--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 02 16:22:10 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/143/CG42458-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42458-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42458-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/143/CG42458-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -7325.00         -7341.24
2      -7325.32         -7339.77
--------------------------------------
TOTAL    -7325.15         -7340.75
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42458-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42458-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42458-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.735211    0.002244    0.639147    0.825271    0.734194   1450.70   1475.85    1.000
r(A<->C){all}   0.081965    0.000122    0.061120    0.103953    0.081574   1153.73   1183.93    1.001
r(A<->G){all}   0.294215    0.000532    0.247362    0.337167    0.293491    861.88    913.68    1.003
r(A<->T){all}   0.117133    0.000297    0.086193    0.152442    0.116513    965.24   1012.29    1.000
r(C<->G){all}   0.074570    0.000100    0.057568    0.096644    0.074018   1101.94   1104.27    1.000
r(C<->T){all}   0.342273    0.000635    0.295576    0.393291    0.341851    908.75    933.81    1.000
r(G<->T){all}   0.089844    0.000199    0.062920    0.117299    0.089302   1179.05   1314.33    1.000
pi(A){all}      0.258338    0.000075    0.241616    0.275206    0.258174   1039.62   1087.20    1.001
pi(C){all}      0.306150    0.000081    0.288578    0.323882    0.306097   1186.34   1304.46    1.000
pi(G){all}      0.270286    0.000074    0.253773    0.287609    0.270041    992.71   1068.38    1.000
pi(T){all}      0.165226    0.000051    0.151272    0.178859    0.165169   1159.66   1160.17    1.000
alpha{1,2}      0.215263    0.000597    0.171593    0.264243    0.213184   1233.46   1265.96    1.000
alpha{3}        3.561980    0.887916    1.912463    5.487485    3.439929   1404.30   1405.81    1.000
pinvar{all}     0.454630    0.000953    0.396814    0.515600    0.455580   1228.24   1235.39    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-6135.670385
Model 2: PositiveSelection	-6134.95651
Model 0: one-ratio	-6260.751469
Model 3: discrete	-6132.907834
Model 7: beta	-6138.814248
Model 8: beta&w>1	-6133.073784


Model 0 vs 1	250.16216799999893

Model 2 vs 1	1.4277500000007421

Model 8 vs 7	11.48092799999904

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42458-PA)

            Pr(w>1)     post mean +- SE for w

   250 A      0.875         1.414
   266 S      0.717         1.219
   468 S      0.740         1.247
   469 S      0.998**       1.561
   470 S      0.603         1.081
   473 V      0.969*        1.525
   475 N      0.799         1.320
   477 A      0.946         1.499
   483 T      0.535         0.984
   495 Q      0.814         1.339
   496 M      0.552         1.018
   497 P      0.969*        1.526
   514 I      0.742         1.249
   515 S      0.994**       1.556
   516 G      0.985*        1.544
   528 G      0.898         1.440
   534 V      0.903         1.445
   535 S      0.682         1.178
   536 A      0.960*        1.515
   540 M      0.974*        1.532
   541 A      0.662         1.152
   567 T      0.903         1.446
   569 A      0.968*        1.525
   572 S      0.956*        1.510
   573 H      0.977*        1.536
   575 P      0.908         1.452
   578 P      0.634         1.109
   644 T      0.543         0.995
   647 S      0.722         1.219
   648 S      0.701         1.200
   650 A      0.570         1.039

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42458-PA)

            Pr(w>1)     post mean +- SE for w

   250 A      0.804         1.336 +- 0.385
   266 S      0.670         1.188 +- 0.487
   468 S      0.691         1.210 +- 0.478
   469 S      0.981*        1.501 +- 0.161
   470 S      0.573         1.082 +- 0.521
   473 V      0.923         1.449 +- 0.264
   475 N      0.746         1.268 +- 0.447
   477 A      0.888         1.417 +- 0.306
   483 T      0.504         0.960 +- 0.590
   495 Q      0.741         1.273 +- 0.427
   496 M      0.531         1.034 +- 0.531
   497 P      0.924         1.450 +- 0.263
   514 I      0.694         1.213 +- 0.478
   515 S      0.968*        1.490 +- 0.187
   516 G      0.939         1.465 +- 0.232
   528 G      0.837         1.365 +- 0.366
   534 V      0.850         1.376 +- 0.362
   535 S      0.640         1.155 +- 0.499
   536 A      0.909         1.437 +- 0.282
   540 M      0.922         1.450 +- 0.258
   541 A      0.623         1.137 +- 0.507
   567 T      0.835         1.366 +- 0.360
   569 A      0.923         1.449 +- 0.264
   572 S      0.903         1.431 +- 0.290
   573 H      0.929         1.456 +- 0.249
   575 P      0.855         1.381 +- 0.356
   578 P      0.594         1.071 +- 0.568
   644 T      0.512         0.969 +- 0.589
   647 S      0.676         1.168 +- 0.532
   648 S      0.657         1.173 +- 0.494
   650 A      0.546         1.051 +- 0.529

>C1
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKRLMTNG
GGLAVAVQQQQQQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQQHHQQQQQ
QHQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTVTAAPSSIHWS
QYKQEQQHHPHAHHPHHQQPFGFQLKSSVAVQATTSPQNAKSAIIANQTA
LGEPYPVGAAAFAAHQQQHQHQQQHQQPLLQPLTLALSPQQPQPHQAATP
LQLHSQLMQQHQHQQQQQQQQQQQQQQHNQQQQHAQEQLSLHQQWGPFKV
YSNPDTLICGNCRESFGELSELLDHKKSYCKLRFTCKCQDVAFAASAKTP
PTSAKLLCAVCKDAFVNPWDLMVHAQAAHMVNIYELGDDEGSSNSNATTA
SSNNVANAAVENGHTIADVAATKQQMPQMPDASSTLNKEPNNNNKISNNN
IISGAINGHMSPSGTGIIMASVSSAENGMASDMETNCLDIKFSPSASPKE
ASDMITAAPGSGSHSPVIPLQDQHRDDLSLDGRMSSSSQQTHHSDELNVK
LLNGSVSSRGSSPGLEADEPPATRACIVRTLSIETAGSSTAPTANTLSLM
SNSLGLALAPQoooooooooooooooooooooooooo
>C2
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKRLMTNG
GGLAVAVQQQQQQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQHHQQQQQQ
HQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTVTAAPGSIHWSQ
YKQEQQHHPHAHHPHHQQPFGFQLKSSVAVQATTSPQNAKSAIIANQTAL
GEPYPVGAAAFAAHQQQHQHQQQHQQPLLQPLTLALSPQQPQPHQAATPL
QLHSQLMQQHQQQQQQHQQQQQQQHNQQQQHAQEQLSLHQQWGPFKVYSN
PDTLICGNCRESFGELSELLDHKKSYCKLRFTCKCQDVAFAASAKTPPTS
AKLLCAVCKDAFVNPWDLMVHAQAAHMVNIYELGDDEGSSSSNSNSNATT
ANNNNVANAAVENGHTIGDEAATKQQMPQMPDASSTLNKEPNNNNKISNN
NINSEAINGHMSPTGTGIIMASVSSAENGMASDMETNCLDIKFSPSASPK
EAGDMITAAPGSGSHSPVIPLQDQHRDDLSLDGRMSSSSQQTHHSDELNV
KLLNGSVSSRGSSPGLEADEPPATRACIVRTLSIETAGSPTAPTANTLSL
MSNSLGLAIAPQooooooooooooooooooooooooo
>C3
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKRLMTNG
GGLAVAVQQQQQQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQHHQQQQQQ
HQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTVTAAPGSIHWSQ
YKQEQQHHPHAHHPHHQQPFGFQLKSSVAVQATTSPQNAKSAIIANQTAL
GEPYPVGAAAFAAHQQQHQHQQQHQQPLLQPLTLALSPQQPQPHQAATPL
QLHSQLMQQHQQQQQQQQQQQQQQQHNQQQQHAQEQLSLHQQWGPFKVYS
NPDTLICGNCRESFGELSELLDHKKSYCKLRFTCKCQDVAFAASAKTPPT
SAKLLCAVCKDAFVNPWDLMVHAQAAHMVNIYELGDDEGSSSSNSNSNAT
TANSNNVANAAVENGHTIADEAATKQQMPQMPDASSTLNKEPNNNNKISN
NNINSEAINGHMSPTGTGIIMASVSTAENGMASDMETNCLDIKFSPSASP
KEAGDMITAAPGSGSHSPVIPLQDQHRDDLSLDGRMSSSSQQTHHSDELN
VKLLNGSVSSRGSSPGLEADEPPATRACIVRTLSIETAGSPTAPTANTLS
LMSNSLGLALAPQoooooooooooooooooooooooo
>C4
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKRLMTNG
GGLAVAVQQQQQQQHGQHHHSAAAVAAAAAAAVHQHQQQQQVQQQQQQHH
HQQQQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTVAAAPGSIH
WSQYKQEQQHHPHAHHPHHAQQPYGFQLKSSVAVQATTSPQNAKSAIIAN
QTALGEPYPVGAAAFAAHQHQQQQQQHQQQPHQQQQHQQPLLQPLTLALS
PQQPQPHQAATPLQLHSQLMQQHQQQQQQQQQQQLQQQQQQHAQEQLSLH
QQWGPFKVYSNPDTLICGNCRESFGELSELLDHKKSYCKLRFTCKCQDVA
FAASAKTPPTSAKLLCAVCKDAFVNPWDLMVHAQAAHMVNIYELGDDEGS
SSSSNNSNTTTASSNNVANAAVENGHAIADEAATKQQMPQMPADGADASS
TLNKEPNNNNKISNNNINSETAINGHMSPSGTAIIMASGSSTENGMPCSD
MDSNCLDIKFSLSASPKEAGDMITATTDSGSDMPMMPLQDQHRDDLSLDG
RMSSSSQQTHHSDELNVKLLNGSVSSRGSSPGLEADVPPATRACIVRTLS
IETAGSPTAPTANTLGLLSNSLGLALAPQoooooooo
>C5
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGAGGGGSNGVRAKKRKRLMTNG
GGLAVAVQQQQQQQHGQHHHSAAAVAAAAAAAVHQHQQQQQVQQQQQQHH
QQQQQQQHQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTVTAAP
GSIHWSQYKQEQQHHPHAHHPHHQQPFGFQLKSSVAVQATTSPQNAKSAI
IANQTALGEPYPVGAAAFAAHQHQQQHPQQQQHQQHQQHQQPLLQPLTLA
LSPQQPQPHQAATPLQLHSQLMQQHQQQQQQQQQQQQQLQQQQHNQQQQH
ALEQLSLHQQWGPFKVYSNPDTLICGNCRESFGELSELLDHKKSYCKLRF
TCKCQDVAFAASAKTPPTSAKLLCAVCKDAFVNPWDLMVHAQAAHMVNIY
ELGDDEGSSSSSSNSNSNTTTASSNNVANAAAVENGHAIADEAATKQQMP
QMPQMPDASSTLNKEPNNNNKISNNNMSSEAINGHMSPTGTAIIMASGSV
AENGMASDMESNCLDIKFSLSASPKEAGDMIAAAADSGAHTAMIPLQDQH
RDDLSLDGRMSSSSQQTHHSDELNVKLLSGSVSSRGSSPGLEADEPPATR
ACIVRTLSIETAGSPTAPTANTLSLMSNSLGLALAPQ
>C6
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTTPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGVGGGGSNGVRAKKRKRLMTNG
GGLAVAVQQQQQQHGQHHHSAAAVAAAAAAAVHQQQQQAQHQQQQHHQQQ
QQQHQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTATAAPGSLH
WSQYKQEQQHHPHAHPHHPHHQQPFGFQLKSSVAVQATTSPQNAKSAIIA
NQTALGEPYPVGAAAAFATHQHQQQQHQQQQHQQPLLQPLTLALSPQQPQ
PHQAATPLQLHSQLMQQHQQQQQQQQQQQQQQQQQQQQLQQQQHAQEQLS
LHQQWGPFKVYSNPDTLICGNCRESFGELSELLDHKKSYCKLRFTCKCQD
VAFAASAKTPPTSAKLLCAVCKDAFANPWDLMVHAQAAHMVNIYELGDDE
GNPTAAAAAITTDNNNIATAAVENGHAIADEAAAKQQMPQMQPASSTLNK
EPNNNNKISNNNTEAANNNNGHMSPSGTGIIMASSGSSASADNGTASDME
TNCQLDIKFSPSASPKEVGDMADPSPPGRDSHSLMILLQDQHRDDLSLDG
RMSSSSQQTHHSDELNVKLLNGSVSSRGSSPGLEADEPPATRACIVRTLS
IESTGPAAAQTANALSLMSNSLSLALAPQoooooooo
>C7
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGVGGGGSNGVRAKKRKRLMTNG
GGLSVAVQQQQQQHGQHHHSAAAVAAAAAAAAVHQQQQQVQHQQQQHHQQ
QQQQHQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTATAATGSL
HWSQYKQEQQHHPHPHPHSHHPHHQQPFGFQLKSSAAAVQATTSPQNAKS
AIIANQTALGEPYPAGAAAAAAAAFATHQQHQQQQQHQQQQHQQPLLQPL
TLALSPQQPQPHQAATPLQLHSQLMQQHQQQQQQQQQHQQQQQQQLQQQQ
HAQEQLSLHQQWGPFKVYSNPDTLICGNCRESFGELSELLDHKKSYCKLR
FTCKCQDVAFAASAKTPPTSAKLLCAVCKDAFANPWDLMVHAQAAHMVNI
YELGDDEGNPSTPIATTTNNNTAIAAVENGHAIADEAATKQQMPQMEAAS
STLNKEPNNNNKISNNNNTEASNNNGHMSPSGTGIIMASSGSSASAENGG
ASDMETSCLDIKFSPSASPKEVGDMAIPTPGRDTDSLMILLQDQHRDDLS
LDGRMSSSSQQTHHSDELNVKLLNGSVSSRGSSPGLEADEPPATRACIVR
TLSIETTGSAATPTANALSLMSNSLSLALAPQooooo
>C8
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGVVGGGGSNGVRAKKRKRLMTNG
GGLAVAVQQQQQQQHGQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQHHQQ
QQQHQQQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTAAAAPGTLH
WSQYKQEQQHHPHQHHPHHQQPFGFQLKSNVAVQATTSPQNAKSAIIANQ
TALGEPYPVGAAAFASHQQHQQQQQQQQQQQHQQPLLQPLTLALSPQQPQ
PHQAATPLQLHSQLMQQHQQQQQQQQQQQHQQQQHAQEQLSLHQQWGPFK
VYSNPDTLICGNCRESFGELSELLDHKKSYCKLRFTCKCQDVAFAASAKT
PPTSAKLLCAVCKDAFANPWDLMVHAQAAHMVNIYELGDDEGNTTTTTIS
TGSSNNIATATVENGHAIADEAATKQQQQQQQQMPQMPASSTLNKEPNNN
NKISNNNNNSENNNGHMSPSGTAMIMASGSSTDNGMPSDVDTNCLEIKFS
PNASPKEVGFMAIPTPGRDSQSPMILLQDQHRDDLSLDERMSSSSQQTHN
SDELNVKLMNGSVSSRGSSPGLEADEPPATRACIVRTLSIDTTASAAVPT
GNALSLMSNSLSLALAPQooooooooooooooooooo
>C9
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGVGGGGSNGVRAKKRKRLMTNG
SGLAVSVQQQQQQQHGQHHHSAAAVAAAVHQQQQVQQQQQQQHQQQQQHQ
QQVAAVAMAAMANLLPQQQLLLHQQNLLSNAAVATTATAAPGSLHWSQYK
QEQQHHTHAHHPHHQQPFGFQLKSSVAVQATTSPQNAKSAIIANQTALGE
PYPVGATAFATHHQHQQQQHQQPLLQPLTLALSPQQPQPHQAATPLQLHS
QLMQQHQQQQQQQQQQQQHQQQQHQQQQHAQEQLSLHQQWGPFKVYSNPD
TLICGNCRESFGELSELLDHKKSYCKLRFTCKCQDVAFAASAKTPPTSAK
LLCAVCKDAFANPWDLMVHAQSAHMVNIYELGDDEANTASNNATAKALVE
NGHPTIAADEAATKQQMPASSTLNKEPNNNNKISNNNNDTIASNNNNGHM
SPSGTEIIMASGSTENGAASDMETHCLDIKFSPSASPKEVGDLAIPSPGR
DSLMILLQDQHRDDLSLDGRMSSSSQQTHHSDELNGKLLNGSVSSRGSSP
GLEADEPPATRACIVRTLSIEASGPTASPTATALSLMSNSLSLALAPQoo
ooooooooooooooooooooooooooooooooooooo
>C10
MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
RQNVSKTGNDWDYFYDSYCSSALLRGGGGVGGGGSNGVRAKKRKRLMTNG
SGLAVAVQQQQQQQHGQHHHSAAAVAAAAAAAVHQQQQQVQQQQQQQQHH
QQQQQHQQQVAAVAMAAMANLLPQQQLLLHQQNLLTNAAVATTATAAPGS
LHWSQYKQEQQHHPHPHHPHHQQPFGFQLKSSVAVQATTSPQNAKPAIMA
NQTALGEPYPVGAAAAFATHHQHQQLQQHQQQQQQQQPLLQPLTLALSPQ
QPQPHQAATPLQLHSQLMQQHQQQQQQQQQQQHQQQQQQQHAQEQLSLHQ
QWGPFKVYSNPDTLICGNCRESFGELSELLDHKKSYCKLRFTCKCQDVAF
AASAKTPPTSAKLLCAVCKDAFANPWDLMVHAQAAHMVNIYELGDDEANS
NGNIATAMATVENGHATIAADEAATKQLQMPAALNKEPNNNNKISNNNNT
SSNNNGHMSPSGTGIIMASGSVENGTASDMESNCLDIKFSPSASPKEVGD
MAIHSPGTGSLTIPLQDQHRDDLSLDGRMSSSSQQTHHSDELNGKLLNGS
VSSRGSSPGLEADEPPATRACIVRTLSIEASGPTAAPTANALSLISNSLS
LALAPQooooooooooooooooooooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=99, Nseq=10, Len=808 

C1              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C2              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C3              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C4              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C5              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C6              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C7              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C8              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C9              MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
C10             MKLSKLSNQTNSQDPQAVNSRIFVGNLNTFQCSKTDVERMFQIYGRLAGI
                **************************************************

C1              SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
C2              SMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTLDVNMVAEPKAHQIGRK
C3