717 7.4261 0.1486 ----------------.. | 0/11
11 h-m-p 0.0000 0.0063 19.7279 +++CCC 511.801814 2 0.0012 252 | 0/11
12 h-m-p 0.0013 0.0065 17.0229 CCCC 511.647784 3 0.0015 272 | 0/11
13 h-m-p 0.0012 0.0300 22.0257 YCCC 511.385993 3 0.0029 291 | 0/11
14 h-m-p 0.0022 0.0232 28.9208 YCCC 510.955162 3 0.0042 310 | 0/11
15 h-m-p 0.0042 0.0212 8.5582 CCCC 510.841293 3 0.0052 330 | 0/11
16 h-m-p 0.0030 0.0826 14.7758 YC 510.619992 1 0.0073 345 | 0/11
17 h-m-p 0.0095 0.0473 1.6397 CC 510.616043 1 0.0032 361 | 0/11
18 h-m-p 0.0036 0.1892 1.4635 ++CYC 510.577938 2 0.0545 380 | 0/11
19 h-m-p 0.0211 1.0183 3.7724 ++YCCCC 510.076865 4 0.2448 403 | 0/11
20 h-m-p 0.1909 2.9580 4.8363 CCC 509.674157 2 0.1887 421 | 0/11
21 h-m-p 0.9039 4.5196 0.2766 YCCC 509.213087 3 1.4537 440 | 0/11
22 h-m-p 1.0688 5.3441 0.3675 +YYCCC 508.231761 4 3.5871 472 | 0/11
23 h-m-p 0.3691 1.8456 0.2865 ++ 507.663458 m 1.8456 497 | 1/11
24 h-m-p 0.4100 3.8752 1.2893 CCC 507.477222 2 0.3578 526 | 1/11
25 h-m-p 0.7582 8.0000 0.6085 +YC 507.160325 1 1.9163 542 | 1/11
26 h-m-p 1.4579 7.7159 0.7998 YCCC 506.958147 3 0.9462 571 | 1/11
27 h-m-p 1.5510 8.0000 0.4879 YYC 506.890574 2 1.2881 597 | 1/11
28 h-m-p 1.3775 8.0000 0.4562 YC 506.865275 1 0.6706 622 | 1/11
29 h-m-p 0.6565 8.0000 0.4660 +YC 506.838276 1 1.6535 648 | 1/11
30 h-m-p 1.6000 8.0000 0.0923 CC 506.834965 1 1.7618 674 | 1/11
31 h-m-p 1.6000 8.0000 0.0247 CC 506.833585 1 1.9232 700 | 1/11
32 h-m-p 1.0394 8.0000 0.0457 CC 506.832971 1 1.5790 726 | 1/11
33 h-m-p 1.6000 8.0000 0.0119 C 506.832871 0 1.7069 750 | 1/11
34 h-m-p 1.6000 8.0000 0.0035 YC 506.832820 1 3.1833 775 | 1/11
35 h-m-p 1.6000 8.0000 0.0010 C 506.832793 0 2.4209 799 | 1/11
36 h-m-p 0.4387 8.0000 0.0056 +C 506.832783 0 1.7249 824 | 1/11
37 h-m-p 1.6000 8.0000 0.0008 Y 506.832783 0 1.2363 848 | 1/11
38 h-m-p 1.6000 8.0000 0.0002 Y 506.832783 0 1.0987 872 | 1/11
39 h-m-p 1.6000 8.0000 0.0000 Y 506.832783 0 1.2234 896 | 1/11
40 h-m-p 1.6000 8.0000 0.0000 C 506.832783 0 0.4000 920 | 1/11
41 h-m-p 0.4984 8.0000 0.0000 ----------Y 506.832783 0 0.0000 954
Out..
lnL = -506.832783
955 lfun, 3820 eigenQcodon, 14325 P(t)
Time used: 0:13
Model 7: beta
TREE # 1
(1, 4, (2, 3)); MP score: 42
0.008454 0.486402 0.049927 0.108249 0.057782 1.376469 0.996708 1.805788
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.675916
np = 8
lnL0 = -515.676355
Iterating by ming2
Initial: fx= 515.676355
x= 0.00845 0.48640 0.04993 0.10825 0.05778 1.37647 0.99671 1.80579
1 h-m-p 0.0001 0.1517 58.5054 +CYCCC 515.212064 4 0.0004 21 | 0/8
2 h-m-p 0.0010 0.0048 14.0636 YCCCC 515.018839 4 0.0019 39 | 0/8
3 h-m-p 0.0025 0.1046 10.2963 ++
QuantileBeta(0.15, 0.00500, 2.23451) = 1.170988e-160 2000 rounds
YYYYCYCCCC 512.486093 10 0.0525 66 | 0/8
4 h-m-p 0.0007 0.0035 151.6610 YYYC 512.138117 3 0.0006 80 | 0/8
5 h-m-p 0.0026 0.0129 29.1603 YCCC 511.973429 3 0.0017 96 | 0/8
6 h-m-p 0.0167 0.4869 2.9814 YCCC 511.935200 3 0.0084 112 | 0/8
7 h-m-p 0.0155 1.0551 1.6176 ++YYC 511.509057 2 0.1978 127 | 0/8
8 h-m-p 0.3819 1.9095 0.6994 YCCC 511.452716 3 0.2074 143 | 0/8
9 h-m-p 0.5784 8.0000 0.2507 +CYCYCC 511.168586 5 4.1133 171 | 0/8
10 h-m-p 0.2382 1.1909 1.1206 CYYCCC 510.997173 5 0.5063 199 | 0/8
11 h-m-p 1.5440 7.7202 0.0829 YCC 510.893568 2 1.1030 213 | 0/8
12 h-m-p 0.4300 3.2854 0.2126 CCCC 510.871258 3 0.4443 238 | 0/8
13 h-m-p 1.6000 8.0000 0.0387 YC 510.868044 1 0.7190 258 | 0/8
14 h-m-p 0.6197 8.0000 0.0449 YC 510.867592 1 0.4011 278 | 0/8
15 h-m-p 1.6000 8.0000 0.0013 YC 510.867524 1 1.2023 298 | 0/8
16 h-m-p 1.6000 8.0000 0.0006 C 510.867506 0 1.7452 317 | 0/8
17 h-m-p 1.6000 8.0000 0.0004 Y 510.867505 0 0.8919 336 | 0/8
18 h-m-p 1.6000 8.0000 0.0001 Y 510.867505 0 1.0428 355 | 0/8
19 h-m-p 1.6000 8.0000 0.0000 Y 510.867505 0 1.2468 374 | 0/8
20 h-m-p 1.6000 8.0000 0.0000 Y 510.867505 0 0.3182 393 | 0/8
21 h-m-p 0.5000 8.0000 0.0000 -Y 510.867505 0 0.0313 413
Out..
lnL = -510.867505
414 lfun, 4554 eigenQcodon, 20700 P(t)
Time used: 0:20
Model 8: beta&w>1
TREE # 1
(1, 4, (2, 3)); MP score: 42
initial w for M8:NSbetaw>1 reset.
0.008454 0.486402 0.049927 0.108249 0.057782 1.179324 0.900000 0.709770 1.329016 2.821721
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.053910
np = 10
lnL0 = -516.446005
Iterating by ming2
Initial: fx= 516.446005
x= 0.00845 0.48640 0.04993 0.10825 0.05778 1.17932 0.90000 0.70977 1.32902 2.82172
1 h-m-p 0.0000 0.0027 56.0486 +++YCYC 514.902008 3 0.0011 22 | 0/10
2 h-m-p 0.0003 0.0016 44.0050 +YYCCC 514.068577 4 0.0011 42 | 0/10
3 h-m-p 0.0016 0.0078 15.5593 ++ 513.121801 m 0.0078 55 | 0/10
4 h-m-p -0.0000 -0.0000 67.6354
h-m-p: -4.41045847e-20 -2.20522923e-19 6.76353997e+01 513.121801
.. | 0/10
5 h-m-p 0.0000 0.0072 27.3605 +++YYCCC 512.693646 4 0.0013 87 | 0/10
6 h-m-p 0.0011 0.0055 22.9047 +YCYCC 511.998275 4 0.0034 107 | 0/10
7 h-m-p 0.0012 0.0062 45.8110 YCCC 511.379976 3 0.0024 125 | 0/10
8 h-m-p 0.0007 0.0036 52.3473 +YCCC 510.569003 3 0.0024 144 | 0/10
9 h-m-p 0.0005 0.0027 124.9107 CYCCCC 509.903301 5 0.0009 166 | 0/10
10 h-m-p 0.0422 0.2708 2.5216 CCC 509.874327 2 0.0082 183 | 0/10
11 h-m-p 0.0032 0.1763 6.5441 ++YCCC 509.633382 3 0.0314 203 | 0/10
12 h-m-p 0.0237 0.1184 6.7600 +YCCC 509.090716 3 0.0683 222 | 0/10
13 h-m-p 0.1776 0.8880 1.0592 YCCC 508.849852 3 0.3853 240 | 0/10
14 h-m-p 0.0839 0.4197 0.9024 ++ 508.550085 m 0.4197 253 | 0/10
15 h-m-p 0.0000 0.0000 4.5115
h-m-p: 7.26781269e-19 3.63390635e-18 4.51153495e+00 508.550085
.. | 0/10
16 h-m-p 0.0000 0.0081 12.3952 ++YCC 508.513995 2 0.0005 291 | 0/10
17 h-m-p 0.0009 0.0043 3.7411 YC 508.502654 1 0.0018 305 | 0/10
18 h-m-p 0.0001 0.0006 6.5616 ++ 508.493848 m 0.0006 318 | 1/10
19 h-m-p 0.0002 0.0239 20.3831 +YC 508.486562 1 0.0004 333 | 1/10
20 h-m-p 0.0021 0.1130 3.8732 +CCC 508.452611 2 0.0089 351 | 1/10
21 h-m-p 0.0426 8.0000 0.8104 YCC 508.429990 2 0.0825 367 | 1/10
22 h-m-p 0.0264 0.2159 2.5333 CCC 508.422898 2 0.0090 393 | 1/10
23 h-m-p 0.0036 0.6168 6.3463 ++CYC 508.313443 2 0.0613 411 | 1/10
24 h-m-p 0.2422 5.3945 1.6071 +CCCC 507.843325 3 1.2462 431 | 1/10
25 h-m-p 1.6000 8.0000 1.0377 CYC 507.523085 2 1.4367 447 | 1/10
26 h-m-p 1.4057 8.0000 1.0605 CCC 507.361623 2 1.4895 464 | 1/10
27 h-m-p 1.6000 8.0000 0.8778 YCCC 507.277726 3 2.7154 482 | 1/10
28 h-m-p 1.6000 8.0000 0.5013 YCC 507.262527 2 1.1278 507 | 1/10
29 h-m-p 1.6000 8.0000 0.2405 +YC 507.245330 1 5.2359 531 | 1/10
30 h-m-p 1.6000 8.0000 0.1249 +YC 507.225620 1 5.0154 555 | 1/10
31 h-m-p 1.6000 8.0000 0.2943 CC 507.209730 1 2.5099 579 | 1/10
32 h-m-p 1.6000 8.0000 0.4077 YC 507.188341 1 3.9796 602 | 1/10
33 h-m-p 1.6000 8.0000 0.6976 YC 507.159316 1 3.9042 625 | 1/10
34 h-m-p 1.6000 8.0000 1.6386 YCCC 507.128715 3 3.1222 652 | 1/10
35 h-m-p 1.6000 8.0000 2.2907 YCCC 507.081883 3 3.7799 670 | 1/10
36 h-m-p 1.6000 8.0000 4.4157 YCCC 507.045944 3 2.8223 688 | 1/10
37 h-m-p 1.6000 8.0000 5.9312 YCCC 507.016865 3 3.1567 706 | 1/10
38 h-m-p 0.9710 4.8552 8.3796 +YCC 506.994476 2 3.1192 723 | 1/10
39 h-m-p 0.2134 1.0669 13.6341 ++ 506.984228 m 1.0669 736 | 2/10
40 h-m-p 0.1365 5.4823 15.4240 ---------------.. | 2/10
41 h-m-p 0.0002 0.1239 0.6757 +YC 506.983784 1 0.0019 777 | 2/10
42 h-m-p 0.0020 0.0818 0.6469 -YC 506.983752 1 0.0002 800 | 2/10
43 h-m-p 0.0013 0.6600 0.2498 YC 506.983676 1 0.0031 822 | 2/10
44 h-m-p 0.0060 1.0397 0.1288 YC 506.983652 1 0.0040 844 | 2/10
45 h-m-p 0.0125 6.2662 0.2229 +YC 506.982554 1 0.1250 867 | 2/10
46 h-m-p 0.0645 8.0000 0.4320 ++YCC 506.971353 2 0.7400 893 | 2/10
47 h-m-p 0.2742 8.0000 1.1659 +CCCC 506.890956 3 1.8479 921 | 2/10
48 h-m-p 1.6000 8.0000 0.0584 CC 506.888854 1 1.3730 936 | 2/10
49 h-m-p 1.2614 8.0000 0.0635 ++ 506.879189 m 8.0000 957 | 2/10
50 h-m-p 0.8385 8.0000 0.6060 CCC 506.872986 2 0.9263 982 | 2/10
51 h-m-p 1.6000 8.0000 0.0188 YC 506.872535 1 1.0283 1004 | 2/10
52 h-m-p 1.6000 8.0000 0.0112 Y 506.872532 0 0.8786 1025 | 2/10
53 h-m-p 1.6000 8.0000 0.0007 Y 506.872532 0 0.9469 1046 | 2/10
54 h-m-p 1.6000 8.0000 0.0000 Y 506.872532 0 0.8560 1067 | 2/10
55 h-m-p 1.6000 8.0000 0.0000 -C 506.872532 0 0.1000 1089
Out..
lnL = -506.872532
1090 lfun, 13080 eigenQcodon, 59950 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -512.900409 S = -476.996841 -30.879193
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 60 patterns 0:40
did 20 / 60 patterns 0:41
did 30 / 60 patterns 0:41
did 40 / 60 patterns 0:41
did 50 / 60 patterns 0:41
did 60 / 60 patterns 0:41
Time used: 0:41
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=77
D_melanogaster_CG42486-PA MKFLAMMALLGLLAIFFVSSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
D_sechellia_CG42486-PA MKFLAIMAFLGLLAILFVDSSEASYCPCNLRKAEVCGTNGLTYQNRCVFE
D_simulans_CG42486-PA MKFLAMMALLGLLAILFLASSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
D_yakuba_CG42486-PA MNFLAMMALLGLLAMLFVPSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE
*:***:**:*****::*: *********************:*********
D_melanogaster_CG42486-PA CTQREYRKLGRILNIKKMGSCQANRFS
D_sechellia_CG42486-PA CTQREYRKLGRILNIKKMGSCQASRFS
D_simulans_CG42486-PA CTQREYRKLGRILNIKKMGSCQASRFS
D_yakuba_CG42486-PA CTQREYRKLGRNLNIRKLGSCSAIRFT
*********** ***:*:***.* **:
>D_melanogaster_CG42486-PA ATGAAGTTCTTGGCTATGATGGCTCTTTTGGGCCTATTGGCTATATTCTT TGTGTCTTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG AGGTCTGTGGAACCAATGGTGTGACCTATCAGAATCGATGTGTTTTTGAG TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTGAACATCAAAAA AATGGGATCTTGTCAAGCTAATCGTTTCTCT >D_sechellia_CG42486-PA ATGAAGTTCTTGGCTATAATGGCTTTTTTGGGCCTATTGGCTATATTGTT TGTGGATTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG AGGTCTGTGGAACCAATGGTTTGACCTATCAGAATCGATGCGTTTTTGAG TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTGAATATAAAAAA AATGGGATCTTGTCAAGCTTCTCGGTTCTCT >D_simulans_CG42486-PA ATGAAGTTCTTGGCTATGATGGCTCTTTTGGGGCTATTGGCTATATTATT TCTGGCTTCATCGGAGGCTAGTTATTGCCCCTGTAATCTTCGAAAGGCAG AGGTCTGTGGAACCAATGGTGTGACCTATCAGAATAGATGTGTTTTTGAG TGCACTCAGCGGGAATATAGAAAGCTCGGAAGAATTTTAAACATCAAAAA AATGGGATCTTGTCAAGCTTCTCGGTTCTCT >D_yakuba_CG42486-PA ATGAATTTCTTGGCTATGATGGCGCTTTTGGGCCTTTTGGCCATGTTATT TGTGCCATCATCGGAGGCCAGCTACTGTCCCTGTAATCTCCGAAAGGCAG AGGTCTGTGGAACCAATGGGGTTACCTACCAAAATCGGTGTGTTTTCGAG TGCACTCAGCGGGAATATAGGAAGCTCGGAAGAAATCTGAACATCCGAAA ACTGGGATCTTGTTCAGCTATACGATTCACT
>D_melanogaster_CG42486-PA MKFLAMMALLGLLAIFFVSSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE CTQREYRKLGRILNIKKMGSCQANRFS >D_sechellia_CG42486-PA MKFLAIMAFLGLLAILFVDSSEASYCPCNLRKAEVCGTNGLTYQNRCVFE CTQREYRKLGRILNIKKMGSCQASRFS >D_simulans_CG42486-PA MKFLAMMALLGLLAILFLASSEASYCPCNLRKAEVCGTNGVTYQNRCVFE CTQREYRKLGRILNIKKMGSCQASRFS >D_yakuba_CG42486-PA MNFLAMMALLGLLAMLFVPSSEASYCPCNLRKAEVCGTNGVTYQNRCVFE CTQREYRKLGRNLNIRKLGSCSAIRFT
#NEXUS
[ID: 1670495347]
begin taxa;
dimensions ntax=4;
taxlabels
D_melanogaster_CG42486-PA
D_sechellia_CG42486-PA
D_simulans_CG42486-PA
D_yakuba_CG42486-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG42486-PA,
2 D_sechellia_CG42486-PA,
3 D_simulans_CG42486-PA,
4 D_yakuba_CG42486-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01861514,4:0.2378315,(2:0.04784968,3:0.02667062)0.715:0.01620978);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01861514,4:0.2378315,(2:0.04784968,3:0.02667062):0.01620978);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -533.64 -541.89
2 -533.37 -543.68
--------------------------------------
TOTAL -533.49 -543.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42486-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.371916 0.009780 0.211656 0.563684 0.354313 1387.75 1444.37 1.000
r(A<->C){all} 0.229767 0.007796 0.067722 0.403865 0.221933 505.58 567.08 1.002
r(A<->G){all} 0.180828 0.005261 0.050907 0.323230 0.172141 733.91 758.46 1.000
r(A<->T){all} 0.099655 0.002970 0.008813 0.205847 0.093046 723.41 725.57 1.001
r(C<->G){all} 0.080760 0.002785 0.000931 0.181650 0.069931 571.92 703.34 1.000
r(C<->T){all} 0.296200 0.007564 0.132801 0.473416 0.292110 649.68 810.62 1.000
r(G<->T){all} 0.112790 0.002651 0.023272 0.216240 0.103428 917.70 954.73 1.000
pi(A){all} 0.249538 0.000687 0.198511 0.301542 0.248535 1136.21 1318.61 1.000
pi(C){all} 0.191857 0.000570 0.147063 0.238346 0.191139 973.43 1037.70 1.001
pi(G){all} 0.249672 0.000728 0.196624 0.301626 0.249306 1112.65 1255.57 1.000
pi(T){all} 0.308933 0.000781 0.255924 0.364509 0.308498 1093.18 1250.47 1.001
alpha{1,2} 0.151428 0.024076 0.000199 0.419809 0.115563 1256.90 1358.53 1.001
alpha{3} 1.329204 0.454405 0.316347 2.639709 1.210331 1345.80 1396.42 1.000
pinvar{all} 0.194049 0.017363 0.000061 0.436651 0.177473 1051.72 1276.36 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/143/CG42486-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 77
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 2 3 2 1 | Ser TCT 3 3 3 1 | Tyr TAT 3 3 3 1 | Cys TGT 4 3 4 5
TTC 3 2 2 3 | TCC 0 0 0 0 | TAC 0 0 0 2 | TGC 2 3 2 1
Leu TTA 0 0 2 1 | TCA 1 1 1 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 4 6 3 3 | TCG 1 1 1 1 | TAG 0 0 0 0 | Trp TGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Leu CTT 2 1 2 2 | Pro CCT 0 0 0 0 | His CAT 0 0 0 0 | Arg CGT 1 0 0 0
CTC 1 1 1 2 | CCC 1 1 1 1 | CAC 0 0 0 0 | CGC 0 0 0 0
CTA 1 1 1 0 | CCA 0 0 0 1 | Gln CAA 1 1 1 1 | CGA 2 2 1 3
CTG 0 0 1 2 | CCG 0 0 0 0 | CAG 2 2 2 1 | CGG 1 2 2 2
------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 0 | Thr ACT 1 1 1 2 | Asn AAT 4 4 3 5 | Ser AGT 1 1 1 0
ATC 1 0 1 1 | ACC 2 2 2 2 | AAC 1 0 1 1 | AGC 0 0 0 1
ATA 1 3 1 1 | ACA 0 0 0 0 | Lys AAA 2 2 2 1 | Arg AGA 2 2 3 1
Met ATG 4 3 4 4 | ACG 0 0 0 0 | AAG 3 3 3 2 | AGG 0 0 0 1
------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 2 | Ala GCT 5 5 6 2 | Asp GAT 0 1 0 0 | Gly GGT 1 1 1 0
GTC 1 1 1 1 | GCC 0 0 0 2 | GAC 0 0 0 0 | GGC 1 1 0 1
GTA 0 0 0 0 | GCA 1 1 1 1 | Glu GAA 1 1 1 1 | GGA 3 3 3 3
GTG 2 1 1 1 | GCG 0 0 0 1 | GAG 3 3 3 3 | GGG 0 0 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG42486-PA
position 1: T:0.29870 C:0.15584 A:0.29870 G:0.24675
position 2: T:0.31169 C:0.19481 A:0.25974 G:0.23377
position 3: T:0.37662 C:0.16883 A:0.19481 G:0.25974
Average T:0.32900 C:0.17316 A:0.25108 G:0.24675
#2: D_sechellia_CG42486-PA
position 1: T:0.32468 C:0.14286 A:0.28571 G:0.24675
position 2: T:0.31169 C:0.19481 A:0.25974 G:0.23377
position 3: T:0.36364 C:0.14286 A:0.22078 G:0.27273
Average T:0.33333 C:0.16017 A:0.25541 G:0.25108
#3: D_simulans_CG42486-PA
position 1: T:0.29870 C:0.15584 A:0.29870 G:0.24675
position 2: T:0.31169 C:0.20779 A:0.24675 G:0.23377
position 3: T:0.36364 C:0.14286 A:0.22078 G:0.27273
Average T:0.32468 C:0.16883 A:0.25541 G:0.25108
#4: D_yakuba_CG42486-PA
position 1: T:0.27273 C:0.19481 A:0.28571 G:0.24675
position 2: T:0.31169 C:0.20779 A:0.23377 G:0.24675
position 3: T:0.27273 C:0.23377 A:0.20779 G:0.28571
Average T:0.28571 C:0.21212 A:0.24242 G:0.25974
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 8 | Ser S TCT 10 | Tyr Y TAT 10 | Cys C TGT 16
TTC 10 | TCC 0 | TAC 2 | TGC 8
Leu L TTA 3 | TCA 5 | *** * TAA 0 | *** * TGA 0
TTG 16 | TCG 4 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 7 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 1
CTC 5 | CCC 4 | CAC 0 | CGC 0
CTA 3 | CCA 1 | Gln Q CAA 4 | CGA 8
CTG 3 | CCG 0 | CAG 7 | CGG 7
------------------------------------------------------------------------------
Ile I ATT 3 | Thr T ACT 5 | Asn N AAT 16 | Ser S AGT 3
ATC 3 | ACC 8 | AAC 3 | AGC 1
ATA 6 | ACA 0 | Lys K AAA 7 | Arg R AGA 8
Met M ATG 15 | ACG 0 | AAG 11 | AGG 1
------------------------------------------------------------------------------
Val V GTT 5 | Ala A GCT 18 | Asp D GAT 1 | Gly G GGT 3
GTC 4 | GCC 2 | GAC 0 | GGC 3
GTA 0 | GCA 4 | Glu E GAA 4 | GGA 12
GTG 5 | GCG 1 | GAG 12 | GGG 2
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.29870 C:0.16234 A:0.29221 G:0.24675
position 2: T:0.31169 C:0.20130 A:0.25000 G:0.23701
position 3: T:0.34416 C:0.17208 A:0.21104 G:0.27273
Average T:0.31818 C:0.17857 A:0.25108 G:0.25216
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG42486-PA
D_sechellia_CG42486-PA 0.5850 (0.0464 0.0793)
D_simulans_CG42486-PA 0.3650 (0.0287 0.0787) 0.2013 (0.0288 0.1429)
D_yakuba_CG42486-PA 0.1528 (0.0713 0.4669) 0.1727 (0.1012 0.5859) 0.1308 (0.0758 0.5796)
Model 0: one-ratio
TREE # 1: (1, 4, (2, 3)); MP score: 42
lnL(ntime: 5 np: 7): -514.455480 +0.000000
5..1 5..4 5..6 6..2 6..3
0.035343 0.469519 0.036553 0.111123 0.056196 1.250219 0.165694
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.70873
(1: 0.035343, 4: 0.469519, (2: 0.111123, 3: 0.056196): 0.036553);
(D_melanogaster_CG42486-PA: 0.035343, D_yakuba_CG42486-PA: 0.469519, (D_sechellia_CG42486-PA: 0.111123, D_simulans_CG42486-PA: 0.056196): 0.036553);
Detailed output identifying parameters
kappa (ts/tv) = 1.25022
omega (dN/dS) = 0.16569
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.035 180.3 50.7 0.1657 0.0056 0.0338 1.0 1.7
5..4 0.470 180.3 50.7 0.1657 0.0743 0.4486 13.4 22.8
5..6 0.037 180.3 50.7 0.1657 0.0058 0.0349 1.0 1.8
6..2 0.111 180.3 50.7 0.1657 0.0176 0.1062 3.2 5.4
6..3 0.056 180.3 50.7 0.1657 0.0089 0.0537 1.6 2.7
tree length for dN: 0.1122
tree length for dS: 0.6772
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 42
lnL(ntime: 5 np: 8): -509.728667 +0.000000
5..1 5..4 5..6 6..2 6..3
0.036346 0.518062 0.033333 0.115021 0.060130 1.128966 0.905321 0.072136
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.76289
(1: 0.036346, 4: 0.518062, (2: 0.115021, 3: 0.060130): 0.033333);
(D_melanogaster_CG42486-PA: 0.036346, D_yakuba_CG42486-PA: 0.518062, (D_sechellia_CG42486-PA: 0.115021, D_simulans_CG42486-PA: 0.060130): 0.033333);
Detailed output identifying parameters
kappa (ts/tv) = 1.12897
dN/dS (w) for site classes (K=2)
p: 0.90532 0.09468
w: 0.07214 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.036 181.2 49.8 0.1600 0.0057 0.0355 1.0 1.8
5..4 0.518 181.2 49.8 0.1600 0.0810 0.5062 14.7 25.2
5..6 0.033 181.2 49.8 0.1600 0.0052 0.0326 0.9 1.6
6..2 0.115 181.2 49.8 0.1600 0.0180 0.1124 3.3 5.6
6..3 0.060 181.2 49.8 0.1600 0.0094 0.0587 1.7 2.9
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 42
lnL(ntime: 5 np: 10): -506.832783 +0.000000
5..1 5..4 5..6 6..2 6..3
0.064017 0.711148 0.000004 0.138994 0.077590 1.376468 0.959553 0.000000 0.104875 6.813221
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99175
(1: 0.064017, 4: 0.711148, (2: 0.138994, 3: 0.077590): 0.000004);
(D_melanogaster_CG42486-PA: 0.064017, D_yakuba_CG42486-PA: 0.711148, (D_sechellia_CG42486-PA: 0.138994, D_simulans_CG42486-PA: 0.077590): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.37647
dN/dS (w) for site classes (K=3)
p: 0.95955 0.00000 0.04045
w: 0.10488 1.00000 6.81322
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.064 179.4 51.6 0.3762 0.0156 0.0414 2.8 2.1
5..4 0.711 179.4 51.6 0.3762 0.1730 0.4599 31.0 23.7
5..6 0.000 179.4 51.6 0.3762 0.0000 0.0000 0.0 0.0
6..2 0.139 179.4 51.6 0.3762 0.0338 0.0899 6.1 4.6
6..3 0.078 179.4 51.6 0.3762 0.0189 0.0502 3.4 2.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.995** 6.779
72 Q 0.811 5.543
74 N 1.000** 6.812
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.871 6.291 +- 3.025
74 N 0.956* 6.764 +- 2.651
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.553 0.443 0.004 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.020 0.043 0.073 0.099 0.119 0.129 0.133 0.132 0.128 0.123
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.020
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.032 0.167
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.023 0.200 0.551
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 3: discrete (3 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 42
lnL(ntime: 5 np: 11): -506.832783 +0.000000
5..1 5..4 5..6 6..2 6..3
0.064017 0.711148 0.000004 0.138994 0.077590 1.376469 0.313170 0.646383 0.104875 0.104875 6.813226
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99175
(1: 0.064017, 4: 0.711148, (2: 0.138994, 3: 0.077590): 0.000004);
(D_melanogaster_CG42486-PA: 0.064017, D_yakuba_CG42486-PA: 0.711148, (D_sechellia_CG42486-PA: 0.138994, D_simulans_CG42486-PA: 0.077590): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.37647
dN/dS (w) for site classes (K=3)
p: 0.31317 0.64638 0.04045
w: 0.10488 0.10488 6.81323
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.064 179.4 51.6 0.3762 0.0156 0.0414 2.8 2.1
5..4 0.711 179.4 51.6 0.3762 0.1730 0.4599 31.0 23.7
5..6 0.000 179.4 51.6 0.3762 0.0000 0.0000 0.0 0.0
6..2 0.139 179.4 51.6 0.3762 0.0338 0.0899 6.1 4.6
6..3 0.078 179.4 51.6 0.3762 0.0189 0.0502 3.4 2.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.995** 6.779
72 Q 0.811 5.543
74 N 1.000** 6.812
Time used: 0:13
Model 7: beta (10 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 42
lnL(ntime: 5 np: 8): -510.867505 +0.000000
5..1 5..4 5..6 6..2 6..3
0.031759 0.504291 0.038244 0.113258 0.059134 1.179324 0.169821 0.767132
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.74669
(1: 0.031759, 4: 0.504291, (2: 0.113258, 3: 0.059134): 0.038244);
(D_melanogaster_CG42486-PA: 0.031759, D_yakuba_CG42486-PA: 0.504291, (D_sechellia_CG42486-PA: 0.113258, D_simulans_CG42486-PA: 0.059134): 0.038244);
Detailed output identifying parameters
kappa (ts/tv) = 1.17932
Parameters in M7 (beta):
p = 0.16982 q = 0.76713
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00002 0.00043 0.00310 0.01361 0.04408 0.11612 0.26097 0.50993 0.85374
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.032 180.8 50.2 0.1802 0.0053 0.0295 1.0 1.5
5..4 0.504 180.8 50.2 0.1802 0.0845 0.4691 15.3 23.5
5..6 0.038 180.8 50.2 0.1802 0.0064 0.0356 1.2 1.8
6..2 0.113 180.8 50.2 0.1802 0.0190 0.1053 3.4 5.3
6..3 0.059 180.8 50.2 0.1802 0.0099 0.0550 1.8 2.8
Time used: 0:20
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 4, (2, 3)); MP score: 42
lnL(ntime: 5 np: 10): -506.872532 +0.000000
5..1 5..4 5..6 6..2 6..3
0.063919 0.711795 0.000004 0.139245 0.077767 1.380311 0.959831 11.793364 99.000000 6.892700
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99273
(1: 0.063919, 4: 0.711795, (2: 0.139245, 3: 0.077767): 0.000004);
(D_melanogaster_CG42486-PA: 0.063919, D_yakuba_CG42486-PA: 0.711795, (D_sechellia_CG42486-PA: 0.139245, D_simulans_CG42486-PA: 0.077767): 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.38031
Parameters in M8 (beta&w>1):
p0 = 0.95983 p = 11.79336 q = 99.00000
(p1 = 0.04017) w = 6.89270
dN/dS (w) for site classes (K=11)
p: 0.09598 0.09598 0.09598 0.09598 0.09598 0.09598 0.09598 0.09598 0.09598 0.09598 0.04017
w: 0.06282 0.07657 0.08559 0.09325 0.10047 0.10776 0.11562 0.12474 0.13670 0.15816 6.89270
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.064 179.4 51.6 0.3788 0.0156 0.0412 2.8 2.1
5..4 0.712 179.4 51.6 0.3788 0.1736 0.4584 31.2 23.7
5..6 0.000 179.4 51.6 0.3788 0.0000 0.0000 0.0 0.0
6..2 0.139 179.4 51.6 0.3788 0.0340 0.0897 6.1 4.6
6..3 0.078 179.4 51.6 0.3788 0.0190 0.0501 3.4 2.6
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.994** 6.851
72 Q 0.796 5.513
74 N 1.000** 6.891
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.935 6.517 +- 2.757
72 Q 0.613 4.207 +- 3.424
74 N 0.985* 6.796 +- 2.475
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.020 0.979
p : 0.737 0.232 0.028 0.002 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.003 0.029 0.065 0.094 0.117 0.138 0.160 0.184 0.210
ws: 0.015 0.043 0.079 0.108 0.127 0.134 0.134 0.128 0.120 0.111
Time used: 0:41
Model 1: NearlyNeutral -509.728667
Model 2: PositiveSelection -506.832783
Model 0: one-ratio -514.45548
Model 3: discrete -506.832783
Model 7: beta -510.867505
Model 8: beta&w>1 -506.872532
Model 0 vs 1 9.453625999999986
Model 2 vs 1 5.791767999999934
Model 8 vs 7 7.989946000000032
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.994** 6.851
72 Q 0.796 5.513
74 N 1.000** 6.891
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42486-PA)
Pr(w>1) post mean +- SE for w
19 S 0.935 6.517 +- 2.757
72 Q 0.613 4.207 +- 3.424
74 N 0.985* 6.796 +- 2.475
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
