--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 02 15:26:19 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/143/CG42445-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -576.25 -585.74
2 -576.03 -586.24
--------------------------------------
TOTAL -576.13 -586.02
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.555976 0.023233 0.310248 0.868259 0.533075 1047.89 1238.33 1.000
r(A<->C){all} 0.115550 0.003544 0.010014 0.234065 0.107551 593.51 601.48 1.000
r(A<->G){all} 0.259161 0.008544 0.099931 0.450292 0.249983 455.91 542.72 1.002
r(A<->T){all} 0.064466 0.002396 0.000008 0.158003 0.052501 544.20 608.87 1.002
r(C<->G){all} 0.040478 0.000927 0.000058 0.100528 0.033985 614.27 694.18 1.000
r(C<->T){all} 0.479617 0.011005 0.283083 0.683535 0.475838 437.91 563.75 1.004
r(G<->T){all} 0.040728 0.000997 0.000167 0.101589 0.033846 741.75 810.07 1.000
pi(A){all} 0.219509 0.000564 0.173246 0.265629 0.219251 1147.74 1223.31 1.000
pi(C){all} 0.267827 0.000637 0.219691 0.317667 0.267379 1150.83 1211.95 1.002
pi(G){all} 0.258177 0.000702 0.208511 0.312157 0.257154 1174.73 1188.27 1.000
pi(T){all} 0.254486 0.000643 0.204514 0.304208 0.254007 911.52 1062.79 1.001
alpha{1,2} 0.069859 0.002063 0.000120 0.149023 0.066197 1288.24 1310.11 1.001
alpha{3} 1.615937 0.507611 0.509043 3.056982 1.474122 1501.00 1501.00 1.000
pinvar{all} 0.504882 0.010275 0.299282 0.679656 0.516941 1107.19 1167.07 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -533.241465
Model 2: PositiveSelection -533.241465
Model 0: one-ratio -534.2384
Model 3: discrete -532.996686
Model 7: beta -533.017132
Model 8: beta&w>1 -533.017184
Model 0 vs 1 1.9938700000000154
Model 2 vs 1 0.0
Model 8 vs 7 1.0400000019217259E-4
>C1
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C2
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C3
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C4
MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
>C5
MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=87
C1 MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
C2 MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
C3 MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
C4 MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
C5 MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
**********:** *******:****************************
C1 DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
C2 DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
C3 DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
C4 DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
C5 DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
***************:*********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1740]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [1740]--->[1740]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.246 Mb, Max= 30.411 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C2
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C3
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C4
MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
>C5
MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
FORMAT of file /tmp/tmp7931913228153696038aln Not Supported[FATAL:T-COFFEE]
>C1
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C2
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C3
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C4
MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
>C5
MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:87 S:100 BS:87
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 98.85 C1 C2 98.85
TOP 1 0 98.85 C2 C1 98.85
BOT 0 2 98.85 C1 C3 98.85
TOP 2 0 98.85 C3 C1 98.85
BOT 0 3 96.55 C1 C4 96.55
TOP 3 0 96.55 C4 C1 96.55
BOT 0 4 97.70 C1 C5 97.70
TOP 4 0 97.70 C5 C1 97.70
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 96.55 C2 C4 96.55
TOP 3 1 96.55 C4 C2 96.55
BOT 1 4 98.85 C2 C5 98.85
TOP 4 1 98.85 C5 C2 98.85
BOT 2 3 96.55 C3 C4 96.55
TOP 3 2 96.55 C4 C3 96.55
BOT 2 4 98.85 C3 C5 98.85
TOP 4 2 98.85 C5 C3 98.85
BOT 3 4 95.40 C4 C5 95.40
TOP 4 3 95.40 C5 C4 95.40
AVG 0 C1 * 97.99
AVG 1 C2 * 98.56
AVG 2 C3 * 98.56
AVG 3 C4 * 96.26
AVG 4 C5 * 97.70
TOT TOT * 97.82
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTTGACAT
C2 ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTCCACATACTCGACAT
C3 ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTCGACAT
C4 ATGGATCTAATGGAGCTGCTGCATCAGCTGCTCCTCCACATACTCGACAT
C5 ATGGATCTAATGGAGCTGCTGCATCAGCTGTTTCTGCACACACTCGACAT
****************************** * ** **** *** *****
C1 TTTTAAGATCTACATCAAGTTTGCACTGATCACGCTGGTCATCTATTTCC
C2 TTTTAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
C3 ATTCAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
C4 TTTTAAGATATACCTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
C5 CTTTAAGATCTACGTCAAGTTCGCCCTGATCACGCTGGTCATCTACTTCC
** *****.*** ******* **.******************** ****
C1 TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
C2 TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
C3 TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
C4 TGGCCGAGTGGTACATACTGCGATATGGAGCGGAGTTGGAGGCCGAACTG
C5 TGGCCGAGTGGTATATCCTACGATATGGTGCCGAACTGGAGGCCGAACTG
************* **.**.********:** **. **************
C1 GACGCCCATCTGGTGGAAGGTGCCGAACTCAGGGAGGAATCCCCCGAGCG
C2 GACGCCCATCTGGTGGAAGGTGCCGAACTGAGGGAGGAATCTCCCGAGCG
C3 GACGCCCATTTGGTGGAAGGTGCCGAACTGAGAGAGGAATCCCCCGAGCG
C4 GATGCCCATCTGGTGGAAGGCGCCGAGCTGAGAGAGGAATCCCCCGATAG
C5 GATGCCCACCTGGTGGAGGGTGCTGAGCTGAGAGAGGAATCCCCCGAGCG
** ***** *******.** ** **.** **.******** ***** .*
C1 ACCTGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
C2 ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
C3 ACCCGAATCGAATAGCACGCTAAGCAAGGTGTTTCGCTTTGTGGTAAACT
C4 ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
C5 ACCCGAATCGAACAGCACTCTCAGCAAGGTGTTTCGATTTGTGGTGAACT
*** ******** ***** ** **************.** *****.****
C1 TTTTCATCCTC
C2 TTTTCATCCTC
C3 TTTTCATCCTC
C4 TTTTCATCCTC
C5 TTTTCATCCTC
***********
>C1
ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTTGACAT
TTTTAAGATCTACATCAAGTTTGCACTGATCACGCTGGTCATCTATTTCC
TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
GACGCCCATCTGGTGGAAGGTGCCGAACTCAGGGAGGAATCCCCCGAGCG
ACCTGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
TTTTCATCCTC
>C2
ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTCCACATACTCGACAT
TTTTAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
GACGCCCATCTGGTGGAAGGTGCCGAACTGAGGGAGGAATCTCCCGAGCG
ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
TTTTCATCCTC
>C3
ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTCGACAT
ATTCAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
GACGCCCATTTGGTGGAAGGTGCCGAACTGAGAGAGGAATCCCCCGAGCG
ACCCGAATCGAATAGCACGCTAAGCAAGGTGTTTCGCTTTGTGGTAAACT
TTTTCATCCTC
>C4
ATGGATCTAATGGAGCTGCTGCATCAGCTGCTCCTCCACATACTCGACAT
TTTTAAGATATACCTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
TGGCCGAGTGGTACATACTGCGATATGGAGCGGAGTTGGAGGCCGAACTG
GATGCCCATCTGGTGGAAGGCGCCGAGCTGAGAGAGGAATCCCCCGATAG
ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
TTTTCATCCTC
>C5
ATGGATCTAATGGAGCTGCTGCATCAGCTGTTTCTGCACACACTCGACAT
CTTTAAGATCTACGTCAAGTTCGCCCTGATCACGCTGGTCATCTACTTCC
TGGCCGAGTGGTATATCCTACGATATGGTGCCGAACTGGAGGCCGAACTG
GATGCCCACCTGGTGGAGGGTGCTGAGCTGAGAGAGGAATCCCCCGAGCG
ACCCGAATCGAACAGCACTCTCAGCAAGGTGTTTCGATTTGTGGTGAACT
TTTTCATCCTC
>C1
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C2
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C3
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C4
MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
>C5
MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 261 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478100214
Setting output file names to "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 267458699
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1841612285
Seed = 1298803410
Swapseed = 1478100214
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 29 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -692.563345 -- -25.624409
Chain 2 -- -692.563345 -- -25.624409
Chain 3 -- -685.781767 -- -25.624409
Chain 4 -- -687.669417 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -688.966535 -- -25.624409
Chain 2 -- -684.280890 -- -25.624409
Chain 3 -- -695.402452 -- -25.624409
Chain 4 -- -693.291571 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-692.563] (-692.563) (-685.782) (-687.669) * [-688.967] (-684.281) (-695.402) (-693.292)
500 -- (-599.854) (-606.907) [-605.204] (-609.666) * [-601.768] (-601.951) (-603.228) (-599.133) -- 0:00:00
1000 -- (-600.309) (-602.280) [-597.972] (-603.869) * (-604.113) (-605.356) [-597.537] (-600.868) -- 0:00:00
1500 -- [-597.980] (-599.754) (-594.491) (-603.316) * (-591.786) (-599.231) [-595.358] (-601.884) -- 0:00:00
2000 -- (-595.276) [-592.354] (-591.898) (-602.328) * (-594.859) [-589.486] (-597.263) (-598.872) -- 0:00:00
2500 -- (-601.298) (-590.136) [-586.486] (-592.151) * (-590.846) (-590.692) (-595.633) [-592.580] -- 0:06:39
3000 -- (-598.623) (-588.714) (-580.545) [-589.435] * (-594.940) (-593.923) [-589.579] (-595.565) -- 0:05:32
3500 -- (-595.593) (-578.580) [-584.245] (-584.756) * (-588.966) (-588.859) (-586.392) [-588.981] -- 0:04:44
4000 -- (-588.970) [-580.940] (-581.871) (-580.197) * [-580.807] (-596.547) (-589.565) (-589.761) -- 0:04:09
4500 -- (-583.229) (-583.343) (-579.983) [-580.658] * (-580.433) (-590.654) [-587.005] (-590.776) -- 0:03:41
5000 -- (-587.812) [-578.643] (-582.510) (-580.104) * (-587.514) [-585.012] (-588.567) (-587.216) -- 0:03:19
Average standard deviation of split frequencies: 0.098209
5500 -- (-582.522) [-580.280] (-584.720) (-578.795) * (-581.916) [-581.270] (-582.587) (-592.768) -- 0:03:00
6000 -- [-580.233] (-576.864) (-581.567) (-579.783) * [-582.704] (-582.253) (-585.689) (-592.281) -- 0:02:45
6500 -- (-578.199) (-576.531) (-585.271) [-578.701] * (-590.110) (-581.967) [-581.740] (-586.389) -- 0:02:32
7000 -- (-583.635) (-581.265) [-579.353] (-580.269) * (-578.212) (-584.766) (-580.848) [-583.744] -- 0:02:21
7500 -- (-585.462) (-583.011) [-577.662] (-578.246) * (-583.776) (-579.314) [-586.244] (-586.530) -- 0:02:12
8000 -- (-587.323) [-579.354] (-589.396) (-573.962) * (-580.029) [-580.142] (-584.327) (-589.631) -- 0:02:04
8500 -- [-580.542] (-581.077) (-586.587) (-576.787) * (-577.933) (-582.349) [-579.150] (-585.265) -- 0:01:56
9000 -- (-587.169) [-578.262] (-584.618) (-578.132) * (-577.989) [-579.226] (-578.671) (-584.284) -- 0:01:50
9500 -- (-584.249) (-581.318) (-582.489) [-576.448] * (-588.157) [-578.710] (-574.849) (-582.303) -- 0:03:28
10000 -- (-592.840) (-588.246) [-579.509] (-577.553) * (-580.073) [-580.525] (-579.462) (-580.651) -- 0:03:18
Average standard deviation of split frequencies: 0.066291
10500 -- (-584.563) [-578.892] (-589.838) (-577.854) * (-584.505) (-578.496) (-577.874) [-576.664] -- 0:03:08
11000 -- (-582.338) (-576.090) (-580.231) [-574.560] * (-578.450) [-578.375] (-580.491) (-579.682) -- 0:02:59
11500 -- [-579.044] (-580.647) (-583.551) (-581.732) * (-576.669) (-578.180) [-575.901] (-580.588) -- 0:02:51
12000 -- [-580.025] (-579.181) (-584.279) (-584.123) * (-583.556) (-582.299) (-576.566) [-584.040] -- 0:02:44
12500 -- [-578.871] (-575.471) (-582.214) (-575.675) * (-583.098) (-583.689) (-583.721) [-575.222] -- 0:02:38
13000 -- [-578.456] (-574.443) (-585.969) (-576.320) * (-576.813) [-581.235] (-579.678) (-581.130) -- 0:02:31
13500 -- (-580.858) [-575.736] (-584.703) (-586.184) * (-581.048) [-576.773] (-577.046) (-578.423) -- 0:02:26
14000 -- (-577.797) [-576.731] (-581.810) (-581.179) * (-578.312) (-580.747) (-584.869) [-574.310] -- 0:02:20
14500 -- (-579.253) [-579.539] (-587.717) (-578.213) * [-581.053] (-581.137) (-577.390) (-582.138) -- 0:02:15
15000 -- (-580.564) [-579.471] (-580.711) (-575.035) * [-577.128] (-585.184) (-577.079) (-580.361) -- 0:02:11
Average standard deviation of split frequencies: 0.055652
15500 -- [-576.549] (-579.540) (-581.758) (-581.061) * (-578.184) (-587.228) (-577.766) [-578.670] -- 0:02:07
16000 -- [-581.395] (-576.957) (-579.305) (-575.570) * (-582.489) (-587.813) [-576.463] (-576.003) -- 0:02:03
16500 -- (-579.681) (-578.458) [-584.238] (-578.373) * (-576.249) (-584.756) (-576.735) [-579.181] -- 0:01:59
17000 -- (-577.910) (-575.911) (-576.864) [-581.717] * (-574.544) [-584.169] (-578.304) (-584.846) -- 0:02:53
17500 -- (-579.322) (-580.244) (-590.584) [-579.466] * (-575.693) (-588.249) [-585.347] (-589.873) -- 0:02:48
18000 -- (-582.732) (-576.675) (-582.538) [-576.285] * (-574.702) (-595.893) (-579.251) [-580.531] -- 0:02:43
18500 -- (-579.936) [-578.558] (-584.156) (-579.038) * [-577.366] (-585.224) (-575.809) (-575.327) -- 0:02:39
19000 -- (-581.232) (-576.654) [-577.988] (-576.613) * [-578.754] (-583.096) (-583.447) (-577.968) -- 0:02:34
19500 -- (-580.900) [-581.293] (-582.518) (-575.930) * (-576.603) [-582.613] (-578.497) (-577.255) -- 0:02:30
20000 -- (-580.518) (-577.697) [-583.218] (-577.472) * (-579.111) (-581.654) [-576.367] (-579.449) -- 0:02:27
Average standard deviation of split frequencies: 0.059306
20500 -- [-583.296] (-580.831) (-578.740) (-583.988) * [-579.233] (-580.763) (-579.524) (-580.747) -- 0:02:23
21000 -- (-579.428) (-581.679) (-578.804) [-577.521] * (-581.436) [-583.931] (-575.986) (-577.704) -- 0:02:19
21500 -- (-577.810) (-576.909) (-580.195) [-577.834] * (-579.592) (-583.621) (-579.635) [-574.674] -- 0:02:16
22000 -- (-576.843) (-578.553) [-582.127] (-575.573) * (-579.272) (-577.516) (-577.584) [-585.256] -- 0:02:13
22500 -- [-579.930] (-581.217) (-581.101) (-572.980) * [-581.208] (-580.980) (-578.333) (-580.091) -- 0:02:10
23000 -- (-581.223) [-578.502] (-580.265) (-575.198) * (-583.336) [-581.529] (-583.386) (-577.296) -- 0:02:07
23500 -- [-580.768] (-584.114) (-579.722) (-581.410) * (-580.292) (-578.000) [-580.945] (-577.488) -- 0:02:04
24000 -- (-581.652) (-579.404) [-583.274] (-582.167) * (-581.793) (-583.487) (-579.473) [-574.221] -- 0:02:42
24500 -- (-581.338) (-581.312) [-580.984] (-582.323) * [-578.948] (-581.487) (-585.311) (-581.063) -- 0:02:39
25000 -- (-577.284) (-583.958) (-580.996) [-577.191] * (-577.212) (-582.444) (-580.741) [-579.917] -- 0:02:36
Average standard deviation of split frequencies: 0.042306
25500 -- (-577.747) (-583.440) (-581.696) [-583.718] * (-579.221) (-584.429) [-578.736] (-583.587) -- 0:02:32
26000 -- (-577.486) [-574.044] (-578.497) (-577.030) * [-575.186] (-582.208) (-575.988) (-579.855) -- 0:02:29
26500 -- (-576.932) [-579.959] (-579.034) (-580.470) * (-579.720) (-590.454) [-578.335] (-582.498) -- 0:02:26
27000 -- (-580.074) (-579.045) (-582.319) [-579.231] * (-577.865) (-590.202) (-576.676) [-582.646] -- 0:02:24
27500 -- (-581.583) (-579.835) [-580.186] (-578.297) * (-580.442) (-585.229) (-578.644) [-579.869] -- 0:02:21
28000 -- (-581.413) [-579.983] (-578.922) (-578.438) * (-579.455) (-581.945) [-581.797] (-577.571) -- 0:02:18
28500 -- [-579.980] (-580.922) (-584.093) (-581.673) * (-584.471) (-579.235) [-579.385] (-581.699) -- 0:02:16
29000 -- (-583.725) (-579.903) (-574.659) [-579.610] * [-585.601] (-578.837) (-582.160) (-578.206) -- 0:02:13
29500 -- [-585.336] (-576.854) (-575.091) (-578.159) * (-583.653) [-579.369] (-582.868) (-582.826) -- 0:02:11
30000 -- (-584.049) [-577.483] (-577.908) (-583.993) * (-578.559) [-579.164] (-581.634) (-581.077) -- 0:02:09
Average standard deviation of split frequencies: 0.049190
30500 -- (-585.223) [-575.071] (-577.545) (-585.966) * [-577.287] (-581.358) (-580.289) (-579.622) -- 0:02:07
31000 -- (-587.678) (-579.032) (-578.471) [-583.363] * (-582.714) (-588.485) [-586.550] (-578.242) -- 0:02:05
31500 -- (-579.495) (-580.646) (-580.541) [-576.134] * [-579.280] (-579.764) (-579.748) (-579.913) -- 0:02:33
32000 -- [-581.537] (-578.605) (-575.938) (-582.844) * (-587.177) (-579.327) (-585.034) [-579.637] -- 0:02:31
32500 -- (-580.934) (-578.794) [-575.360] (-579.045) * [-582.105] (-576.456) (-580.997) (-577.275) -- 0:02:28
33000 -- (-586.597) (-577.422) (-574.557) [-581.584] * [-577.696] (-584.929) (-576.615) (-580.746) -- 0:02:26
33500 -- (-585.718) [-577.109] (-576.165) (-580.744) * (-577.207) (-577.984) (-576.940) [-577.613] -- 0:02:24
34000 -- (-582.306) [-583.774] (-578.549) (-582.382) * (-579.145) (-579.365) (-576.704) [-581.441] -- 0:02:22
34500 -- (-585.650) (-584.636) [-577.368] (-574.817) * (-580.837) [-576.132] (-580.649) (-579.464) -- 0:02:19
35000 -- [-583.241] (-582.093) (-577.711) (-576.774) * (-577.661) (-576.875) (-578.259) [-584.578] -- 0:02:17
Average standard deviation of split frequencies: 0.036374
35500 -- (-586.535) [-577.342] (-582.268) (-582.112) * [-575.320] (-579.940) (-592.424) (-577.959) -- 0:02:15
36000 -- (-584.376) (-577.023) (-579.653) [-581.566] * (-578.663) (-576.675) [-578.917] (-577.170) -- 0:02:13
36500 -- (-585.022) [-580.271] (-580.287) (-588.989) * (-581.924) (-583.537) [-580.526] (-576.917) -- 0:02:11
37000 -- [-579.341] (-579.135) (-578.342) (-587.208) * [-577.503] (-578.517) (-577.442) (-578.283) -- 0:02:10
37500 -- [-578.465] (-578.383) (-581.283) (-585.260) * [-574.646] (-585.608) (-577.252) (-577.921) -- 0:02:08
38000 -- (-577.336) (-576.942) (-578.221) [-582.219] * (-578.121) [-582.570] (-581.419) (-576.761) -- 0:02:06
38500 -- (-577.720) (-584.112) [-580.753] (-580.916) * (-581.170) (-579.317) [-586.958] (-577.558) -- 0:02:04
39000 -- (-576.550) [-583.757] (-584.828) (-581.456) * [-581.909] (-582.006) (-578.326) (-579.867) -- 0:02:27
39500 -- [-575.005] (-586.987) (-582.485) (-581.658) * [-575.344] (-581.181) (-578.424) (-581.344) -- 0:02:25
40000 -- (-579.420) [-581.768] (-580.743) (-577.603) * [-577.126] (-584.080) (-580.877) (-575.032) -- 0:02:24
Average standard deviation of split frequencies: 0.041731
40500 -- (-585.088) [-578.943] (-581.338) (-578.569) * (-579.833) (-580.059) (-579.722) [-577.183] -- 0:02:22
41000 -- (-577.845) (-584.446) [-575.790] (-579.806) * (-578.100) (-586.142) [-578.915] (-579.047) -- 0:02:20
41500 -- (-579.996) (-581.323) [-577.453] (-578.640) * [-579.794] (-581.695) (-583.237) (-580.908) -- 0:02:18
42000 -- (-577.954) [-581.211] (-578.173) (-576.136) * (-581.167) [-581.917] (-582.760) (-579.096) -- 0:02:16
42500 -- [-575.347] (-578.861) (-577.638) (-581.951) * (-577.548) (-584.808) (-588.399) [-575.691] -- 0:02:15
43000 -- (-580.137) [-578.002] (-581.478) (-576.467) * [-576.372] (-582.108) (-584.173) (-576.176) -- 0:02:13
43500 -- [-577.309] (-577.353) (-575.736) (-587.564) * (-575.991) (-576.569) [-575.092] (-578.697) -- 0:02:11
44000 -- [-575.609] (-578.402) (-577.561) (-579.600) * (-574.480) (-577.311) (-587.060) [-577.310] -- 0:02:10
44500 -- (-576.530) (-576.092) [-575.736] (-575.269) * [-583.998] (-573.028) (-575.101) (-578.540) -- 0:02:08
45000 -- (-583.974) (-583.244) (-573.508) [-577.447] * (-583.510) (-573.881) (-585.569) [-584.757] -- 0:02:07
Average standard deviation of split frequencies: 0.034843
45500 -- (-576.655) (-578.098) [-578.543] (-577.008) * (-577.126) (-574.861) [-578.670] (-585.222) -- 0:02:05
46000 -- (-576.804) (-580.182) (-576.758) [-578.780] * (-580.552) (-579.794) (-577.695) [-579.467] -- 0:02:04
46500 -- (-579.433) (-574.682) [-583.157] (-577.219) * (-581.872) (-575.858) [-582.435] (-580.458) -- 0:02:23
47000 -- (-579.839) [-574.856] (-582.004) (-582.448) * (-578.351) (-576.890) (-582.994) [-579.156] -- 0:02:21
47500 -- (-581.355) [-577.567] (-578.403) (-578.869) * [-578.154] (-578.674) (-579.094) (-576.639) -- 0:02:20
48000 -- [-579.727] (-577.304) (-583.268) (-580.703) * (-581.792) (-579.727) [-581.213] (-584.224) -- 0:02:18
48500 -- [-579.216] (-585.734) (-578.198) (-584.925) * (-587.546) [-578.117] (-582.721) (-578.195) -- 0:02:17
49000 -- (-578.631) (-578.468) [-583.769] (-579.169) * (-583.266) [-582.134] (-577.776) (-581.315) -- 0:02:15
49500 -- (-581.693) (-579.927) [-581.709] (-585.354) * [-580.265] (-576.481) (-580.565) (-578.475) -- 0:02:14
50000 -- (-584.279) (-579.858) [-580.805] (-577.920) * (-576.513) (-575.213) (-583.677) [-581.909] -- 0:02:13
Average standard deviation of split frequencies: 0.039077
50500 -- (-585.270) (-579.521) (-577.791) [-577.383] * (-577.500) (-579.639) (-582.528) [-580.680] -- 0:02:11
51000 -- [-580.033] (-578.909) (-581.030) (-575.452) * [-575.514] (-578.138) (-583.280) (-574.839) -- 0:02:10
51500 -- (-584.878) (-585.523) (-577.625) [-577.296] * [-577.407] (-575.715) (-578.150) (-586.327) -- 0:02:08
52000 -- (-581.495) [-578.768] (-574.241) (-588.721) * [-576.086] (-577.954) (-576.277) (-577.332) -- 0:02:07
52500 -- [-577.939] (-582.244) (-574.550) (-579.056) * (-580.991) (-583.010) (-576.615) [-579.621] -- 0:02:06
53000 -- (-586.940) [-577.465] (-577.030) (-578.280) * (-578.535) (-581.632) [-576.718] (-589.471) -- 0:02:05
53500 -- (-584.498) [-577.253] (-585.358) (-576.487) * (-581.089) [-582.747] (-578.472) (-577.418) -- 0:02:21
54000 -- (-580.399) (-578.262) [-581.100] (-582.427) * [-578.459] (-577.553) (-580.647) (-577.434) -- 0:02:20
54500 -- (-579.170) (-581.333) (-578.820) [-575.938] * (-577.873) (-578.346) [-578.572] (-576.523) -- 0:02:18
55000 -- (-578.553) (-581.528) [-577.709] (-582.928) * (-580.135) (-579.725) (-584.398) [-576.065] -- 0:02:17
Average standard deviation of split frequencies: 0.046766
55500 -- [-582.077] (-581.197) (-582.999) (-578.045) * (-582.962) [-578.782] (-587.559) (-577.654) -- 0:02:16
56000 -- [-578.667] (-579.055) (-581.778) (-583.979) * (-578.586) [-577.961] (-589.573) (-574.311) -- 0:02:14
56500 -- (-581.779) (-583.152) (-576.876) [-581.876] * (-578.834) (-577.113) (-586.092) [-578.044] -- 0:02:13
57000 -- (-575.990) [-577.779] (-579.613) (-579.905) * (-584.608) [-578.534] (-579.262) (-583.234) -- 0:02:12
57500 -- [-577.495] (-579.164) (-579.765) (-578.267) * (-580.908) (-584.182) (-577.881) [-579.349] -- 0:02:11
58000 -- (-583.165) (-581.519) [-578.465] (-576.860) * (-591.615) (-576.227) (-579.801) [-577.248] -- 0:02:09
58500 -- (-579.920) (-586.493) (-574.800) [-580.074] * (-580.796) (-577.701) [-585.042] (-574.925) -- 0:02:08
59000 -- (-580.876) (-585.983) (-578.742) [-577.845] * (-580.251) [-575.541] (-579.824) (-574.951) -- 0:02:07
59500 -- (-582.750) [-587.026] (-578.770) (-579.691) * (-590.138) (-577.604) [-577.875] (-583.797) -- 0:02:06
60000 -- (-582.489) [-582.233] (-581.407) (-583.400) * (-581.883) [-572.879] (-577.833) (-582.101) -- 0:02:05
Average standard deviation of split frequencies: 0.039715
60500 -- (-579.350) (-584.765) [-579.973] (-582.957) * (-584.781) [-577.048] (-577.758) (-576.302) -- 0:02:04
61000 -- [-580.658] (-586.680) (-580.315) (-581.146) * (-583.637) [-575.721] (-588.521) (-577.053) -- 0:02:18
61500 -- (-586.926) [-580.612] (-576.386) (-581.154) * (-587.581) (-578.193) (-576.235) [-580.829] -- 0:02:17
62000 -- (-578.258) [-586.182] (-578.638) (-583.452) * (-589.432) [-580.081] (-575.648) (-575.597) -- 0:02:16
62500 -- (-582.514) (-577.652) (-576.943) [-577.573] * (-583.845) [-577.792] (-575.964) (-581.318) -- 0:02:15
63000 -- (-581.250) (-576.184) [-574.579] (-591.342) * (-581.567) (-581.779) (-585.321) [-579.103] -- 0:02:13
63500 -- (-579.353) (-577.391) [-574.093] (-578.376) * (-580.307) (-579.446) [-583.650] (-582.423) -- 0:02:12
64000 -- (-576.200) (-577.969) (-581.789) [-575.755] * (-589.834) (-578.380) [-582.395] (-578.844) -- 0:02:11
64500 -- (-580.180) [-580.081] (-587.774) (-578.026) * (-580.254) (-583.564) [-577.163] (-579.945) -- 0:02:10
65000 -- (-575.563) [-585.222] (-578.570) (-576.060) * (-581.503) (-589.386) (-580.512) [-578.231] -- 0:02:09
Average standard deviation of split frequencies: 0.035712
65500 -- (-577.133) (-579.570) (-579.166) [-577.577] * (-577.449) [-577.577] (-579.468) (-580.590) -- 0:02:08
66000 -- (-578.508) (-577.246) (-580.523) [-575.699] * (-582.196) [-577.387] (-587.797) (-576.678) -- 0:02:07
66500 -- (-587.614) [-578.984] (-578.719) (-581.021) * (-583.393) (-581.026) (-586.440) [-575.220] -- 0:02:06
67000 -- (-589.070) [-584.171] (-583.790) (-575.062) * (-576.833) [-573.332] (-584.974) (-577.506) -- 0:02:05
67500 -- (-582.790) (-580.006) (-586.540) [-575.322] * (-576.631) [-574.310] (-579.579) (-581.217) -- 0:02:04
68000 -- [-581.983] (-583.946) (-584.069) (-574.899) * (-578.994) [-575.110] (-591.585) (-577.513) -- 0:02:17
68500 -- (-591.283) [-578.544] (-581.469) (-576.739) * (-582.664) (-578.994) [-576.600] (-575.150) -- 0:02:15
69000 -- (-578.869) (-578.253) (-577.591) [-575.201] * [-580.842] (-584.724) (-576.002) (-577.460) -- 0:02:14
69500 -- (-578.503) (-579.080) (-577.751) [-575.636] * [-577.596] (-585.013) (-581.766) (-573.466) -- 0:02:13
70000 -- (-585.454) [-579.491] (-576.405) (-576.021) * (-582.082) (-579.423) [-576.491] (-578.406) -- 0:02:12
Average standard deviation of split frequencies: 0.032613
70500 -- (-581.292) (-581.876) [-580.596] (-578.849) * (-580.163) (-580.866) (-582.989) [-577.157] -- 0:02:11
71000 -- (-589.852) [-578.142] (-576.182) (-582.408) * (-580.647) (-585.057) (-581.320) [-579.156] -- 0:02:10
71500 -- (-577.710) (-586.536) [-577.201] (-586.387) * (-580.436) [-577.403] (-583.674) (-582.805) -- 0:02:09
72000 -- (-578.941) (-580.347) (-576.315) [-580.500] * (-578.699) (-588.983) (-584.175) [-579.977] -- 0:02:08
72500 -- (-577.768) (-576.990) (-578.071) [-576.099] * (-585.808) [-579.078] (-581.908) (-586.480) -- 0:02:07
73000 -- [-575.370] (-576.134) (-577.275) (-576.088) * (-581.352) (-578.605) (-588.203) [-576.297] -- 0:02:06
73500 -- (-577.021) (-580.944) [-578.337] (-584.137) * (-579.873) (-586.523) [-580.777] (-579.000) -- 0:02:06
74000 -- (-577.034) (-575.766) (-584.176) [-576.506] * (-586.395) (-575.854) (-580.383) [-579.061] -- 0:02:05
74500 -- (-583.198) (-582.147) (-585.965) [-577.143] * (-584.797) [-575.850] (-578.455) (-579.651) -- 0:02:04
75000 -- (-582.203) (-583.386) [-585.468] (-581.266) * (-590.968) (-580.275) (-580.605) [-578.927] -- 0:02:03
Average standard deviation of split frequencies: 0.025586
75500 -- (-581.881) (-580.067) (-582.649) [-576.210] * (-587.348) (-583.034) [-583.187] (-579.301) -- 0:02:14
76000 -- (-587.035) (-580.686) [-579.076] (-574.874) * (-587.991) [-578.776] (-577.762) (-577.920) -- 0:02:13
76500 -- (-583.909) (-577.771) (-580.605) [-580.546] * (-585.729) (-578.059) (-586.591) [-579.104] -- 0:02:12
77000 -- (-574.502) [-575.733] (-577.158) (-577.409) * (-586.210) [-578.706] (-582.696) (-576.591) -- 0:02:11
77500 -- (-579.362) (-578.591) (-577.264) [-579.060] * (-587.376) (-581.296) [-581.654] (-578.318) -- 0:02:10
78000 -- (-581.168) (-583.870) (-574.952) [-584.485] * [-581.821] (-575.065) (-586.545) (-584.682) -- 0:02:10
78500 -- (-581.103) (-577.472) [-578.068] (-582.146) * [-580.495] (-579.926) (-589.024) (-580.588) -- 0:02:09
79000 -- (-581.222) (-584.981) (-578.270) [-586.464] * (-583.236) [-575.375] (-586.355) (-580.810) -- 0:02:08
79500 -- (-577.822) (-577.099) [-575.430] (-578.512) * (-580.240) (-580.359) (-588.312) [-574.910] -- 0:02:07
80000 -- [-576.595] (-575.999) (-577.384) (-579.045) * (-583.048) [-578.952] (-582.581) (-578.886) -- 0:02:06
Average standard deviation of split frequencies: 0.024106
80500 -- (-584.897) (-578.264) [-579.585] (-575.611) * (-582.825) (-584.623) [-578.788] (-578.759) -- 0:02:05
81000 -- (-578.138) (-576.136) [-583.158] (-576.414) * (-586.316) (-586.613) [-576.077] (-583.065) -- 0:02:04
81500 -- [-576.342] (-579.986) (-580.673) (-578.742) * [-581.411] (-579.975) (-577.705) (-575.582) -- 0:02:03
82000 -- (-580.837) [-578.775] (-580.673) (-576.206) * [-582.067] (-583.346) (-579.415) (-579.149) -- 0:02:03
82500 -- (-580.763) (-577.236) (-581.567) [-581.184] * [-578.241] (-588.141) (-577.207) (-579.967) -- 0:02:02
83000 -- (-581.612) [-577.562] (-584.198) (-578.319) * (-581.789) [-581.383] (-583.619) (-581.764) -- 0:02:12
83500 -- (-575.222) (-575.949) (-579.640) [-573.887] * (-581.716) [-584.087] (-577.110) (-574.408) -- 0:02:11
84000 -- [-578.735] (-580.003) (-582.531) (-581.678) * [-585.510] (-584.398) (-577.793) (-575.769) -- 0:02:10
84500 -- (-579.155) (-580.981) (-585.010) [-576.939] * (-578.821) (-577.679) [-580.833] (-582.270) -- 0:02:10
85000 -- [-574.156] (-582.205) (-583.750) (-585.639) * (-579.436) (-577.805) [-580.004] (-576.717) -- 0:02:09
Average standard deviation of split frequencies: 0.017815
85500 -- (-579.119) [-582.754] (-582.302) (-580.537) * [-582.994] (-579.490) (-583.239) (-579.871) -- 0:02:08
86000 -- (-580.298) [-579.205] (-578.414) (-578.741) * (-581.715) (-578.787) [-578.159] (-576.598) -- 0:02:07
86500 -- [-580.449] (-584.873) (-582.780) (-580.789) * (-576.992) [-576.651] (-580.703) (-578.484) -- 0:02:06
87000 -- (-582.698) [-581.152] (-579.707) (-577.239) * (-581.464) (-577.267) (-576.946) [-582.073] -- 0:02:05
87500 -- (-582.266) (-580.874) [-583.812] (-580.370) * (-581.484) [-580.094] (-580.431) (-583.867) -- 0:02:05
88000 -- (-580.262) (-579.105) (-580.666) [-578.046] * (-577.803) [-576.737] (-578.519) (-582.695) -- 0:02:04
88500 -- [-581.155] (-580.947) (-584.571) (-582.272) * (-581.484) [-580.954] (-585.802) (-585.701) -- 0:02:03
89000 -- (-580.956) (-581.811) [-582.501] (-585.335) * (-581.270) [-577.654] (-578.343) (-590.289) -- 0:02:02
89500 -- (-579.511) [-581.914] (-580.947) (-579.725) * (-575.383) (-579.124) (-587.084) [-578.241] -- 0:02:02
90000 -- (-579.262) (-576.100) (-586.505) [-577.531] * [-576.491] (-585.888) (-581.158) (-584.723) -- 0:02:01
Average standard deviation of split frequencies: 0.016898
90500 -- [-575.240] (-581.839) (-582.591) (-582.726) * [-578.836] (-583.608) (-583.408) (-582.151) -- 0:02:10
91000 -- [-580.345] (-578.300) (-585.603) (-581.993) * (-576.901) (-579.051) (-580.483) [-579.457] -- 0:02:09
91500 -- (-578.090) [-573.512] (-579.053) (-585.648) * [-574.686] (-577.670) (-581.514) (-579.634) -- 0:02:09
92000 -- (-576.292) [-576.194] (-577.347) (-582.515) * [-583.236] (-581.459) (-575.095) (-578.208) -- 0:02:08
92500 -- (-582.276) [-574.329] (-577.011) (-578.747) * (-579.028) [-577.349] (-581.399) (-579.513) -- 0:02:07
93000 -- (-580.805) (-577.987) [-582.868] (-576.136) * (-583.233) [-576.912] (-578.622) (-582.631) -- 0:02:06
93500 -- [-577.727] (-579.588) (-578.382) (-582.318) * [-584.326] (-579.242) (-576.207) (-584.857) -- 0:02:06
94000 -- (-579.131) [-574.928] (-576.198) (-581.507) * (-583.342) (-576.122) (-582.121) [-580.924] -- 0:02:05
94500 -- (-577.134) [-578.379] (-575.995) (-577.819) * (-583.186) (-576.561) [-579.848] (-582.521) -- 0:02:04
95000 -- (-583.982) (-576.484) [-578.622] (-583.967) * [-576.518] (-577.843) (-578.493) (-578.050) -- 0:02:03
Average standard deviation of split frequencies: 0.016836
95500 -- (-580.985) [-575.941] (-583.763) (-587.225) * [-580.783] (-575.697) (-578.146) (-576.318) -- 0:02:03
96000 -- (-577.704) [-574.553] (-595.646) (-579.226) * (-576.847) [-582.144] (-579.531) (-576.335) -- 0:02:02
96500 -- [-578.903] (-574.587) (-576.469) (-582.236) * (-578.707) [-580.588] (-580.245) (-581.642) -- 0:02:01
97000 -- (-577.600) (-584.748) (-583.115) [-579.937] * (-584.003) (-578.935) (-575.822) [-577.189] -- 0:02:01
97500 -- (-575.573) [-575.943] (-582.780) (-588.254) * [-577.132] (-577.643) (-577.774) (-580.051) -- 0:02:09
98000 -- (-576.681) [-577.575] (-580.910) (-577.531) * [-578.103] (-580.252) (-581.011) (-579.342) -- 0:02:08
98500 -- [-578.835] (-577.135) (-581.049) (-582.801) * (-579.129) (-583.170) [-578.880] (-577.851) -- 0:02:08
99000 -- (-590.105) (-578.797) (-575.501) [-583.672] * (-578.543) [-578.750] (-577.006) (-578.354) -- 0:02:07
99500 -- [-581.107] (-582.779) (-581.112) (-581.029) * (-583.216) [-577.232] (-578.065) (-579.173) -- 0:02:06
100000 -- [-576.082] (-578.675) (-584.016) (-583.358) * (-583.176) (-581.158) [-574.596] (-578.967) -- 0:02:05
Average standard deviation of split frequencies: 0.019400
100500 -- (-576.010) (-577.858) (-578.645) [-585.089] * (-583.923) (-579.300) (-576.899) [-581.224] -- 0:02:05
101000 -- (-576.363) (-577.324) [-578.277] (-581.634) * (-583.623) (-579.595) [-584.744] (-581.330) -- 0:02:04
101500 -- (-579.204) (-580.165) [-579.172] (-576.499) * (-589.700) [-579.366] (-580.829) (-586.315) -- 0:02:03
102000 -- [-577.716] (-579.484) (-575.895) (-575.969) * (-586.818) (-579.621) [-577.604] (-586.619) -- 0:02:03
102500 -- (-578.349) [-576.520] (-579.000) (-579.818) * (-583.855) [-576.491] (-585.791) (-583.840) -- 0:02:02
103000 -- (-580.739) (-576.007) [-576.337] (-580.966) * (-581.453) [-584.387] (-577.554) (-581.723) -- 0:02:01
103500 -- (-583.736) (-577.381) [-579.607] (-577.624) * [-580.868] (-583.001) (-575.446) (-581.297) -- 0:02:01
104000 -- (-576.282) [-577.681] (-577.461) (-578.131) * [-581.180] (-579.288) (-578.351) (-581.387) -- 0:02:00
104500 -- (-575.830) (-582.053) [-575.552] (-576.476) * (-579.708) (-581.801) (-583.012) [-580.735] -- 0:01:59
105000 -- [-577.956] (-582.707) (-580.201) (-578.645) * [-583.798] (-580.103) (-582.440) (-585.944) -- 0:02:07
Average standard deviation of split frequencies: 0.018345
105500 -- (-581.011) [-573.239] (-586.650) (-580.225) * (-582.281) (-585.018) [-580.976] (-582.039) -- 0:02:07
106000 -- (-576.085) [-574.312] (-586.250) (-587.139) * (-583.462) (-585.077) [-584.496] (-578.490) -- 0:02:06
106500 -- [-576.130] (-577.971) (-582.773) (-578.948) * (-574.823) (-578.194) [-580.839] (-577.979) -- 0:02:05
107000 -- [-575.298] (-576.559) (-581.402) (-578.661) * (-583.628) (-579.834) (-582.753) [-577.609] -- 0:02:05
107500 -- (-581.449) [-577.518] (-581.390) (-588.935) * (-575.233) (-580.470) [-577.090] (-575.167) -- 0:02:04
108000 -- (-581.769) [-576.869] (-585.849) (-588.644) * (-574.637) (-577.690) [-579.341] (-581.863) -- 0:02:03
108500 -- (-577.384) (-578.967) [-576.961] (-579.536) * (-579.859) (-578.972) [-583.817] (-584.724) -- 0:02:03
109000 -- (-575.383) (-576.611) (-577.912) [-572.490] * (-579.720) (-577.137) [-584.011] (-588.024) -- 0:02:02
109500 -- (-576.873) (-582.070) [-580.052] (-577.390) * (-585.297) [-581.181] (-578.779) (-580.006) -- 0:02:01
110000 -- [-582.038] (-583.629) (-581.928) (-580.265) * [-578.462] (-580.428) (-579.560) (-578.472) -- 0:02:01
Average standard deviation of split frequencies: 0.015974
110500 -- (-575.569) (-578.616) [-583.146] (-579.692) * (-583.136) [-577.159] (-576.802) (-578.557) -- 0:02:00
111000 -- [-575.049] (-580.378) (-579.180) (-581.579) * (-578.283) [-575.494] (-577.506) (-577.333) -- 0:02:00
111500 -- (-575.405) (-583.887) (-580.757) [-575.572] * (-580.218) (-585.434) (-576.835) [-574.402] -- 0:01:59
112000 -- [-579.572] (-580.830) (-582.690) (-583.348) * (-581.373) (-577.821) (-577.526) [-578.240] -- 0:01:58
112500 -- (-579.004) (-579.692) [-575.962] (-583.723) * (-588.611) (-584.915) (-576.830) [-576.682] -- 0:02:06
113000 -- (-576.017) (-586.145) [-576.524] (-578.636) * (-580.792) [-577.050] (-581.063) (-583.442) -- 0:02:05
113500 -- (-574.311) [-577.327] (-580.796) (-582.840) * [-580.870] (-581.230) (-582.050) (-589.600) -- 0:02:04
114000 -- (-581.331) (-574.674) (-576.106) [-578.715] * (-580.622) (-580.465) (-578.789) [-583.481] -- 0:02:04
114500 -- [-578.015] (-575.740) (-578.583) (-586.301) * (-582.247) (-582.091) [-578.372] (-588.748) -- 0:02:03
115000 -- (-583.199) (-578.316) [-575.591] (-589.244) * (-579.817) (-582.630) (-577.692) [-580.687] -- 0:02:03
Average standard deviation of split frequencies: 0.016763
115500 -- (-578.885) [-573.823] (-578.425) (-584.822) * (-575.886) (-581.255) [-580.786] (-581.696) -- 0:02:02
116000 -- (-584.524) (-574.570) [-581.417] (-582.469) * (-577.793) (-580.293) [-582.304] (-577.973) -- 0:02:01
116500 -- (-584.038) [-578.972] (-578.598) (-587.103) * (-579.544) [-579.619] (-585.610) (-575.296) -- 0:02:01
117000 -- (-579.690) [-582.523] (-580.444) (-582.108) * [-579.301] (-581.467) (-580.004) (-581.058) -- 0:02:00
117500 -- (-582.164) [-583.134] (-578.154) (-581.269) * (-582.018) (-584.495) (-587.404) [-577.543] -- 0:02:00
118000 -- [-577.370] (-575.480) (-581.658) (-576.812) * (-581.504) (-585.967) (-583.171) [-577.735] -- 0:01:59
118500 -- [-575.383] (-580.081) (-579.313) (-588.022) * (-581.654) (-581.326) (-581.782) [-576.279] -- 0:01:59
119000 -- (-577.758) [-577.315] (-581.278) (-582.733) * (-583.072) (-580.126) (-579.345) [-578.926] -- 0:01:58
119500 -- [-590.381] (-577.357) (-580.452) (-576.697) * [-580.282] (-578.267) (-587.205) (-586.747) -- 0:02:05
120000 -- (-589.067) (-575.979) (-580.097) [-581.706] * [-576.025] (-575.824) (-583.024) (-574.536) -- 0:02:04
Average standard deviation of split frequencies: 0.018068
120500 -- (-587.145) (-580.313) [-580.722] (-583.281) * (-576.926) [-574.687] (-585.891) (-577.365) -- 0:02:04
121000 -- (-582.130) (-578.094) [-583.511] (-576.334) * (-581.197) (-582.606) (-578.132) [-572.963] -- 0:02:03
121500 -- (-580.014) (-578.537) (-580.157) [-575.598] * (-587.221) (-579.572) (-588.895) [-575.227] -- 0:02:02
122000 -- (-578.516) (-580.814) (-587.029) [-576.538] * (-574.406) (-586.348) (-574.148) [-581.619] -- 0:02:02
122500 -- (-574.653) [-577.067] (-580.563) (-579.250) * [-579.415] (-582.189) (-575.265) (-578.498) -- 0:02:01
123000 -- (-578.987) (-582.502) [-579.880] (-580.961) * (-582.614) (-585.886) (-577.088) [-575.944] -- 0:02:01
123500 -- (-579.547) (-579.641) (-582.612) [-575.679] * (-577.430) (-590.221) [-576.244] (-579.933) -- 0:02:00
124000 -- (-579.753) (-581.696) (-585.065) [-578.360] * (-585.525) (-590.987) [-581.093] (-582.527) -- 0:02:00
124500 -- [-580.777] (-577.086) (-576.808) (-579.062) * (-575.926) (-586.715) [-579.312] (-579.153) -- 0:01:59
125000 -- (-578.311) (-575.149) [-574.258] (-574.840) * (-580.052) (-586.224) [-576.949] (-574.315) -- 0:01:59
Average standard deviation of split frequencies: 0.017304
125500 -- (-575.744) [-576.702] (-577.076) (-577.680) * (-581.124) (-581.792) (-577.204) [-575.789] -- 0:01:58
126000 -- (-581.526) (-577.588) [-573.418] (-577.940) * (-578.206) (-585.740) (-581.454) [-580.103] -- 0:01:57
126500 -- [-575.577] (-582.321) (-577.441) (-579.233) * [-575.955] (-584.285) (-576.041) (-583.679) -- 0:01:57
127000 -- (-581.051) [-581.302] (-585.137) (-586.300) * (-579.504) (-583.385) [-574.127] (-579.743) -- 0:02:03
127500 -- (-580.362) (-576.568) (-575.289) [-578.656] * (-577.969) (-583.921) [-577.683] (-576.041) -- 0:02:03
128000 -- [-574.874] (-578.746) (-576.437) (-577.842) * [-579.363] (-578.396) (-582.352) (-580.710) -- 0:02:02
128500 -- (-579.196) (-576.297) (-578.895) [-576.120] * (-574.677) (-581.492) (-584.640) [-580.704] -- 0:02:02
129000 -- (-581.704) [-580.611] (-577.218) (-582.392) * (-579.599) (-578.252) (-581.677) [-578.651] -- 0:02:01
129500 -- (-576.380) (-579.263) (-577.705) [-576.023] * (-584.868) [-586.936] (-578.189) (-579.612) -- 0:02:00
130000 -- [-577.539] (-578.389) (-579.735) (-575.923) * (-578.315) (-585.498) [-582.828] (-581.732) -- 0:02:00
Average standard deviation of split frequencies: 0.015784
130500 -- (-580.944) (-579.812) (-577.400) [-575.885] * (-578.936) (-585.183) (-576.193) [-580.488] -- 0:01:59
131000 -- (-579.649) (-587.330) (-575.863) [-581.064] * [-575.059] (-579.596) (-580.168) (-579.471) -- 0:01:59
131500 -- (-584.964) [-583.776] (-576.251) (-583.109) * [-574.181] (-584.204) (-589.110) (-589.589) -- 0:01:58
132000 -- (-580.010) (-582.109) [-577.892] (-580.463) * (-575.344) (-589.486) (-583.427) [-579.412] -- 0:01:58
132500 -- (-587.649) (-578.741) [-576.971] (-578.029) * (-580.602) [-584.021] (-579.858) (-577.468) -- 0:01:57
133000 -- [-581.172] (-579.809) (-579.095) (-579.380) * (-581.548) [-584.181] (-585.407) (-577.035) -- 0:01:57
133500 -- (-583.758) (-579.219) [-589.941] (-579.335) * (-579.273) (-589.558) [-577.023] (-580.890) -- 0:01:56
134000 -- (-583.410) [-578.615] (-576.428) (-585.101) * (-580.000) (-592.876) (-585.576) [-578.245] -- 0:01:56
134500 -- (-584.880) (-578.344) [-578.228] (-588.329) * [-574.613] (-580.346) (-576.611) (-580.934) -- 0:02:02
135000 -- (-575.874) (-583.810) (-576.500) [-582.392] * [-580.565] (-580.995) (-575.342) (-580.479) -- 0:02:01
Average standard deviation of split frequencies: 0.015165
135500 -- [-574.742] (-581.907) (-577.906) (-585.803) * [-582.340] (-576.839) (-576.737) (-576.079) -- 0:02:01
136000 -- (-578.650) [-577.612] (-583.453) (-588.817) * (-579.678) (-579.247) (-577.894) [-578.821] -- 0:02:00
136500 -- (-579.085) (-580.832) [-578.336] (-584.402) * (-572.960) (-577.120) [-576.222] (-587.334) -- 0:02:00
137000 -- (-577.604) (-576.060) (-585.559) [-577.994] * [-576.577] (-583.749) (-577.612) (-589.896) -- 0:01:59
137500 -- (-579.154) [-579.824] (-586.520) (-587.599) * [-575.486] (-582.281) (-582.667) (-583.626) -- 0:01:59
138000 -- [-574.006] (-577.709) (-578.169) (-580.865) * (-581.525) [-577.251] (-580.435) (-581.067) -- 0:01:58
138500 -- (-584.061) (-574.940) [-579.635] (-580.534) * (-580.574) (-580.454) [-577.065] (-581.602) -- 0:01:58
139000 -- (-582.468) [-577.573] (-583.405) (-589.030) * (-582.684) (-583.572) (-580.090) [-579.804] -- 0:01:57
139500 -- (-579.393) (-578.081) (-581.041) [-582.731] * (-587.563) (-577.060) [-577.797] (-581.651) -- 0:01:57
140000 -- (-579.473) (-584.241) [-581.997] (-585.459) * (-578.941) [-579.210] (-581.105) (-586.344) -- 0:01:56
Average standard deviation of split frequencies: 0.015918
140500 -- [-581.879] (-576.192) (-587.476) (-593.446) * (-580.348) [-582.866] (-584.018) (-583.624) -- 0:01:56
141000 -- (-580.256) (-577.688) (-585.780) [-586.816] * (-574.483) (-584.774) (-584.105) [-575.801] -- 0:01:55
141500 -- (-586.439) [-578.077] (-578.339) (-588.099) * (-576.459) (-582.148) [-580.320] (-581.293) -- 0:01:55
142000 -- (-586.631) (-584.376) [-576.436] (-587.415) * [-573.652] (-580.331) (-579.066) (-580.603) -- 0:02:00
142500 -- [-576.726] (-580.293) (-580.551) (-584.755) * (-580.656) [-577.705] (-578.673) (-579.468) -- 0:02:00
143000 -- (-576.329) (-580.173) [-581.386] (-582.937) * (-579.388) (-585.115) [-580.141] (-578.594) -- 0:01:59
143500 -- [-576.707] (-582.315) (-578.044) (-580.337) * (-581.239) (-581.608) (-581.266) [-584.260] -- 0:01:59
144000 -- (-579.965) [-582.132] (-584.783) (-577.918) * (-579.368) (-580.033) (-588.069) [-587.239] -- 0:01:58
144500 -- (-578.229) [-574.789] (-583.194) (-578.080) * [-576.739] (-581.476) (-577.063) (-583.983) -- 0:01:58
145000 -- (-582.708) [-576.571] (-577.951) (-586.900) * [-574.617] (-578.065) (-576.327) (-583.425) -- 0:01:57
Average standard deviation of split frequencies: 0.015337
145500 -- (-579.774) (-584.230) [-577.707] (-585.559) * [-574.964] (-581.152) (-578.813) (-584.884) -- 0:01:57
146000 -- [-581.859] (-578.168) (-583.903) (-584.362) * (-575.474) [-576.049] (-578.437) (-583.306) -- 0:01:56
146500 -- (-581.519) (-582.678) (-585.557) [-585.690] * (-580.688) (-574.462) [-579.146] (-583.945) -- 0:01:56
147000 -- [-575.004] (-574.676) (-578.680) (-587.476) * (-583.486) [-578.239] (-583.653) (-579.670) -- 0:01:56
147500 -- (-575.655) (-580.566) [-574.096] (-589.028) * (-581.148) (-576.351) [-582.182] (-585.162) -- 0:01:55
148000 -- (-581.973) [-579.064] (-582.043) (-592.727) * (-586.589) (-580.846) [-576.763] (-593.051) -- 0:01:55
148500 -- (-579.664) [-575.484] (-582.342) (-585.418) * (-576.330) (-581.169) [-579.665] (-580.753) -- 0:01:54
149000 -- [-575.641] (-576.968) (-577.608) (-587.885) * (-581.118) [-577.614] (-583.150) (-577.019) -- 0:01:59
149500 -- (-578.257) [-580.826] (-580.075) (-582.298) * (-577.327) (-579.351) (-576.967) [-577.020] -- 0:01:59
150000 -- [-581.314] (-583.771) (-579.463) (-590.200) * (-581.025) (-580.427) (-582.073) [-585.282] -- 0:01:58
Average standard deviation of split frequencies: 0.015644
150500 -- (-582.096) (-579.818) (-583.580) [-581.012] * (-585.091) (-584.545) [-581.209] (-574.844) -- 0:01:58
151000 -- (-580.312) (-582.080) (-580.901) [-578.599] * (-580.446) (-582.107) (-575.574) [-576.617] -- 0:01:58
151500 -- [-576.873] (-579.808) (-579.302) (-583.796) * (-577.966) (-580.289) (-580.928) [-576.867] -- 0:01:57
152000 -- (-580.213) [-578.901] (-575.686) (-586.916) * (-581.537) [-580.236] (-579.917) (-579.171) -- 0:01:57
152500 -- [-579.008] (-585.231) (-579.458) (-579.712) * (-583.450) (-578.602) [-578.561] (-575.393) -- 0:01:56
153000 -- (-578.752) (-581.311) (-574.856) [-577.286] * [-580.679] (-578.186) (-579.311) (-577.521) -- 0:01:56
153500 -- (-581.374) (-580.580) (-574.480) [-575.799] * [-577.827] (-576.587) (-578.114) (-575.139) -- 0:01:55
154000 -- (-577.576) (-586.833) [-575.482] (-577.299) * (-578.289) (-578.667) (-577.284) [-578.794] -- 0:01:55
154500 -- (-577.775) (-587.687) [-575.170] (-581.910) * (-580.927) (-581.693) (-580.813) [-572.265] -- 0:01:54
155000 -- [-581.492] (-592.714) (-581.349) (-584.920) * (-582.453) (-581.179) [-574.527] (-578.820) -- 0:01:54
Average standard deviation of split frequencies: 0.018131
155500 -- (-580.657) (-592.658) (-583.829) [-583.613] * (-581.658) (-581.492) [-576.842] (-577.915) -- 0:01:54
156000 -- (-580.927) (-593.457) [-580.287] (-579.340) * (-583.677) (-587.973) (-584.797) [-576.051] -- 0:01:53
156500 -- (-580.644) (-585.787) (-585.985) [-580.373] * (-577.444) (-579.609) (-582.427) [-578.221] -- 0:01:58
157000 -- [-576.887] (-579.666) (-586.040) (-575.920) * (-582.022) (-578.047) (-581.681) [-578.235] -- 0:01:58
157500 -- (-578.800) (-580.695) [-589.948] (-578.886) * (-577.605) [-577.476] (-579.969) (-584.170) -- 0:01:57
158000 -- (-585.424) (-583.406) (-584.174) [-576.863] * [-578.204] (-579.910) (-582.084) (-583.718) -- 0:01:57
158500 -- [-579.954] (-576.356) (-594.637) (-574.837) * (-578.808) [-577.858] (-587.952) (-588.696) -- 0:01:56
159000 -- [-580.377] (-580.399) (-585.878) (-579.008) * [-577.427] (-577.549) (-585.019) (-587.703) -- 0:01:56
159500 -- (-580.196) (-579.939) (-583.240) [-580.875] * (-576.670) [-581.299] (-581.433) (-582.879) -- 0:01:55
160000 -- (-579.622) (-580.165) (-580.032) [-578.140] * [-578.967] (-585.183) (-582.216) (-574.502) -- 0:01:55
Average standard deviation of split frequencies: 0.016504
160500 -- (-583.673) (-579.882) (-591.573) [-579.775] * (-577.795) (-581.896) (-575.907) [-576.560] -- 0:01:55
161000 -- [-577.036] (-581.210) (-578.460) (-582.632) * [-577.186] (-587.410) (-579.313) (-580.032) -- 0:01:54
161500 -- (-583.817) (-581.831) (-585.805) [-576.166] * (-582.405) [-577.961] (-580.370) (-575.270) -- 0:01:54
162000 -- (-579.677) (-580.980) [-578.815] (-577.526) * (-583.833) (-576.201) (-580.820) [-580.353] -- 0:01:53
162500 -- (-581.106) [-575.969] (-579.241) (-578.560) * [-573.047] (-578.687) (-577.795) (-582.703) -- 0:01:53
163000 -- (-580.032) [-579.012] (-583.490) (-581.225) * [-576.753] (-579.430) (-579.989) (-579.029) -- 0:01:52
163500 -- (-577.784) [-577.974] (-585.565) (-577.358) * (-575.075) [-576.799] (-579.322) (-573.362) -- 0:01:57
164000 -- (-582.623) (-577.752) [-581.431] (-587.352) * (-585.548) (-578.603) (-579.737) [-578.212] -- 0:01:57
164500 -- (-580.003) (-575.920) (-577.499) [-581.554] * (-578.360) (-574.865) (-580.789) [-577.926] -- 0:01:56
165000 -- (-579.853) (-575.518) [-580.945] (-583.204) * [-581.564] (-579.249) (-582.723) (-576.768) -- 0:01:56
Average standard deviation of split frequencies: 0.016329
165500 -- (-580.815) [-576.578] (-578.975) (-581.867) * (-577.408) [-576.105] (-588.716) (-584.749) -- 0:01:55
166000 -- (-583.545) (-575.833) (-583.772) [-579.954] * (-582.554) [-579.249] (-583.367) (-580.448) -- 0:01:55
166500 -- [-577.616] (-580.235) (-575.286) (-586.088) * (-578.345) (-580.928) [-579.582] (-579.154) -- 0:01:55
167000 -- (-577.836) [-578.909] (-582.757) (-586.650) * [-579.707] (-581.272) (-576.157) (-573.798) -- 0:01:54
167500 -- (-576.860) (-580.660) (-577.183) [-587.651] * (-581.868) [-574.732] (-579.737) (-580.173) -- 0:01:54
168000 -- (-581.973) (-584.329) [-581.054] (-584.063) * (-580.868) (-578.651) [-574.369] (-583.367) -- 0:01:53
168500 -- (-579.144) (-581.608) [-579.236] (-585.048) * (-585.576) (-581.515) [-575.085] (-576.989) -- 0:01:53
169000 -- [-580.888] (-578.502) (-578.469) (-580.307) * (-579.271) [-580.438] (-578.381) (-574.784) -- 0:01:53
169500 -- (-579.121) (-582.202) (-581.573) [-577.685] * [-573.700] (-575.188) (-576.846) (-577.193) -- 0:01:52
170000 -- (-578.568) [-576.902] (-578.821) (-592.007) * [-578.628] (-577.299) (-583.370) (-576.970) -- 0:01:52
Average standard deviation of split frequencies: 0.015882
170500 -- (-582.510) (-582.073) [-578.710] (-577.656) * (-583.092) [-585.280] (-573.142) (-577.010) -- 0:01:51
171000 -- (-582.245) [-583.045] (-576.658) (-585.504) * (-576.143) [-578.509] (-574.267) (-583.760) -- 0:01:56
171500 -- [-581.154] (-578.117) (-577.618) (-582.723) * (-581.069) [-579.544] (-575.749) (-583.144) -- 0:01:55
172000 -- (-579.513) [-582.550] (-581.207) (-581.720) * (-584.228) [-576.307] (-575.798) (-579.659) -- 0:01:55
172500 -- (-573.752) [-575.561] (-578.208) (-580.147) * (-586.532) (-579.309) [-575.228] (-581.658) -- 0:01:55
173000 -- (-582.407) (-576.128) (-578.732) [-575.959] * (-587.790) [-577.384] (-576.021) (-581.748) -- 0:01:54
173500 -- [-577.547] (-579.081) (-576.669) (-585.284) * [-579.668] (-581.298) (-578.331) (-581.909) -- 0:01:54
174000 -- (-577.688) (-576.884) (-578.362) [-586.964] * (-579.943) (-576.012) (-574.246) [-583.343] -- 0:01:53
174500 -- [-580.881] (-575.305) (-576.735) (-582.197) * (-581.114) [-576.999] (-579.361) (-584.016) -- 0:01:53
175000 -- (-578.580) [-575.883] (-584.571) (-579.765) * (-581.636) (-578.731) (-581.337) [-579.113] -- 0:01:53
Average standard deviation of split frequencies: 0.015401
175500 -- (-582.331) (-577.874) [-579.858] (-580.921) * (-586.785) (-576.272) [-577.350] (-582.591) -- 0:01:52
176000 -- (-578.515) (-580.072) (-578.052) [-576.261] * (-584.333) [-576.704] (-581.773) (-575.813) -- 0:01:52
176500 -- [-583.302] (-579.319) (-586.063) (-579.175) * [-578.775] (-580.298) (-576.548) (-580.040) -- 0:01:51
177000 -- (-585.244) (-577.385) (-579.569) [-580.095] * [-581.132] (-583.584) (-578.902) (-583.550) -- 0:01:51
177500 -- (-577.834) (-574.343) (-578.010) [-579.726] * (-579.684) (-577.268) [-577.115] (-575.299) -- 0:01:51
178000 -- (-580.735) [-576.637] (-582.448) (-578.700) * (-574.619) (-573.814) [-576.179] (-583.030) -- 0:01:50
178500 -- [-577.647] (-584.007) (-580.181) (-579.235) * [-574.585] (-576.671) (-581.137) (-578.612) -- 0:01:55
179000 -- [-581.715] (-577.908) (-580.892) (-579.309) * [-577.994] (-573.966) (-590.050) (-581.420) -- 0:01:54
179500 -- (-587.692) (-581.133) (-578.354) [-582.291] * (-582.556) (-581.671) [-583.974] (-584.626) -- 0:01:54
180000 -- (-586.117) [-575.200] (-581.985) (-580.517) * (-581.578) (-587.016) (-579.394) [-582.159] -- 0:01:53
Average standard deviation of split frequencies: 0.016401
180500 -- (-575.304) [-578.773] (-581.360) (-580.993) * (-585.598) (-583.271) [-579.486] (-579.092) -- 0:01:53
181000 -- (-578.266) (-575.641) [-577.451] (-584.982) * [-578.459] (-582.548) (-574.012) (-581.030) -- 0:01:53
181500 -- (-581.857) (-576.196) [-574.749] (-580.357) * (-589.670) (-580.099) [-577.168] (-581.827) -- 0:01:52
182000 -- (-578.685) [-575.130] (-583.474) (-588.176) * (-593.962) (-581.135) [-576.232] (-578.152) -- 0:01:52
182500 -- [-582.245] (-575.620) (-578.983) (-585.555) * [-584.487] (-579.985) (-577.670) (-583.625) -- 0:01:51
183000 -- (-590.848) (-579.916) [-575.821] (-588.201) * (-581.419) (-576.431) [-577.317] (-581.640) -- 0:01:51
183500 -- (-582.250) (-578.037) (-574.731) [-588.222] * (-583.132) [-580.343] (-575.732) (-578.475) -- 0:01:51
184000 -- (-580.692) (-577.769) (-580.756) [-584.581] * (-582.066) (-577.550) (-575.050) [-578.997] -- 0:01:50
184500 -- (-588.304) (-578.086) (-577.112) [-576.503] * (-584.127) (-580.792) (-578.920) [-578.453] -- 0:01:50
185000 -- (-583.191) [-575.502] (-589.346) (-580.625) * (-583.123) (-578.572) [-577.375] (-581.613) -- 0:01:50
Average standard deviation of split frequencies: 0.015523
185500 -- (-590.078) (-585.658) (-580.090) [-581.313] * (-579.927) [-573.649] (-577.481) (-575.464) -- 0:01:54
186000 -- (-586.398) (-583.477) (-580.896) [-581.852] * (-578.813) (-588.078) (-578.741) [-575.727] -- 0:01:53
186500 -- [-580.500] (-587.518) (-579.941) (-581.079) * [-581.090] (-580.299) (-577.506) (-577.779) -- 0:01:53
187000 -- (-577.406) [-576.708] (-574.942) (-578.556) * [-576.552] (-581.533) (-581.817) (-579.922) -- 0:01:53
187500 -- (-579.575) [-578.703] (-577.890) (-581.066) * (-577.023) (-579.905) (-583.731) [-575.379] -- 0:01:52
188000 -- (-576.585) (-583.586) [-578.479] (-582.878) * (-580.214) (-581.429) [-583.403] (-582.987) -- 0:01:52
188500 -- [-577.985] (-587.114) (-578.175) (-583.675) * (-579.289) (-578.628) (-582.358) [-577.309] -- 0:01:51
189000 -- (-578.035) [-581.858] (-581.171) (-583.612) * (-581.404) (-583.728) (-578.464) [-580.016] -- 0:01:51
189500 -- [-574.952] (-587.945) (-580.560) (-575.836) * (-580.374) (-579.043) (-573.778) [-578.279] -- 0:01:51
190000 -- (-582.492) (-589.311) [-573.913] (-577.036) * [-577.238] (-576.438) (-581.287) (-578.925) -- 0:01:50
Average standard deviation of split frequencies: 0.015894
190500 -- [-580.757] (-581.409) (-580.536) (-577.481) * (-590.210) (-581.284) (-579.647) [-577.949] -- 0:01:50
191000 -- (-578.269) [-581.213] (-579.539) (-583.084) * (-580.845) (-582.383) (-576.930) [-577.332] -- 0:01:50
191500 -- (-578.546) (-585.980) [-579.123] (-582.128) * [-583.493] (-576.352) (-580.060) (-575.428) -- 0:01:49
192000 -- (-579.745) (-576.975) (-578.077) [-577.124] * [-575.379] (-578.849) (-583.340) (-585.324) -- 0:01:49
192500 -- (-580.847) (-577.074) (-582.666) [-579.298] * [-578.839] (-577.485) (-580.148) (-582.215) -- 0:01:49
193000 -- [-575.870] (-574.515) (-580.542) (-579.101) * [-585.091] (-581.199) (-586.814) (-594.525) -- 0:01:52
193500 -- (-579.413) [-582.808] (-583.116) (-581.940) * (-577.169) (-586.141) (-586.447) [-588.433] -- 0:01:52
194000 -- [-576.277] (-581.555) (-583.060) (-581.239) * [-579.956] (-579.210) (-580.147) (-586.837) -- 0:01:52
194500 -- (-585.042) (-577.880) [-578.911] (-576.614) * (-584.220) [-577.577] (-580.677) (-579.552) -- 0:01:51
195000 -- (-586.019) [-579.387] (-577.959) (-585.073) * [-585.647] (-573.732) (-575.369) (-580.978) -- 0:01:51
Average standard deviation of split frequencies: 0.015032
195500 -- (-583.995) (-579.144) [-578.128] (-585.027) * [-580.853] (-580.729) (-583.062) (-576.766) -- 0:01:51
196000 -- (-582.607) (-579.548) (-576.913) [-576.780] * (-578.656) (-577.199) [-583.442] (-582.144) -- 0:01:50
196500 -- (-576.787) (-594.832) [-574.112] (-581.679) * (-588.445) [-580.863] (-587.762) (-582.237) -- 0:01:50
197000 -- (-581.430) (-590.091) (-579.078) [-579.097] * [-585.301] (-584.484) (-589.495) (-581.331) -- 0:01:50
197500 -- (-583.677) (-579.419) (-576.040) [-575.427] * [-576.443] (-583.489) (-583.229) (-579.603) -- 0:01:49
198000 -- (-584.771) (-590.488) [-582.121] (-577.800) * (-575.193) (-582.172) [-577.245] (-579.206) -- 0:01:49
198500 -- (-577.981) (-578.025) [-580.326] (-579.557) * (-573.775) [-578.902] (-585.478) (-590.166) -- 0:01:49
199000 -- (-576.003) [-576.567] (-581.743) (-578.396) * (-576.476) (-581.319) (-582.005) [-578.415] -- 0:01:48
199500 -- (-574.839) [-583.984] (-579.336) (-574.394) * (-578.966) (-578.050) (-579.909) [-575.323] -- 0:01:48
200000 -- (-581.232) (-581.068) (-581.271) [-576.149] * (-583.200) (-583.983) (-579.380) [-578.064] -- 0:01:48
Average standard deviation of split frequencies: 0.018122
200500 -- (-577.228) (-575.845) (-582.746) [-575.426] * (-576.700) (-578.466) (-581.238) [-579.276] -- 0:01:51
201000 -- (-577.830) (-574.933) (-579.769) [-575.065] * [-579.094] (-576.635) (-581.896) (-577.307) -- 0:01:51
201500 -- [-575.510] (-578.809) (-577.002) (-576.120) * (-591.169) (-577.647) (-578.497) [-581.286] -- 0:01:50
202000 -- [-576.820] (-577.350) (-575.593) (-588.141) * (-581.196) (-581.948) (-579.695) [-581.273] -- 0:01:50
202500 -- (-575.121) [-573.487] (-576.472) (-579.595) * [-582.350] (-573.772) (-578.694) (-580.109) -- 0:01:50
203000 -- (-577.684) [-573.473] (-578.556) (-581.714) * [-582.331] (-579.467) (-575.035) (-581.991) -- 0:01:49
203500 -- (-575.887) [-585.438] (-586.239) (-576.885) * (-580.723) (-580.918) (-580.439) [-576.755] -- 0:01:49
204000 -- [-581.894] (-580.049) (-576.929) (-582.498) * [-579.386] (-576.376) (-576.989) (-578.767) -- 0:01:49
204500 -- (-579.283) (-581.679) (-582.721) [-584.235] * (-579.512) [-577.699] (-577.557) (-578.730) -- 0:01:48
205000 -- (-578.456) [-578.315] (-592.395) (-579.379) * (-582.039) (-578.200) [-577.859] (-584.336) -- 0:01:48
Average standard deviation of split frequencies: 0.018307
205500 -- (-575.311) [-580.325] (-582.784) (-579.557) * (-582.246) (-577.504) [-576.627] (-580.013) -- 0:01:48
206000 -- (-584.104) [-577.691] (-575.953) (-588.919) * (-584.817) [-580.400] (-586.205) (-578.612) -- 0:01:47
206500 -- (-579.785) (-577.135) (-579.735) [-576.260] * (-581.666) [-575.107] (-579.530) (-586.003) -- 0:01:47
207000 -- (-581.101) (-579.192) (-579.940) [-582.235] * (-582.230) (-579.717) [-576.668] (-585.379) -- 0:01:47
207500 -- (-580.672) (-579.116) [-579.425] (-580.891) * (-578.616) [-578.995] (-576.471) (-582.841) -- 0:01:50
208000 -- [-579.209] (-583.427) (-581.787) (-577.825) * (-581.115) (-586.539) [-576.527] (-587.280) -- 0:01:50
208500 -- (-577.835) (-578.305) [-575.199] (-577.176) * [-584.878] (-581.576) (-578.065) (-584.631) -- 0:01:50
209000 -- (-577.583) [-577.026] (-584.539) (-577.201) * (-577.906) (-581.715) (-584.134) [-578.087] -- 0:01:49
209500 -- (-576.447) (-576.687) (-578.051) [-579.008] * (-583.849) [-590.466] (-577.381) (-577.824) -- 0:01:49
210000 -- (-579.767) (-585.743) [-579.244] (-580.912) * [-576.508] (-584.263) (-576.034) (-585.793) -- 0:01:49
Average standard deviation of split frequencies: 0.018181
210500 -- (-578.846) (-575.760) [-580.983] (-577.399) * (-578.725) (-579.174) [-583.046] (-578.296) -- 0:01:48
211000 -- [-579.789] (-583.389) (-582.086) (-580.039) * (-573.829) [-580.960] (-582.649) (-578.232) -- 0:01:48
211500 -- (-581.891) (-582.889) (-577.247) [-575.847] * (-584.220) (-583.031) (-582.585) [-579.811] -- 0:01:48
212000 -- (-579.159) [-581.915] (-576.351) (-581.944) * [-578.803] (-581.945) (-577.049) (-577.629) -- 0:01:47
212500 -- (-580.512) (-575.672) (-580.626) [-574.459] * (-578.008) (-581.568) [-575.237] (-579.648) -- 0:01:47
213000 -- (-577.476) (-576.048) [-579.668] (-581.814) * [-574.972] (-578.863) (-579.445) (-579.806) -- 0:01:47
213500 -- [-577.709] (-583.064) (-579.026) (-581.726) * (-578.567) (-579.902) [-575.573] (-578.529) -- 0:01:46
214000 -- (-588.079) (-580.099) (-582.947) [-577.600] * (-576.184) (-577.400) [-575.641] (-578.814) -- 0:01:46
214500 -- (-574.488) [-577.403] (-579.952) (-574.619) * [-576.557] (-577.431) (-576.791) (-579.872) -- 0:01:46
215000 -- (-574.425) (-579.755) (-577.775) [-578.131] * (-585.336) [-578.349] (-578.972) (-582.454) -- 0:01:49
Average standard deviation of split frequencies: 0.017148
215500 -- (-582.686) (-580.277) (-578.645) [-586.738] * (-579.620) (-576.164) [-574.153] (-586.322) -- 0:01:49
216000 -- [-577.048] (-578.999) (-576.292) (-586.192) * (-579.442) [-574.302] (-576.401) (-591.025) -- 0:01:48
216500 -- (-577.967) (-578.790) (-578.212) [-577.380] * (-580.031) [-579.903] (-580.819) (-580.454) -- 0:01:48
217000 -- (-575.204) (-577.117) [-574.018] (-576.978) * [-581.060] (-579.000) (-579.892) (-578.759) -- 0:01:48
217500 -- (-576.792) (-576.484) [-574.992] (-579.363) * (-579.886) (-575.552) [-586.770] (-584.971) -- 0:01:47
218000 -- (-574.711) (-578.396) (-578.428) [-579.513] * [-578.832] (-576.549) (-579.060) (-581.888) -- 0:01:47
218500 -- (-578.865) (-576.445) [-576.893] (-582.665) * (-587.071) (-577.944) [-578.238] (-580.711) -- 0:01:47
219000 -- (-574.864) [-581.209] (-586.489) (-574.658) * (-582.728) (-575.571) [-580.697] (-575.562) -- 0:01:46
219500 -- (-578.761) [-582.036] (-578.366) (-579.557) * (-579.968) (-575.731) (-579.727) [-579.038] -- 0:01:46
220000 -- (-574.990) [-583.325] (-581.380) (-579.785) * (-577.839) (-582.854) (-583.440) [-585.182] -- 0:01:46
Average standard deviation of split frequencies: 0.019532
220500 -- (-578.014) (-587.994) (-578.684) [-577.881] * (-580.326) (-587.032) [-579.668] (-579.105) -- 0:01:46
221000 -- (-578.693) [-582.940] (-581.087) (-584.905) * (-578.541) (-577.571) (-585.785) [-577.381] -- 0:01:45
221500 -- (-585.318) (-586.923) (-578.915) [-576.966] * (-584.084) (-585.734) [-580.622] (-584.453) -- 0:01:45
222000 -- (-575.983) (-577.815) [-580.885] (-578.211) * [-577.193] (-582.972) (-578.441) (-583.612) -- 0:01:45
222500 -- [-576.870] (-579.114) (-583.303) (-582.369) * (-579.271) [-578.926] (-579.450) (-581.899) -- 0:01:48
223000 -- (-578.729) (-578.029) (-584.071) [-579.757] * (-586.291) (-577.692) [-578.429] (-579.824) -- 0:01:48
223500 -- (-581.273) [-582.170] (-576.456) (-578.124) * (-582.978) (-581.054) [-577.403] (-584.705) -- 0:01:47
224000 -- (-578.087) [-582.919] (-579.449) (-588.158) * (-585.764) (-578.211) [-579.322] (-585.747) -- 0:01:47
224500 -- [-577.796] (-584.300) (-576.688) (-579.826) * (-583.369) [-577.172] (-580.880) (-585.862) -- 0:01:47
225000 -- (-582.906) (-577.346) (-577.450) [-576.536] * (-581.444) (-578.440) [-582.004] (-588.096) -- 0:01:46
Average standard deviation of split frequencies: 0.018177
225500 -- (-576.796) (-579.063) [-581.716] (-576.380) * (-580.868) (-578.700) (-583.453) [-578.129] -- 0:01:46
226000 -- [-578.978] (-582.218) (-582.736) (-573.054) * (-587.096) [-579.001] (-579.482) (-583.133) -- 0:01:46
226500 -- (-578.282) [-579.631] (-578.817) (-575.043) * (-585.931) (-580.065) (-576.219) [-584.140] -- 0:01:45
227000 -- [-575.691] (-579.574) (-579.569) (-574.556) * (-585.471) (-578.324) [-582.794] (-587.081) -- 0:01:45
227500 -- (-582.639) (-580.106) [-582.449] (-578.614) * (-589.263) [-575.922] (-587.544) (-587.315) -- 0:01:45
228000 -- (-587.433) (-579.031) [-577.142] (-580.368) * (-589.044) [-582.786] (-582.484) (-592.474) -- 0:01:44
228500 -- (-579.527) [-578.407] (-574.110) (-574.792) * (-584.811) [-577.221] (-579.515) (-588.703) -- 0:01:44
229000 -- (-581.116) [-578.162] (-578.489) (-580.189) * (-577.994) [-583.378] (-585.284) (-584.670) -- 0:01:44
229500 -- [-582.221] (-578.272) (-582.475) (-581.006) * (-580.946) (-585.858) (-577.360) [-584.801] -- 0:01:47
230000 -- (-581.107) (-576.649) [-579.919] (-578.359) * [-579.138] (-579.504) (-575.733) (-584.471) -- 0:01:47
Average standard deviation of split frequencies: 0.015765
230500 -- (-578.184) (-579.714) (-578.178) [-577.845] * (-585.984) (-579.570) [-576.956] (-581.877) -- 0:01:46
231000 -- (-586.649) (-582.715) (-579.831) [-573.939] * (-579.287) [-577.526] (-581.241) (-593.194) -- 0:01:46
231500 -- (-580.472) (-581.583) [-578.235] (-579.709) * [-574.627] (-577.971) (-581.556) (-590.852) -- 0:01:46
232000 -- (-578.530) [-583.839] (-579.511) (-576.717) * (-578.225) [-574.913] (-577.403) (-590.630) -- 0:01:45
232500 -- (-583.290) (-580.057) (-586.425) [-575.669] * (-575.181) [-574.688] (-579.208) (-584.984) -- 0:01:45
233000 -- [-576.936] (-581.628) (-584.716) (-584.317) * (-575.207) (-575.199) (-579.608) [-582.020] -- 0:01:45
233500 -- (-586.594) [-577.386] (-581.120) (-575.928) * (-576.707) [-576.160] (-580.566) (-581.549) -- 0:01:45
234000 -- (-576.806) [-574.672] (-577.722) (-576.081) * [-580.612] (-576.764) (-583.918) (-585.720) -- 0:01:44
234500 -- (-574.655) (-581.314) [-577.677] (-579.796) * [-573.256] (-579.667) (-583.461) (-589.071) -- 0:01:44
235000 -- [-578.625] (-579.411) (-579.432) (-581.958) * (-582.050) [-576.750] (-586.809) (-589.384) -- 0:01:44
Average standard deviation of split frequencies: 0.016551
235500 -- (-576.917) (-578.684) [-581.311] (-587.365) * [-581.807] (-577.243) (-582.092) (-582.732) -- 0:01:43
236000 -- (-583.369) (-583.262) (-579.766) [-578.128] * (-578.561) [-579.252] (-578.776) (-584.421) -- 0:01:43
236500 -- [-579.556] (-585.741) (-578.999) (-581.299) * (-579.141) (-577.999) [-576.969] (-583.666) -- 0:01:43
237000 -- (-578.891) (-577.787) [-578.720] (-583.675) * [-582.851] (-575.801) (-580.977) (-579.854) -- 0:01:46
237500 -- (-575.037) (-578.359) (-581.868) [-578.607] * (-581.971) [-580.110] (-574.687) (-578.963) -- 0:01:45
238000 -- (-578.180) (-580.271) [-576.784] (-581.087) * (-581.760) (-576.882) (-577.667) [-581.510] -- 0:01:45
238500 -- [-580.542] (-575.644) (-578.705) (-579.797) * (-585.401) (-572.356) [-577.004] (-586.536) -- 0:01:45
239000 -- (-584.054) [-577.568] (-580.251) (-578.297) * (-577.416) (-584.046) (-578.646) [-583.215] -- 0:01:45
239500 -- (-583.853) [-575.641] (-582.222) (-585.784) * (-578.115) (-581.094) (-578.235) [-575.854] -- 0:01:44
240000 -- (-574.415) [-576.076] (-575.964) (-585.786) * (-575.683) [-577.838] (-577.230) (-575.272) -- 0:01:44
Average standard deviation of split frequencies: 0.019308
240500 -- [-574.909] (-578.066) (-578.602) (-582.815) * (-589.103) (-578.010) (-576.030) [-577.187] -- 0:01:44
241000 -- (-580.382) (-574.177) [-574.285] (-585.926) * (-579.827) [-581.491] (-585.016) (-576.813) -- 0:01:43
241500 -- (-580.935) (-579.333) [-574.842] (-583.321) * (-582.005) (-575.761) [-578.909] (-582.851) -- 0:01:43
242000 -- (-575.860) [-577.404] (-583.487) (-579.586) * (-577.914) (-575.928) [-578.095] (-581.158) -- 0:01:43
242500 -- (-582.889) (-577.218) [-578.366] (-580.655) * (-572.774) (-585.013) [-575.585] (-580.459) -- 0:01:43
243000 -- (-577.655) (-578.728) (-575.730) [-574.952] * (-579.186) [-579.241] (-574.917) (-575.044) -- 0:01:42
243500 -- (-574.799) (-577.246) [-578.850] (-578.742) * (-575.584) (-583.104) (-580.411) [-577.893] -- 0:01:42
244000 -- (-587.219) (-581.024) [-580.724] (-577.288) * (-580.610) (-583.113) (-581.034) [-578.212] -- 0:01:42
244500 -- [-578.465] (-580.146) (-576.050) (-576.250) * (-581.220) [-577.735] (-579.156) (-579.579) -- 0:01:45
245000 -- (-574.954) [-577.802] (-587.328) (-577.577) * (-581.452) [-577.299] (-582.708) (-578.250) -- 0:01:44
Average standard deviation of split frequencies: 0.018615
245500 -- (-578.172) [-577.613] (-578.992) (-581.328) * (-578.405) [-582.078] (-580.963) (-585.872) -- 0:01:44
246000 -- [-580.445] (-581.729) (-578.648) (-580.299) * [-576.478] (-581.514) (-586.480) (-579.423) -- 0:01:44
246500 -- [-582.767] (-580.121) (-577.302) (-580.388) * (-584.195) (-581.056) [-579.298] (-581.372) -- 0:01:43
247000 -- (-589.033) (-575.616) (-579.069) [-577.284] * [-577.014] (-588.629) (-578.757) (-583.192) -- 0:01:43
247500 -- [-586.987] (-580.803) (-580.260) (-581.868) * [-579.440] (-577.781) (-582.794) (-583.474) -- 0:01:43
248000 -- (-582.860) (-584.076) [-573.593] (-580.735) * [-581.597] (-594.954) (-581.500) (-583.105) -- 0:01:43
248500 -- (-583.143) (-577.491) (-578.063) [-577.997] * (-579.848) (-579.473) (-578.545) [-581.975] -- 0:01:42
249000 -- (-581.084) (-577.239) [-576.870] (-583.509) * (-587.936) (-585.568) (-578.847) [-576.531] -- 0:01:42
249500 -- (-578.383) [-575.484] (-584.204) (-584.235) * (-589.221) (-591.132) [-573.752] (-583.660) -- 0:01:42
250000 -- (-579.393) (-577.172) (-581.233) [-576.522] * (-585.431) [-582.721] (-575.523) (-586.409) -- 0:01:42
Average standard deviation of split frequencies: 0.017194
250500 -- (-585.533) (-575.951) (-584.095) [-581.202] * (-581.325) [-581.347] (-574.847) (-577.003) -- 0:01:41
251000 -- (-578.168) [-580.107] (-578.582) (-575.206) * [-582.338] (-584.646) (-584.684) (-580.476) -- 0:01:41
251500 -- (-580.905) (-578.289) (-585.967) [-575.510] * (-585.258) (-580.089) (-576.519) [-578.627] -- 0:01:41
252000 -- (-582.200) [-574.864] (-582.892) (-578.619) * [-583.896] (-587.317) (-579.435) (-580.160) -- 0:01:43
252500 -- (-582.335) [-580.256] (-586.541) (-576.758) * (-579.499) (-584.866) (-577.878) [-579.971] -- 0:01:43
253000 -- (-578.087) [-578.145] (-580.803) (-576.540) * (-590.432) (-578.837) [-578.913] (-577.631) -- 0:01:43
253500 -- (-576.971) (-579.021) (-582.669) [-576.463] * (-583.691) (-577.225) (-579.080) [-580.481] -- 0:01:43
254000 -- (-579.846) (-579.634) (-578.087) [-575.593] * (-585.506) [-576.546] (-575.887) (-577.003) -- 0:01:42
254500 -- [-575.714] (-579.391) (-588.089) (-580.740) * (-590.027) [-575.330] (-580.601) (-582.737) -- 0:01:42
255000 -- (-577.147) (-580.250) (-588.715) [-583.593] * (-587.005) (-577.255) (-584.170) [-585.887] -- 0:01:42
Average standard deviation of split frequencies: 0.017099
255500 -- (-580.148) (-585.389) (-582.109) [-574.662] * [-584.540] (-578.174) (-586.267) (-591.114) -- 0:01:41
256000 -- (-580.733) (-578.067) (-585.697) [-573.814] * (-587.877) (-582.806) [-580.069] (-582.535) -- 0:01:41
256500 -- (-586.069) [-578.302] (-584.777) (-583.529) * (-582.930) (-577.315) [-582.181] (-584.167) -- 0:01:41
257000 -- (-583.900) (-577.840) (-580.665) [-577.075] * [-587.349] (-583.250) (-576.183) (-585.601) -- 0:01:41
257500 -- (-575.516) [-578.388] (-584.133) (-584.061) * (-588.683) (-576.723) (-580.875) [-578.229] -- 0:01:40
258000 -- (-578.867) (-581.290) (-579.587) [-579.707] * (-582.787) (-585.407) (-577.570) [-577.790] -- 0:01:40
258500 -- (-585.341) (-577.631) (-577.915) [-578.631] * (-584.982) [-581.863] (-577.643) (-580.597) -- 0:01:40
259000 -- (-586.377) (-576.283) [-580.093] (-574.312) * (-586.303) (-591.236) [-578.836] (-583.388) -- 0:01:40
259500 -- (-581.603) (-580.654) (-581.120) [-580.337] * (-581.877) (-587.151) (-572.224) [-576.419] -- 0:01:42
260000 -- (-584.999) [-584.205] (-581.784) (-581.382) * (-581.599) (-578.980) (-576.150) [-575.435] -- 0:01:42
Average standard deviation of split frequencies: 0.017310
260500 -- (-582.432) (-582.055) [-578.379] (-583.459) * [-580.057] (-581.272) (-576.538) (-582.929) -- 0:01:42
261000 -- (-580.418) (-575.494) (-581.112) [-581.398] * (-580.200) (-580.366) (-575.153) [-583.513] -- 0:01:41
261500 -- [-576.680] (-580.663) (-587.547) (-580.670) * (-580.972) (-582.487) (-586.875) [-579.566] -- 0:01:41
262000 -- (-582.192) [-577.564] (-582.772) (-587.155) * (-576.183) (-577.272) (-576.762) [-576.949] -- 0:01:41
262500 -- [-577.043] (-577.913) (-578.897) (-578.227) * [-574.020] (-580.141) (-579.421) (-581.664) -- 0:01:41
263000 -- (-581.850) [-576.925] (-582.607) (-582.359) * (-575.012) [-580.769] (-584.671) (-576.936) -- 0:01:40
263500 -- [-583.319] (-575.830) (-585.587) (-582.048) * [-580.722] (-585.288) (-578.582) (-582.175) -- 0:01:40
264000 -- (-587.787) [-578.141] (-586.734) (-578.186) * [-574.435] (-577.589) (-576.927) (-582.376) -- 0:01:40
264500 -- (-582.968) [-577.314] (-584.094) (-576.472) * [-575.065] (-581.132) (-580.417) (-580.760) -- 0:01:40
265000 -- (-586.768) [-575.268] (-583.334) (-576.212) * (-581.801) (-581.028) (-580.544) [-576.829] -- 0:01:39
Average standard deviation of split frequencies: 0.017722
265500 -- (-577.825) (-579.063) [-586.883] (-579.234) * (-583.072) [-579.693] (-578.819) (-577.588) -- 0:01:39
266000 -- (-583.216) (-581.413) (-581.305) [-579.252] * (-580.597) (-585.887) [-575.489] (-582.615) -- 0:01:39
266500 -- (-578.787) (-583.744) [-581.167] (-577.438) * (-576.549) (-583.954) [-575.479] (-578.719) -- 0:01:41
267000 -- (-577.599) (-573.658) (-581.940) [-578.189] * (-579.878) [-581.540] (-579.688) (-576.562) -- 0:01:41
267500 -- (-577.265) (-581.553) [-583.772] (-579.950) * (-582.744) [-578.876] (-578.483) (-581.914) -- 0:01:41
268000 -- (-578.649) (-582.012) [-578.488] (-577.175) * [-580.255] (-583.467) (-578.921) (-587.384) -- 0:01:41
268500 -- (-573.354) (-586.217) [-579.536] (-579.928) * (-580.825) (-582.889) (-585.321) [-576.132] -- 0:01:40
269000 -- (-578.125) (-580.500) [-574.786] (-579.405) * (-580.442) [-583.603] (-588.097) (-577.666) -- 0:01:40
269500 -- [-574.513] (-582.936) (-573.887) (-579.109) * (-576.357) (-584.550) [-577.548] (-582.186) -- 0:01:40
270000 -- (-580.916) (-580.151) (-576.212) [-580.946] * [-574.626] (-577.025) (-583.438) (-580.448) -- 0:01:40
Average standard deviation of split frequencies: 0.016919
270500 -- [-583.488] (-582.569) (-585.223) (-577.740) * (-577.179) [-580.104] (-584.545) (-579.444) -- 0:01:39
271000 -- (-590.630) [-582.678] (-585.879) (-579.049) * (-586.182) [-579.536] (-582.057) (-576.739) -- 0:01:39
271500 -- (-586.733) (-585.517) [-577.104] (-579.367) * [-577.749] (-579.361) (-582.628) (-581.704) -- 0:01:39
272000 -- (-591.281) [-582.620] (-580.169) (-578.406) * [-574.857] (-577.543) (-584.680) (-578.968) -- 0:01:39
272500 -- (-578.141) (-585.019) (-582.122) [-577.910] * (-577.741) [-578.312] (-581.317) (-581.217) -- 0:01:38
273000 -- (-582.167) [-579.742] (-585.449) (-574.094) * (-580.223) (-580.293) (-578.720) [-580.768] -- 0:01:38
273500 -- [-580.797] (-580.241) (-579.305) (-578.235) * (-585.463) (-576.550) [-577.461] (-578.961) -- 0:01:38
274000 -- (-578.627) (-582.856) [-579.132] (-584.253) * [-576.259] (-581.751) (-581.140) (-581.721) -- 0:01:40
274500 -- (-579.978) [-577.761] (-584.899) (-579.494) * (-578.470) (-587.893) [-579.218] (-576.226) -- 0:01:40
275000 -- (-580.028) (-579.129) [-580.182] (-577.101) * (-581.094) (-580.881) (-580.292) [-585.009] -- 0:01:40
Average standard deviation of split frequencies: 0.015860
275500 -- (-578.456) [-581.329] (-580.176) (-580.391) * (-580.424) (-577.886) [-579.215] (-577.859) -- 0:01:39
276000 -- (-579.299) [-572.342] (-579.268) (-580.753) * (-577.892) (-578.985) [-578.265] (-582.500) -- 0:01:39
276500 -- (-580.328) (-578.991) [-583.814] (-580.606) * (-576.982) (-581.303) (-577.215) [-577.412] -- 0:01:39
277000 -- (-578.106) (-579.532) (-580.148) [-579.582] * (-580.452) (-580.524) [-578.185] (-577.453) -- 0:01:39
277500 -- (-577.288) [-575.060] (-582.553) (-577.215) * (-578.656) (-582.984) [-577.991] (-580.983) -- 0:01:38
278000 -- (-580.277) (-578.760) [-574.170] (-577.958) * [-574.745] (-581.803) (-582.330) (-580.995) -- 0:01:38
278500 -- (-575.582) (-585.856) [-579.143] (-577.544) * (-574.434) [-580.462] (-579.790) (-582.139) -- 0:01:38
279000 -- (-583.047) (-580.037) [-578.749] (-580.267) * [-575.060] (-579.902) (-582.549) (-582.069) -- 0:01:38
279500 -- [-578.747] (-585.183) (-580.157) (-578.960) * (-579.294) [-581.035] (-582.507) (-582.857) -- 0:01:37
280000 -- [-580.558] (-580.935) (-578.438) (-580.010) * [-576.437] (-578.725) (-590.387) (-581.051) -- 0:01:37
Average standard deviation of split frequencies: 0.016076
280500 -- (-581.793) (-585.280) (-580.751) [-576.886] * (-577.477) (-577.001) [-578.646] (-577.949) -- 0:01:37
281000 -- [-577.232] (-583.643) (-582.954) (-578.163) * (-576.028) [-577.940] (-584.763) (-581.436) -- 0:01:37
281500 -- (-577.073) (-580.372) [-579.201] (-579.127) * (-584.528) [-577.460] (-578.576) (-578.383) -- 0:01:39
282000 -- [-579.049] (-580.673) (-578.824) (-578.819) * (-577.750) (-581.201) (-587.379) [-582.522] -- 0:01:39
282500 -- (-574.128) (-584.494) (-584.639) [-578.215] * (-579.251) (-574.158) [-581.929] (-581.203) -- 0:01:39
283000 -- (-581.902) [-583.875] (-581.938) (-581.277) * [-576.488] (-577.988) (-584.433) (-578.840) -- 0:01:38
283500 -- [-579.796] (-587.275) (-582.480) (-580.677) * [-575.655] (-578.075) (-582.014) (-577.868) -- 0:01:38
284000 -- [-578.714] (-578.864) (-574.305) (-579.394) * (-581.356) [-577.862] (-583.042) (-583.734) -- 0:01:38
284500 -- (-578.435) (-581.061) (-577.015) [-578.508] * (-579.405) (-582.405) [-579.188] (-579.249) -- 0:01:38
285000 -- (-576.058) [-581.749] (-574.441) (-582.513) * (-576.518) (-578.887) (-587.151) [-578.841] -- 0:01:37
Average standard deviation of split frequencies: 0.015305
285500 -- [-582.025] (-579.812) (-576.827) (-588.911) * (-578.704) (-576.971) (-578.001) [-575.577] -- 0:01:37
286000 -- [-576.841] (-580.879) (-581.946) (-580.400) * (-577.640) (-582.090) (-577.350) [-586.877] -- 0:01:37
286500 -- (-578.150) (-583.997) (-574.538) [-578.093] * [-583.085] (-585.866) (-591.414) (-582.182) -- 0:01:37
287000 -- [-579.450] (-582.118) (-573.381) (-581.164) * [-582.826] (-586.885) (-577.208) (-576.476) -- 0:01:36
287500 -- (-581.788) (-580.249) [-575.119] (-584.569) * (-579.610) (-583.515) (-579.289) [-575.833] -- 0:01:36
288000 -- [-582.439] (-575.818) (-578.304) (-576.638) * (-577.351) (-585.086) (-586.240) [-577.486] -- 0:01:36
288500 -- (-587.642) (-580.003) (-579.640) [-579.309] * (-574.990) (-580.122) (-581.566) [-577.948] -- 0:01:38
289000 -- (-579.850) [-579.281] (-585.617) (-581.454) * (-580.129) (-586.956) [-578.074] (-576.431) -- 0:01:38
289500 -- (-574.211) (-580.887) [-581.694] (-574.471) * [-575.355] (-578.146) (-582.177) (-575.827) -- 0:01:38
290000 -- (-577.577) (-582.087) [-586.002] (-581.330) * (-575.696) (-579.310) (-580.072) [-580.424] -- 0:01:37
Average standard deviation of split frequencies: 0.016450
290500 -- (-578.024) (-580.022) [-582.029] (-580.111) * (-578.519) [-581.701] (-576.974) (-581.477) -- 0:01:37
291000 -- (-580.820) [-578.741] (-589.846) (-580.334) * (-588.422) (-577.776) [-580.787] (-580.746) -- 0:01:37
291500 -- (-584.895) (-588.119) [-583.524] (-579.803) * (-579.921) [-577.691] (-580.979) (-583.484) -- 0:01:37
292000 -- (-584.338) (-580.488) (-582.054) [-575.053] * [-576.013] (-586.849) (-581.424) (-583.582) -- 0:01:36
292500 -- (-581.122) [-577.253] (-585.162) (-585.241) * [-578.003] (-582.568) (-576.847) (-582.067) -- 0:01:36
293000 -- (-581.695) [-577.732] (-581.118) (-585.830) * (-579.395) (-583.012) [-578.229] (-582.332) -- 0:01:36
293500 -- (-581.836) [-582.094] (-578.506) (-587.739) * (-576.873) (-580.292) (-581.778) [-584.820] -- 0:01:36
294000 -- (-587.381) (-577.460) [-582.578] (-577.663) * (-578.563) (-580.482) [-582.378] (-581.660) -- 0:01:36
294500 -- (-579.370) (-575.993) (-581.962) [-576.376] * (-580.094) (-583.971) (-578.348) [-576.595] -- 0:01:35
295000 -- (-578.934) (-585.925) (-580.485) [-575.343] * (-582.459) [-577.629] (-579.639) (-580.290) -- 0:01:35
Average standard deviation of split frequencies: 0.018428
295500 -- (-581.133) (-579.711) [-580.172] (-579.758) * (-584.139) (-582.661) [-574.637] (-581.908) -- 0:01:35
296000 -- (-579.379) [-580.554] (-586.615) (-586.065) * (-587.240) (-583.444) [-580.624] (-579.684) -- 0:01:37
296500 -- (-583.900) (-579.644) (-576.275) [-582.285] * (-581.997) (-581.159) [-578.727] (-581.872) -- 0:01:37
297000 -- (-580.562) (-577.212) (-577.840) [-580.494] * (-581.002) (-583.308) [-579.208] (-585.428) -- 0:01:37
297500 -- (-579.180) [-574.237] (-580.417) (-584.795) * [-579.607] (-580.438) (-575.593) (-583.220) -- 0:01:36
298000 -- (-578.309) (-572.401) [-576.872] (-579.708) * (-583.714) (-581.863) [-581.270] (-584.017) -- 0:01:36
298500 -- [-576.952] (-577.943) (-576.608) (-576.820) * [-585.721] (-577.737) (-576.435) (-585.737) -- 0:01:36
299000 -- [-576.970] (-576.619) (-580.652) (-579.220) * [-581.805] (-578.533) (-578.799) (-584.696) -- 0:01:36
299500 -- (-581.696) [-580.347] (-577.678) (-580.209) * (-583.541) [-574.238] (-581.147) (-578.501) -- 0:01:35
300000 -- (-582.715) [-579.254] (-582.527) (-584.124) * (-579.626) (-576.184) (-579.572) [-579.303] -- 0:01:35
Average standard deviation of split frequencies: 0.016127
300500 -- [-578.338] (-580.808) (-582.959) (-580.732) * (-578.132) (-595.096) (-578.798) [-579.432] -- 0:01:35
301000 -- (-577.494) [-581.868] (-585.836) (-579.488) * (-586.866) (-575.573) [-581.762] (-580.585) -- 0:01:35
301500 -- (-583.003) (-579.731) (-577.798) [-579.504] * (-580.849) (-579.512) [-576.850] (-574.001) -- 0:01:34
302000 -- (-580.696) (-578.526) [-575.399] (-578.879) * (-584.854) [-580.266] (-578.930) (-580.217) -- 0:01:34
302500 -- (-575.671) (-583.539) [-574.726] (-577.456) * (-587.290) (-578.134) (-581.518) [-578.119] -- 0:01:34
303000 -- (-584.287) (-579.742) (-579.738) [-573.840] * (-582.612) [-574.392] (-577.849) (-580.280) -- 0:01:34
303500 -- (-578.375) (-575.057) [-576.931] (-580.438) * (-586.365) (-574.655) [-575.559] (-580.790) -- 0:01:36
304000 -- (-581.070) (-578.946) (-576.253) [-576.569] * (-582.467) [-577.679] (-578.019) (-583.135) -- 0:01:36
304500 -- (-576.662) [-579.729] (-574.690) (-581.853) * (-582.104) (-583.886) (-577.621) [-579.511] -- 0:01:35
305000 -- [-579.781] (-583.320) (-576.248) (-578.414) * (-584.880) (-577.183) (-578.640) [-581.264] -- 0:01:35
Average standard deviation of split frequencies: 0.016726
305500 -- (-577.459) (-579.117) (-580.391) [-579.138] * (-585.956) (-579.455) (-578.878) [-576.515] -- 0:01:35
306000 -- [-572.915] (-584.738) (-583.260) (-583.546) * (-578.660) [-580.796] (-577.971) (-579.599) -- 0:01:35
306500 -- [-577.311] (-588.228) (-585.024) (-575.295) * [-580.265] (-575.093) (-577.849) (-580.734) -- 0:01:35
307000 -- [-577.028] (-589.748) (-577.662) (-578.999) * (-584.498) (-580.115) [-577.449] (-581.200) -- 0:01:34
307500 -- (-577.605) (-578.965) [-577.360] (-577.057) * (-579.263) (-578.428) [-576.642] (-583.632) -- 0:01:34
308000 -- [-577.567] (-584.152) (-582.997) (-579.271) * [-577.808] (-584.527) (-582.235) (-587.285) -- 0:01:34
308500 -- (-582.385) (-582.870) (-575.202) [-582.618] * [-580.147] (-590.521) (-582.204) (-579.487) -- 0:01:34
309000 -- (-582.625) (-578.758) [-574.195] (-584.443) * (-579.612) (-586.577) (-582.415) [-578.448] -- 0:01:33
309500 -- (-580.611) (-583.068) (-581.474) [-575.834] * (-580.367) [-578.574] (-573.648) (-576.569) -- 0:01:33
310000 -- (-577.282) [-578.956] (-581.852) (-575.537) * (-580.200) (-579.683) (-580.987) [-581.294] -- 0:01:33
Average standard deviation of split frequencies: 0.014740
310500 -- (-575.494) (-582.325) [-576.544] (-580.559) * (-581.768) (-578.067) [-576.428] (-581.967) -- 0:01:35
311000 -- [-576.245] (-585.044) (-580.634) (-577.672) * [-577.385] (-583.312) (-577.280) (-578.841) -- 0:01:35
311500 -- [-575.425] (-577.179) (-580.601) (-577.491) * (-581.165) (-583.171) [-577.661] (-581.645) -- 0:01:35
312000 -- (-580.966) [-584.448] (-585.061) (-580.917) * [-581.007] (-581.027) (-585.000) (-576.173) -- 0:01:34
312500 -- (-582.617) (-580.725) (-585.910) [-574.818] * (-583.643) (-586.522) [-577.705] (-578.775) -- 0:01:34
313000 -- (-584.655) (-580.127) (-582.938) [-582.458] * (-582.026) [-576.183] (-580.130) (-582.322) -- 0:01:34
313500 -- (-582.979) [-579.884] (-584.482) (-576.114) * (-581.956) (-576.353) [-574.422] (-583.596) -- 0:01:34
314000 -- (-589.540) [-578.646] (-582.855) (-588.123) * (-575.664) [-576.067] (-579.402) (-580.038) -- 0:01:33
314500 -- (-574.707) (-586.042) (-583.441) [-577.175] * (-588.862) (-578.879) [-575.594] (-577.302) -- 0:01:33
315000 -- (-576.224) (-578.753) [-576.483] (-585.848) * (-583.854) (-583.189) [-583.197] (-587.504) -- 0:01:33
Average standard deviation of split frequencies: 0.016197
315500 -- (-582.035) (-580.681) (-584.360) [-580.345] * (-584.182) (-582.522) [-578.989] (-579.605) -- 0:01:33
316000 -- (-578.987) (-581.208) (-576.485) [-582.349] * [-581.916] (-577.988) (-579.658) (-578.922) -- 0:01:33
316500 -- [-576.198] (-582.383) (-575.423) (-582.794) * (-583.934) (-578.233) [-580.325] (-582.348) -- 0:01:32
317000 -- (-578.661) (-576.923) [-576.208] (-587.403) * (-585.321) [-583.165] (-579.565) (-581.116) -- 0:01:32
317500 -- [-583.605] (-580.665) (-580.865) (-576.413) * [-579.831] (-576.990) (-581.361) (-585.049) -- 0:01:32
318000 -- [-580.777] (-581.619) (-580.615) (-577.789) * (-589.502) (-579.309) (-581.533) [-578.779] -- 0:01:34
318500 -- (-579.326) [-576.814] (-579.152) (-581.612) * (-578.135) (-581.091) [-580.493] (-576.666) -- 0:01:34
319000 -- (-577.353) (-590.233) [-579.654] (-577.643) * [-577.848] (-582.423) (-577.735) (-580.153) -- 0:01:33
319500 -- [-579.449] (-580.683) (-586.486) (-580.487) * [-577.010] (-580.122) (-581.965) (-576.237) -- 0:01:33
320000 -- (-577.808) [-579.861] (-584.331) (-579.661) * [-577.616] (-579.062) (-579.390) (-587.785) -- 0:01:33
Average standard deviation of split frequencies: 0.017011
320500 -- [-582.835] (-586.897) (-579.441) (-578.188) * [-575.275] (-577.255) (-589.601) (-587.220) -- 0:01:33
321000 -- (-577.058) (-581.044) [-576.784] (-578.313) * (-584.898) [-578.899] (-580.011) (-581.235) -- 0:01:33
321500 -- (-580.497) (-578.510) (-578.280) [-581.933] * (-580.588) [-578.543] (-578.092) (-583.195) -- 0:01:32
322000 -- (-579.213) (-578.907) [-582.258] (-581.942) * [-581.941] (-580.989) (-575.543) (-584.879) -- 0:01:32
322500 -- (-580.813) (-581.046) (-577.591) [-579.629] * (-581.465) [-578.085] (-576.857) (-582.250) -- 0:01:32
323000 -- (-593.292) (-582.781) [-581.414] (-576.509) * (-584.803) [-576.839] (-577.597) (-586.619) -- 0:01:32
323500 -- (-595.058) (-578.524) (-577.036) [-581.138] * (-581.516) [-580.939] (-578.824) (-587.481) -- 0:01:32
324000 -- (-581.492) [-580.048] (-580.343) (-586.070) * (-578.845) (-577.910) (-581.463) [-582.547] -- 0:01:31
324500 -- (-579.101) [-579.060] (-578.636) (-579.791) * [-575.815] (-578.043) (-583.221) (-581.819) -- 0:01:31
325000 -- (-574.911) (-573.620) [-574.205] (-581.139) * (-576.128) (-583.170) (-583.194) [-577.987] -- 0:01:31
Average standard deviation of split frequencies: 0.017765
325500 -- [-575.865] (-576.140) (-575.206) (-581.170) * (-576.917) [-580.205] (-579.896) (-577.411) -- 0:01:33
326000 -- (-577.377) [-576.309] (-578.177) (-582.209) * [-579.087] (-578.224) (-577.059) (-582.553) -- 0:01:33
326500 -- (-580.206) (-579.891) [-577.726] (-573.901) * (-582.292) [-578.307] (-588.381) (-580.301) -- 0:01:32
327000 -- (-582.900) [-574.471] (-583.556) (-577.502) * (-578.280) (-575.950) [-579.564] (-576.035) -- 0:01:32
327500 -- (-580.780) [-582.956] (-574.949) (-578.798) * (-582.797) [-577.923] (-579.896) (-575.600) -- 0:01:32
328000 -- (-576.523) [-579.556] (-575.885) (-578.564) * (-578.891) [-574.942] (-578.557) (-576.118) -- 0:01:32
328500 -- (-580.501) (-586.310) (-578.687) [-578.305] * (-576.150) (-575.953) (-578.136) [-578.500] -- 0:01:31
329000 -- (-578.354) (-580.390) (-578.398) [-580.135] * (-578.721) (-576.952) [-581.200] (-575.168) -- 0:01:31
329500 -- (-577.181) [-576.161] (-579.635) (-576.089) * (-582.499) (-577.732) (-577.755) [-577.658] -- 0:01:31
330000 -- (-584.545) (-579.730) (-580.605) [-574.791] * (-574.221) [-584.507] (-577.315) (-578.645) -- 0:01:31
Average standard deviation of split frequencies: 0.016293
330500 -- (-582.653) [-582.104] (-575.556) (-577.955) * (-575.929) (-579.209) (-582.289) [-580.235] -- 0:01:31
331000 -- [-582.256] (-584.293) (-575.734) (-576.590) * [-575.559] (-579.378) (-580.541) (-579.121) -- 0:01:30
331500 -- (-578.252) (-582.104) (-581.826) [-579.348] * (-579.210) (-583.573) (-579.940) [-578.736] -- 0:01:30
332000 -- (-577.837) (-579.107) (-583.462) [-577.667] * (-581.860) (-588.946) [-575.632] (-575.359) -- 0:01:30
332500 -- (-578.636) (-578.024) (-580.216) [-575.237] * (-576.902) (-576.441) [-579.948] (-579.854) -- 0:01:32
333000 -- (-580.001) (-588.893) [-578.685] (-577.223) * [-577.002] (-581.674) (-586.110) (-574.517) -- 0:01:32
333500 -- (-580.582) (-582.341) (-584.179) [-576.654] * [-577.959] (-583.924) (-585.112) (-577.627) -- 0:01:31
334000 -- [-579.198] (-583.093) (-582.094) (-577.192) * [-578.185] (-586.906) (-582.343) (-579.309) -- 0:01:31
334500 -- (-577.676) (-582.666) (-578.995) [-574.967] * (-584.992) (-578.892) (-577.938) [-579.831] -- 0:01:31
335000 -- (-581.760) (-575.719) [-581.076] (-580.653) * [-577.461] (-591.731) (-580.091) (-581.578) -- 0:01:31
Average standard deviation of split frequencies: 0.019041
335500 -- (-575.524) [-576.759] (-578.707) (-578.140) * (-583.554) (-580.648) (-582.847) [-580.762] -- 0:01:31
336000 -- (-575.757) (-578.491) [-578.903] (-577.195) * [-573.361] (-581.549) (-583.294) (-585.174) -- 0:01:30
336500 -- (-585.755) (-574.583) (-583.175) [-581.712] * (-579.296) [-576.483] (-580.175) (-579.066) -- 0:01:30
337000 -- (-577.943) [-578.856] (-576.570) (-580.176) * (-574.920) (-577.773) (-579.448) [-580.708] -- 0:01:30
337500 -- (-582.186) (-576.692) [-581.169] (-577.790) * (-578.437) (-579.948) (-580.799) [-580.942] -- 0:01:30
338000 -- [-578.943] (-583.797) (-580.266) (-579.876) * (-577.460) (-576.806) (-586.816) [-577.838] -- 0:01:30
338500 -- (-575.215) [-583.488] (-579.360) (-580.116) * (-580.161) [-579.026] (-582.742) (-575.787) -- 0:01:29
339000 -- (-586.140) (-582.460) (-579.675) [-577.403] * (-580.167) (-585.186) [-581.942] (-579.733) -- 0:01:29
339500 -- [-574.831] (-579.334) (-577.046) (-575.926) * [-574.103] (-582.550) (-578.852) (-580.536) -- 0:01:29
340000 -- [-578.998] (-582.021) (-581.709) (-583.338) * (-574.515) [-578.041] (-586.074) (-579.067) -- 0:01:31
Average standard deviation of split frequencies: 0.019175
340500 -- [-579.040] (-581.066) (-577.623) (-579.691) * (-582.267) [-577.532] (-576.391) (-575.929) -- 0:01:31
341000 -- [-573.950] (-578.527) (-580.088) (-581.737) * [-575.841] (-585.488) (-578.545) (-579.896) -- 0:01:30
341500 -- (-575.941) (-586.465) (-583.785) [-575.511] * (-575.594) (-581.741) [-580.026] (-580.851) -- 0:01:30
342000 -- (-577.657) (-582.906) (-580.090) [-579.469] * (-576.669) [-580.710] (-583.612) (-577.481) -- 0:01:30
342500 -- (-583.894) (-588.610) [-577.366] (-581.628) * (-577.970) [-584.001] (-577.580) (-575.841) -- 0:01:30
343000 -- (-580.310) (-593.398) [-577.486] (-581.671) * (-574.456) (-582.722) (-576.522) [-581.065] -- 0:01:30
343500 -- (-581.105) (-587.571) (-575.554) [-574.505] * [-588.857] (-583.666) (-580.329) (-582.350) -- 0:01:29
344000 -- (-579.597) (-589.771) (-580.272) [-576.326] * (-582.384) (-584.855) (-584.469) [-579.638] -- 0:01:29
344500 -- (-579.917) (-590.173) (-577.829) [-576.517] * [-577.845] (-589.060) (-576.772) (-582.010) -- 0:01:29
345000 -- (-576.458) (-588.828) [-586.373] (-575.849) * (-580.036) (-589.394) (-577.955) [-578.220] -- 0:01:29
Average standard deviation of split frequencies: 0.019853
345500 -- [-581.353] (-589.769) (-583.438) (-577.081) * [-581.067] (-586.573) (-582.472) (-580.764) -- 0:01:29
346000 -- (-580.956) [-580.134] (-580.972) (-577.156) * (-581.930) (-586.753) (-579.405) [-577.509] -- 0:01:28
346500 -- (-586.497) (-579.859) (-579.054) [-572.765] * [-579.138] (-587.571) (-582.462) (-579.931) -- 0:01:28
347000 -- (-578.564) (-583.678) [-577.153] (-574.974) * (-579.707) (-579.831) (-580.673) [-585.124] -- 0:01:30
347500 -- (-582.631) (-582.898) (-579.972) [-574.948] * (-582.287) (-581.344) [-584.150] (-580.178) -- 0:01:30
348000 -- (-584.813) [-583.678] (-576.703) (-577.047) * [-575.811] (-584.157) (-580.078) (-580.265) -- 0:01:29
348500 -- (-588.461) (-580.462) [-576.525] (-576.792) * (-579.049) (-587.102) [-583.534] (-582.117) -- 0:01:29
349000 -- (-587.334) (-581.593) (-577.302) [-575.590] * (-582.555) (-583.557) [-574.713] (-575.946) -- 0:01:29
349500 -- (-594.667) (-583.153) (-584.166) [-579.858] * (-579.624) [-579.910] (-582.465) (-579.301) -- 0:01:29
350000 -- [-575.083] (-579.383) (-585.155) (-582.579) * (-582.072) (-590.578) [-580.772] (-578.265) -- 0:01:29
Average standard deviation of split frequencies: 0.017668
350500 -- (-578.082) (-581.782) [-582.043] (-584.071) * (-580.771) (-579.764) [-578.705] (-575.724) -- 0:01:28
351000 -- [-577.169] (-577.342) (-589.202) (-576.958) * (-578.540) (-578.636) [-576.004] (-573.758) -- 0:01:28
351500 -- (-577.172) [-581.714] (-583.347) (-586.014) * [-585.597] (-580.162) (-577.036) (-576.484) -- 0:01:28
352000 -- (-579.227) [-587.674] (-584.693) (-579.649) * (-577.043) [-580.507] (-579.764) (-576.353) -- 0:01:28
352500 -- (-582.532) (-580.852) (-577.537) [-576.734] * (-575.779) (-577.010) [-576.687] (-580.479) -- 0:01:28
353000 -- (-575.034) (-580.102) [-578.267] (-579.809) * [-575.396] (-577.074) (-583.400) (-580.110) -- 0:01:27
353500 -- (-578.545) [-586.359] (-580.008) (-579.127) * (-585.812) (-580.569) [-579.971] (-578.936) -- 0:01:27
354000 -- (-577.848) (-583.887) [-580.160] (-586.705) * [-578.204] (-577.280) (-580.270) (-577.791) -- 0:01:27
354500 -- (-580.959) [-579.208] (-578.523) (-582.068) * (-574.741) (-578.124) (-581.446) [-578.800] -- 0:01:29
355000 -- (-581.966) [-575.465] (-578.284) (-582.118) * (-577.184) [-579.535] (-575.819) (-581.805) -- 0:01:29
Average standard deviation of split frequencies: 0.017782
355500 -- (-574.790) (-579.625) [-585.580] (-583.961) * (-577.286) [-577.888] (-574.223) (-578.512) -- 0:01:28
356000 -- [-578.231] (-575.311) (-575.733) (-577.724) * [-580.502] (-579.159) (-579.851) (-582.079) -- 0:01:28
356500 -- (-581.684) [-577.055] (-577.609) (-581.782) * (-575.665) (-579.425) (-576.418) [-575.918] -- 0:01:28
357000 -- (-576.695) (-577.907) [-577.384] (-580.352) * [-577.719] (-578.577) (-578.528) (-583.159) -- 0:01:28
357500 -- (-579.765) (-577.707) [-581.303] (-579.130) * (-578.774) (-578.635) (-585.753) [-575.683] -- 0:01:28
358000 -- (-577.661) [-578.696] (-583.672) (-580.382) * (-583.336) (-585.848) (-586.098) [-580.072] -- 0:01:27
358500 -- (-577.267) (-573.016) (-576.281) [-578.092] * (-576.324) [-581.549] (-594.257) (-584.532) -- 0:01:27
359000 -- (-579.278) [-578.772] (-579.174) (-580.884) * (-576.430) [-577.326] (-589.759) (-583.396) -- 0:01:27
359500 -- [-575.977] (-577.692) (-576.929) (-577.833) * (-581.884) [-575.139] (-580.167) (-581.440) -- 0:01:27
360000 -- (-573.314) (-577.869) (-579.296) [-579.786] * (-578.003) [-574.559] (-589.790) (-582.345) -- 0:01:27
Average standard deviation of split frequencies: 0.019232
360500 -- (-578.184) (-577.475) (-578.580) [-582.675] * [-581.670] (-581.944) (-585.608) (-575.837) -- 0:01:26
361000 -- [-578.913] (-579.190) (-581.819) (-586.159) * (-584.542) [-580.431] (-587.384) (-581.090) -- 0:01:26
361500 -- (-580.200) [-579.218] (-580.670) (-582.504) * (-578.186) (-578.982) (-590.359) [-575.955] -- 0:01:26
362000 -- [-579.282] (-579.857) (-577.807) (-577.389) * [-576.254] (-585.129) (-594.000) (-578.524) -- 0:01:28
362500 -- (-575.239) [-576.140] (-574.673) (-582.215) * (-575.066) (-584.384) (-590.512) [-579.165] -- 0:01:27
363000 -- (-575.576) (-574.964) (-582.015) [-582.676] * [-576.801] (-575.502) (-587.412) (-578.161) -- 0:01:27
363500 -- (-576.802) (-579.032) [-578.118] (-578.703) * (-577.110) (-576.831) (-585.225) [-581.089] -- 0:01:27
364000 -- (-582.073) [-577.955] (-580.514) (-583.627) * (-576.799) [-577.383] (-584.662) (-582.884) -- 0:01:27
364500 -- (-589.282) (-579.972) (-577.771) [-582.273] * [-578.988] (-576.154) (-581.220) (-577.632) -- 0:01:27
365000 -- (-581.156) [-578.516] (-581.908) (-579.874) * [-577.681] (-583.416) (-587.308) (-584.611) -- 0:01:26
Average standard deviation of split frequencies: 0.017296
365500 -- [-582.493] (-579.564) (-585.737) (-582.410) * (-579.874) (-582.497) [-579.089] (-592.441) -- 0:01:26
366000 -- (-581.241) [-577.488] (-580.835) (-582.907) * (-575.873) [-585.082] (-575.400) (-589.720) -- 0:01:26
366500 -- (-576.553) (-583.171) [-579.974] (-577.072) * (-579.318) [-578.310] (-579.431) (-585.151) -- 0:01:26
367000 -- [-579.681] (-583.745) (-579.004) (-577.794) * (-579.711) [-577.994] (-576.672) (-582.099) -- 0:01:26
367500 -- (-575.959) [-581.868] (-577.338) (-578.418) * (-580.711) [-580.522] (-576.742) (-580.767) -- 0:01:26
368000 -- (-585.518) [-577.265] (-573.348) (-578.946) * (-585.761) (-576.326) [-579.300] (-578.016) -- 0:01:25
368500 -- (-580.334) (-578.574) (-576.241) [-576.551] * [-581.971] (-580.421) (-575.551) (-577.572) -- 0:01:25
369000 -- (-588.220) (-584.454) [-578.798] (-581.322) * [-578.279] (-584.706) (-580.079) (-579.215) -- 0:01:27
369500 -- (-577.385) (-584.021) (-580.245) [-576.577] * (-576.990) [-583.406] (-580.051) (-577.424) -- 0:01:27
370000 -- (-579.696) [-580.600] (-578.408) (-576.828) * (-576.086) (-574.920) [-578.707] (-579.907) -- 0:01:26
Average standard deviation of split frequencies: 0.016715
370500 -- [-579.966] (-576.917) (-581.895) (-575.487) * (-580.429) [-579.307] (-582.573) (-577.965) -- 0:01:26
371000 -- [-583.849] (-579.634) (-575.626) (-576.556) * [-580.198] (-579.173) (-583.064) (-581.600) -- 0:01:26
371500 -- [-578.381] (-581.443) (-574.472) (-578.793) * [-579.232] (-578.013) (-581.425) (-591.662) -- 0:01:26
372000 -- (-576.183) [-578.228] (-575.744) (-586.843) * (-582.171) (-575.359) [-579.790] (-585.879) -- 0:01:26
372500 -- (-580.928) [-578.633] (-574.908) (-584.351) * (-580.552) [-579.099] (-579.750) (-580.327) -- 0:01:25
373000 -- (-582.918) [-580.729] (-573.690) (-590.585) * (-582.801) (-576.617) [-576.450] (-578.358) -- 0:01:25
373500 -- (-574.352) [-578.191] (-573.135) (-587.722) * [-578.309] (-576.457) (-579.370) (-577.200) -- 0:01:25
374000 -- (-579.053) (-579.528) [-574.420] (-578.615) * (-577.277) (-579.789) [-581.638] (-588.828) -- 0:01:25
374500 -- [-581.787] (-575.021) (-585.769) (-580.370) * (-592.435) (-585.089) (-583.977) [-580.399] -- 0:01:25
375000 -- [-580.538] (-580.004) (-585.711) (-577.596) * (-578.138) (-581.483) [-576.947] (-575.293) -- 0:01:25
Average standard deviation of split frequencies: 0.015940
375500 -- [-577.838] (-580.272) (-586.597) (-583.220) * [-578.614] (-578.312) (-580.164) (-577.178) -- 0:01:24
376000 -- (-582.468) [-578.224] (-576.378) (-582.240) * (-580.750) (-580.147) (-579.684) [-574.153] -- 0:01:24
376500 -- (-576.693) [-581.830] (-573.940) (-584.673) * (-576.542) (-574.550) (-583.698) [-579.510] -- 0:01:26
377000 -- (-578.550) (-583.962) [-576.634] (-583.028) * (-581.319) (-576.552) [-574.614] (-579.432) -- 0:01:25
377500 -- (-585.587) [-580.728] (-576.382) (-578.875) * (-575.270) (-579.426) [-577.734] (-579.575) -- 0:01:25
378000 -- [-576.796] (-578.649) (-590.647) (-580.827) * (-581.396) [-576.516] (-577.574) (-577.061) -- 0:01:25
378500 -- [-575.201] (-578.825) (-581.592) (-575.638) * (-575.358) [-573.751] (-581.750) (-585.050) -- 0:01:25
379000 -- [-578.772] (-584.416) (-578.450) (-579.873) * (-574.458) (-581.620) (-579.655) [-579.596] -- 0:01:25
379500 -- (-575.156) [-575.472] (-582.412) (-578.716) * [-576.142] (-581.470) (-581.794) (-578.818) -- 0:01:25
380000 -- (-577.173) (-578.899) [-578.542] (-574.837) * (-587.074) [-583.412] (-576.124) (-577.884) -- 0:01:24
Average standard deviation of split frequencies: 0.015214
380500 -- (-579.132) [-578.469] (-582.099) (-579.847) * (-583.516) (-578.798) [-578.546] (-577.248) -- 0:01:24
381000 -- [-577.825] (-582.156) (-576.143) (-580.594) * (-591.559) (-578.030) [-585.208] (-578.798) -- 0:01:24
381500 -- (-579.091) (-579.117) [-576.533] (-579.973) * (-579.871) [-577.494] (-582.243) (-580.860) -- 0:01:24
382000 -- (-574.501) (-579.286) (-577.848) [-577.240] * [-576.095] (-575.370) (-583.209) (-583.595) -- 0:01:24
382500 -- [-585.856] (-578.570) (-581.354) (-582.813) * (-583.443) [-576.091] (-578.988) (-583.288) -- 0:01:23
383000 -- [-581.123] (-582.290) (-582.191) (-580.428) * [-576.934] (-579.796) (-576.260) (-581.314) -- 0:01:23
383500 -- (-581.012) (-583.235) (-576.429) [-575.626] * (-578.416) (-577.822) [-577.093] (-576.989) -- 0:01:25
384000 -- (-582.482) (-580.371) [-576.670] (-579.331) * [-577.714] (-580.064) (-576.954) (-589.969) -- 0:01:25
384500 -- (-580.256) (-575.828) (-581.366) [-577.147] * [-579.137] (-574.134) (-579.078) (-584.337) -- 0:01:24
385000 -- (-577.442) [-581.711] (-585.596) (-580.745) * (-584.268) (-575.135) [-578.618] (-577.409) -- 0:01:24
Average standard deviation of split frequencies: 0.015004
385500 -- (-578.130) [-578.181] (-577.956) (-577.993) * (-580.433) (-584.868) [-574.853] (-583.821) -- 0:01:24
386000 -- (-580.577) (-579.873) (-587.079) [-573.801] * (-578.190) (-576.493) (-576.949) [-580.591] -- 0:01:24
386500 -- (-577.987) (-581.986) (-589.961) [-577.688] * (-577.797) (-579.752) (-587.429) [-583.727] -- 0:01:24
387000 -- (-580.098) [-577.354] (-575.666) (-576.779) * [-578.852] (-578.924) (-583.715) (-584.567) -- 0:01:23
387500 -- (-575.024) (-583.558) [-580.110] (-575.803) * (-584.742) [-577.296] (-578.429) (-582.033) -- 0:01:23
388000 -- (-576.586) [-579.214] (-581.286) (-582.565) * [-576.260] (-578.099) (-580.525) (-581.987) -- 0:01:23
388500 -- (-578.714) (-590.141) [-582.510] (-575.351) * (-580.496) [-579.910] (-580.349) (-581.031) -- 0:01:23
389000 -- (-575.946) (-583.600) (-579.622) [-574.678] * (-577.807) (-578.201) (-583.654) [-576.087] -- 0:01:23
389500 -- (-580.446) (-582.299) [-576.263] (-582.609) * [-580.710] (-580.256) (-577.708) (-585.524) -- 0:01:23
390000 -- (-578.848) [-579.070] (-580.261) (-584.282) * (-577.610) (-577.802) (-581.025) [-578.784] -- 0:01:22
Average standard deviation of split frequencies: 0.013963
390500 -- [-578.188] (-583.401) (-579.352) (-583.063) * (-576.968) [-582.905] (-581.157) (-583.019) -- 0:01:22
391000 -- (-579.558) (-577.559) [-582.551] (-579.182) * (-577.383) (-580.779) [-580.077] (-578.798) -- 0:01:24
391500 -- [-578.613] (-580.818) (-578.589) (-579.850) * [-580.387] (-584.484) (-584.893) (-580.261) -- 0:01:23
392000 -- [-581.906] (-578.975) (-582.944) (-580.083) * (-578.870) (-579.027) (-586.073) [-573.792] -- 0:01:23
392500 -- (-579.468) (-588.627) [-579.316] (-576.305) * (-580.072) (-581.196) (-581.149) [-578.309] -- 0:01:23
393000 -- (-581.627) [-577.003] (-575.182) (-580.501) * (-580.161) [-576.697] (-582.219) (-579.969) -- 0:01:23
393500 -- (-580.313) (-579.638) (-578.533) [-580.398] * (-583.340) (-586.015) (-588.017) [-574.968] -- 0:01:23
394000 -- (-578.142) (-579.078) [-578.611] (-583.026) * (-585.139) (-583.976) [-582.902] (-578.477) -- 0:01:23
394500 -- (-577.919) (-581.400) [-577.907] (-581.409) * (-584.120) [-585.057] (-581.963) (-581.850) -- 0:01:22
395000 -- (-579.661) (-579.147) (-580.966) [-577.939] * [-578.873] (-575.885) (-581.015) (-578.477) -- 0:01:22
Average standard deviation of split frequencies: 0.012925
395500 -- (-584.204) [-580.705] (-582.859) (-581.133) * (-577.280) (-578.319) [-577.910] (-584.279) -- 0:01:22
396000 -- (-581.692) [-578.302] (-582.603) (-582.899) * (-580.265) (-580.466) [-578.737] (-585.228) -- 0:01:22
396500 -- [-580.686] (-581.984) (-583.155) (-579.994) * (-582.594) [-576.991] (-583.853) (-584.163) -- 0:01:22
397000 -- (-576.471) [-577.528] (-580.263) (-579.996) * (-584.406) (-579.329) (-576.557) [-585.776] -- 0:01:22
397500 -- (-581.923) [-578.964] (-581.242) (-581.175) * (-588.358) (-575.566) [-581.058] (-577.812) -- 0:01:21
398000 -- (-581.761) [-584.213] (-589.992) (-573.793) * (-583.540) (-581.203) [-578.983] (-580.207) -- 0:01:21
398500 -- [-578.525] (-581.983) (-585.684) (-578.344) * (-577.887) (-578.486) (-584.064) [-578.488] -- 0:01:23
399000 -- [-575.459] (-582.812) (-582.037) (-579.318) * (-576.710) [-579.199] (-578.958) (-581.230) -- 0:01:22
399500 -- (-579.714) (-585.527) [-583.552] (-580.786) * (-574.208) (-581.419) (-579.652) [-577.701] -- 0:01:22
400000 -- (-583.516) [-576.833] (-580.849) (-574.233) * (-580.655) (-582.585) (-586.599) [-574.521] -- 0:01:22
Average standard deviation of split frequencies: 0.011429
400500 -- (-583.460) [-583.902] (-574.904) (-578.594) * (-583.995) (-578.293) (-577.987) [-583.763] -- 0:01:22
401000 -- [-580.355] (-582.225) (-581.671) (-585.622) * (-580.244) (-576.716) (-574.230) [-579.598] -- 0:01:22
401500 -- (-587.431) [-583.838] (-586.745) (-576.835) * (-577.539) (-579.014) (-581.090) [-578.429] -- 0:01:21
402000 -- [-584.050] (-577.881) (-581.145) (-577.871) * (-581.215) [-581.272] (-582.050) (-581.486) -- 0:01:21
402500 -- (-579.198) (-576.093) (-578.470) [-580.481] * (-578.396) [-583.628] (-589.047) (-575.916) -- 0:01:21
403000 -- (-577.700) [-582.077] (-575.438) (-576.822) * (-577.503) (-584.832) (-591.888) [-580.585] -- 0:01:21
403500 -- (-577.491) [-577.564] (-579.683) (-584.527) * (-578.577) [-587.092] (-585.585) (-576.497) -- 0:01:21
404000 -- (-582.757) [-577.521] (-578.872) (-577.156) * (-582.607) (-585.700) (-588.950) [-578.059] -- 0:01:21
404500 -- (-583.313) (-581.770) (-581.354) [-578.009] * [-577.028] (-583.901) (-583.538) (-581.081) -- 0:01:20
405000 -- (-585.413) (-579.800) (-575.648) [-578.854] * [-576.392] (-581.472) (-592.270) (-580.609) -- 0:01:20
Average standard deviation of split frequencies: 0.010284
405500 -- [-579.763] (-584.701) (-575.139) (-581.375) * (-575.908) (-578.627) (-592.681) [-573.840] -- 0:01:22
406000 -- [-578.522] (-579.351) (-575.931) (-584.354) * (-579.408) (-582.207) [-586.132] (-577.908) -- 0:01:21
406500 -- (-576.591) (-578.259) (-585.647) [-576.927] * [-580.415] (-580.276) (-583.428) (-584.398) -- 0:01:21
407000 -- (-580.558) (-573.980) (-583.054) [-580.077] * (-577.940) [-577.277] (-579.262) (-577.623) -- 0:01:21
407500 -- [-581.022] (-580.736) (-580.997) (-578.896) * (-581.053) (-578.072) [-581.133] (-578.594) -- 0:01:21
408000 -- (-578.730) (-583.418) [-578.239] (-580.569) * (-581.303) (-577.725) (-581.906) [-576.321] -- 0:01:21
408500 -- (-581.170) (-581.733) (-581.589) [-573.653] * [-580.011] (-582.753) (-577.028) (-575.687) -- 0:01:21
409000 -- (-576.029) (-579.512) (-579.787) [-578.734] * (-583.345) (-590.970) (-582.621) [-580.143] -- 0:01:20
409500 -- [-577.464] (-583.481) (-576.164) (-584.845) * (-578.419) [-582.317] (-587.239) (-575.704) -- 0:01:20
410000 -- (-578.623) (-581.821) [-578.927] (-576.689) * (-580.252) (-576.059) (-577.511) [-578.835] -- 0:01:20
Average standard deviation of split frequencies: 0.009675
410500 -- (-585.239) (-583.105) (-581.349) [-575.812] * (-583.050) (-577.934) [-585.787] (-579.788) -- 0:01:20
411000 -- (-577.327) [-578.991] (-583.359) (-580.741) * [-584.529] (-581.719) (-576.775) (-583.560) -- 0:01:20
411500 -- [-574.873] (-581.712) (-583.237) (-577.389) * (-579.820) (-579.291) (-580.545) [-574.079] -- 0:01:20
412000 -- (-579.655) (-578.031) [-581.539] (-579.896) * [-577.745] (-578.620) (-580.402) (-578.264) -- 0:01:19
412500 -- [-580.608] (-574.806) (-586.606) (-578.647) * (-574.385) (-579.584) [-574.627] (-577.133) -- 0:01:19
413000 -- (-574.390) (-574.065) (-584.635) [-577.519] * [-576.577] (-584.376) (-575.832) (-577.607) -- 0:01:21
413500 -- (-582.109) (-584.972) (-581.889) [-579.791] * (-587.375) (-577.904) (-580.801) [-574.858] -- 0:01:20
414000 -- [-580.621] (-579.528) (-578.389) (-583.886) * (-577.610) (-577.789) [-581.662] (-579.319) -- 0:01:20
414500 -- (-576.617) (-579.409) [-582.067] (-579.010) * (-578.218) (-579.784) (-584.917) [-575.548] -- 0:01:20
415000 -- (-580.007) (-576.853) (-583.816) [-577.054] * (-574.825) [-574.951] (-577.064) (-579.180) -- 0:01:20
Average standard deviation of split frequencies: 0.010199
415500 -- (-583.556) (-577.935) (-577.064) [-575.933] * (-581.402) (-576.221) (-577.618) [-578.987] -- 0:01:20
416000 -- (-587.738) (-576.469) (-575.961) [-575.435] * (-583.689) [-573.894] (-577.140) (-577.456) -- 0:01:20
416500 -- [-577.527] (-580.199) (-575.525) (-582.648) * (-582.970) (-580.009) (-580.679) [-581.242] -- 0:01:19
417000 -- (-575.028) (-581.860) [-580.382] (-578.317) * (-589.279) (-576.290) (-585.413) [-577.784] -- 0:01:19
417500 -- (-572.593) (-580.459) [-579.909] (-588.005) * (-581.070) [-578.930] (-579.785) (-573.050) -- 0:01:19
418000 -- (-585.146) (-578.897) (-580.632) [-579.085] * (-581.559) [-578.957] (-585.088) (-581.804) -- 0:01:19
418500 -- (-581.064) (-582.592) (-578.655) [-574.169] * (-588.134) [-576.369] (-577.850) (-577.074) -- 0:01:19
419000 -- (-584.323) (-575.705) (-578.090) [-573.989] * (-587.641) [-575.050] (-575.697) (-587.136) -- 0:01:19
419500 -- (-580.289) (-578.222) [-578.238] (-575.329) * (-594.958) [-575.429] (-580.860) (-579.616) -- 0:01:18
420000 -- (-589.692) (-577.778) (-573.728) [-578.537] * (-582.011) (-575.155) [-575.987] (-576.753) -- 0:01:18
Average standard deviation of split frequencies: 0.008325
420500 -- (-579.287) (-576.867) [-577.770] (-577.262) * (-581.140) (-583.308) (-577.319) [-579.622] -- 0:01:19
421000 -- (-587.784) (-583.683) (-578.304) [-583.041] * (-580.455) (-578.865) [-574.697] (-579.233) -- 0:01:19
421500 -- [-576.752] (-583.904) (-580.923) (-579.685) * (-580.899) [-579.365] (-581.731) (-583.804) -- 0:01:19
422000 -- (-583.079) (-586.712) [-578.292] (-577.546) * (-580.648) (-581.929) [-583.134] (-581.493) -- 0:01:19
422500 -- (-595.550) (-579.928) [-575.228] (-578.556) * (-581.063) [-579.337] (-589.469) (-582.722) -- 0:01:19
423000 -- (-586.553) (-581.045) (-581.414) [-583.282] * [-580.004] (-573.414) (-576.203) (-575.703) -- 0:01:19
423500 -- (-583.342) (-577.103) [-575.458] (-584.392) * (-579.924) (-578.507) [-582.029] (-578.465) -- 0:01:18
424000 -- (-581.314) (-576.396) (-580.695) [-579.385] * (-580.269) [-581.381] (-580.143) (-579.205) -- 0:01:18
424500 -- (-576.053) [-575.580] (-582.448) (-579.837) * (-582.771) (-580.676) (-577.120) [-578.139] -- 0:01:18
425000 -- (-575.983) [-579.235] (-578.061) (-578.209) * (-579.267) (-582.701) (-579.846) [-578.414] -- 0:01:18
Average standard deviation of split frequencies: 0.009643
425500 -- (-584.078) (-582.144) [-578.978] (-580.816) * (-590.915) (-585.745) (-585.302) [-578.621] -- 0:01:18
426000 -- (-584.147) (-577.108) (-578.183) [-579.345] * (-580.654) [-580.803] (-580.996) (-578.262) -- 0:01:18
426500 -- (-581.990) (-583.083) [-584.317] (-577.148) * (-579.870) (-583.048) [-581.258] (-585.216) -- 0:01:17
427000 -- (-588.562) (-576.581) (-577.758) [-574.990] * (-584.871) (-577.011) [-580.277] (-581.668) -- 0:01:17
427500 -- (-584.001) (-591.323) (-578.966) [-573.923] * (-586.001) (-577.968) [-581.046] (-581.299) -- 0:01:19
428000 -- (-585.995) (-577.634) (-581.751) [-580.765] * [-582.339] (-587.683) (-585.219) (-582.017) -- 0:01:18
428500 -- (-583.066) (-582.713) (-576.423) [-575.856] * (-581.260) [-579.616] (-583.991) (-579.936) -- 0:01:18
429000 -- (-580.016) (-576.133) [-582.304] (-575.149) * (-579.879) [-574.327] (-585.110) (-579.109) -- 0:01:18
429500 -- [-585.408] (-581.045) (-588.485) (-583.022) * (-578.806) [-577.802] (-582.321) (-582.045) -- 0:01:18
430000 -- (-581.765) (-580.693) [-577.593] (-576.134) * (-579.730) (-579.146) (-585.281) [-579.662] -- 0:01:18
Average standard deviation of split frequencies: 0.010320
430500 -- (-579.320) (-583.381) [-575.505] (-576.144) * [-579.671] (-584.780) (-580.827) (-578.397) -- 0:01:18
431000 -- (-577.155) (-581.096) (-585.975) [-578.930] * (-581.559) [-578.317] (-583.304) (-580.038) -- 0:01:17
431500 -- (-582.522) (-578.283) (-580.712) [-580.481] * (-584.253) (-580.258) (-581.372) [-585.274] -- 0:01:17
432000 -- (-590.207) (-579.587) [-578.276] (-580.006) * [-583.964] (-585.378) (-582.111) (-584.114) -- 0:01:17
432500 -- [-578.424] (-576.959) (-578.240) (-581.688) * [-582.207] (-583.383) (-585.255) (-582.383) -- 0:01:17
433000 -- (-585.124) [-577.372] (-581.053) (-577.334) * (-588.031) (-576.981) [-579.125] (-577.358) -- 0:01:17
433500 -- (-578.496) (-575.223) (-584.302) [-577.159] * (-579.729) [-577.754] (-579.136) (-578.362) -- 0:01:17
434000 -- [-575.631] (-576.513) (-585.255) (-577.645) * (-578.999) [-580.698] (-578.526) (-586.529) -- 0:01:16
434500 -- [-580.222] (-578.667) (-573.086) (-581.028) * [-575.015] (-575.010) (-581.252) (-576.730) -- 0:01:16
435000 -- [-582.681] (-585.576) (-579.956) (-579.668) * [-579.840] (-576.613) (-583.822) (-575.899) -- 0:01:17
Average standard deviation of split frequencies: 0.009422
435500 -- (-580.013) [-576.205] (-585.383) (-579.608) * (-578.485) (-577.787) [-581.240] (-579.573) -- 0:01:17
436000 -- [-575.787] (-579.687) (-583.375) (-581.337) * (-581.325) [-577.646] (-581.711) (-582.742) -- 0:01:17
436500 -- (-573.777) (-582.882) [-583.318] (-579.591) * (-578.851) (-581.774) (-579.559) [-579.996] -- 0:01:17
437000 -- (-579.295) (-583.306) (-582.372) [-577.072] * (-584.618) (-576.869) [-580.175] (-579.327) -- 0:01:17
437500 -- (-580.274) (-574.987) (-577.444) [-578.209] * (-579.969) (-579.696) (-578.023) [-576.118] -- 0:01:17
438000 -- (-577.819) (-576.360) (-576.634) [-577.639] * (-580.120) (-581.525) [-584.491] (-575.272) -- 0:01:16
438500 -- (-574.857) (-578.793) [-587.558] (-578.181) * (-575.358) (-577.612) [-578.774] (-577.509) -- 0:01:16
439000 -- (-575.379) (-577.414) [-579.741] (-576.482) * [-580.220] (-576.719) (-579.860) (-579.681) -- 0:01:16
439500 -- (-575.478) (-579.894) [-579.052] (-579.580) * (-582.170) (-583.751) (-583.767) [-575.752] -- 0:01:16
440000 -- (-577.957) (-577.584) (-587.326) [-577.728] * (-580.581) (-583.493) (-584.822) [-573.527] -- 0:01:16
Average standard deviation of split frequencies: 0.009933
440500 -- (-577.622) (-579.332) (-576.713) [-579.903] * (-585.389) (-574.771) [-577.715] (-575.471) -- 0:01:16
441000 -- (-579.956) [-579.442] (-578.169) (-576.582) * (-588.104) (-581.631) [-574.797] (-574.462) -- 0:01:16
441500 -- [-582.567] (-576.808) (-582.274) (-577.283) * (-578.765) [-575.965] (-577.291) (-578.584) -- 0:01:15
442000 -- (-576.985) [-579.806] (-583.514) (-581.389) * [-576.532] (-576.705) (-578.472) (-590.497) -- 0:01:17
442500 -- [-576.502] (-579.445) (-578.678) (-581.169) * [-580.646] (-578.829) (-582.461) (-580.790) -- 0:01:16
443000 -- [-578.284] (-580.931) (-578.080) (-585.017) * (-585.112) [-575.264] (-582.303) (-580.150) -- 0:01:16
443500 -- (-582.540) (-582.956) (-578.694) [-579.630] * (-578.413) (-574.765) (-586.733) [-575.506] -- 0:01:16
444000 -- (-579.349) (-577.379) (-582.428) [-580.144] * [-577.190] (-577.807) (-576.851) (-578.323) -- 0:01:16
444500 -- [-575.079] (-583.426) (-577.801) (-580.570) * (-580.825) (-579.385) [-579.421] (-581.740) -- 0:01:16
445000 -- [-576.277] (-583.519) (-580.048) (-582.845) * (-579.897) (-581.194) (-578.970) [-573.600] -- 0:01:16
Average standard deviation of split frequencies: 0.009664
445500 -- (-580.785) (-582.564) [-578.280] (-585.055) * (-579.481) (-577.713) (-579.763) [-576.929] -- 0:01:15
446000 -- (-580.342) [-574.921] (-578.801) (-578.916) * (-580.448) [-580.025] (-583.466) (-582.427) -- 0:01:15
446500 -- [-576.622] (-576.969) (-578.877) (-582.808) * (-580.042) [-576.848] (-577.153) (-575.579) -- 0:01:15
447000 -- (-578.031) (-583.295) [-578.419] (-589.598) * (-579.235) (-577.970) (-575.500) [-578.552] -- 0:01:15
447500 -- (-576.360) (-578.824) [-584.307] (-582.668) * (-576.382) [-574.916] (-579.019) (-576.125) -- 0:01:15
448000 -- (-577.472) (-582.450) (-575.312) [-579.871] * [-578.600] (-582.651) (-579.422) (-589.560) -- 0:01:15
448500 -- [-583.001] (-577.242) (-574.563) (-578.488) * (-577.385) (-577.430) (-579.157) [-578.209] -- 0:01:15
449000 -- [-580.874] (-581.162) (-575.628) (-584.791) * (-578.559) (-573.755) (-581.358) [-579.812] -- 0:01:14
449500 -- (-587.281) [-578.110] (-580.104) (-576.718) * [-578.661] (-578.529) (-587.396) (-583.906) -- 0:01:15
450000 -- [-586.607] (-579.349) (-579.892) (-579.643) * (-583.426) (-597.506) (-580.913) [-578.988] -- 0:01:15
Average standard deviation of split frequencies: 0.009414
450500 -- (-578.181) [-573.194] (-575.439) (-582.527) * (-580.850) (-576.797) [-577.528] (-580.795) -- 0:01:15
451000 -- (-585.636) [-579.434] (-581.970) (-575.576) * [-580.393] (-578.010) (-580.157) (-582.242) -- 0:01:15
451500 -- (-589.476) (-580.510) (-578.179) [-575.449] * [-579.014] (-581.227) (-580.705) (-583.070) -- 0:01:15
452000 -- (-582.962) (-585.303) [-577.834] (-586.539) * (-576.415) (-581.628) [-575.566] (-580.642) -- 0:01:15
452500 -- (-583.795) (-581.627) [-577.002] (-582.918) * (-576.892) (-581.092) (-574.528) [-580.488] -- 0:01:15
453000 -- [-582.879] (-578.878) (-579.243) (-578.310) * (-586.915) (-584.086) (-584.052) [-577.544] -- 0:01:14
453500 -- (-582.840) [-575.851] (-577.871) (-580.191) * (-579.699) (-583.096) (-584.907) [-575.653] -- 0:01:14
454000 -- (-580.472) [-574.829] (-576.599) (-578.582) * (-586.150) (-577.417) (-584.595) [-578.823] -- 0:01:14
454500 -- (-577.859) (-577.733) (-579.808) [-579.372] * (-578.097) (-590.472) (-579.050) [-574.186] -- 0:01:14
455000 -- (-584.391) [-576.820] (-588.387) (-576.773) * (-585.962) [-578.949] (-587.621) (-577.358) -- 0:01:14
Average standard deviation of split frequencies: 0.009304
455500 -- (-585.124) (-581.393) [-575.273] (-576.681) * (-578.314) [-578.551] (-585.986) (-575.683) -- 0:01:14
456000 -- [-582.853] (-587.068) (-579.320) (-579.894) * (-581.998) (-583.572) [-579.144] (-580.584) -- 0:01:13
456500 -- [-583.878] (-581.139) (-578.802) (-578.416) * (-582.814) (-579.670) (-583.822) [-579.387] -- 0:01:13
457000 -- (-581.981) (-582.362) [-578.148] (-582.347) * (-579.408) (-574.909) (-579.869) [-579.305] -- 0:01:14
457500 -- (-581.893) (-580.750) [-575.054] (-577.532) * (-585.741) (-576.963) [-579.343] (-577.476) -- 0:01:14
458000 -- (-585.215) [-578.574] (-580.608) (-576.709) * (-575.761) (-582.826) (-581.787) [-579.299] -- 0:01:14
458500 -- (-581.648) (-576.052) [-578.588] (-583.131) * (-583.553) (-582.593) [-577.683] (-581.746) -- 0:01:14
459000 -- (-586.131) (-581.526) [-580.112] (-578.985) * (-583.830) (-581.460) [-575.077] (-577.533) -- 0:01:14
459500 -- [-578.107] (-579.189) (-581.152) (-582.151) * (-578.457) (-592.790) (-582.324) [-577.739] -- 0:01:14
460000 -- (-581.179) [-579.783] (-579.204) (-583.596) * (-578.035) (-581.692) (-581.137) [-578.130] -- 0:01:13
Average standard deviation of split frequencies: 0.009648
460500 -- (-579.769) (-579.232) (-576.055) [-577.643] * (-588.409) (-577.504) (-579.713) [-577.498] -- 0:01:13
461000 -- (-577.566) (-580.572) [-586.145] (-584.056) * [-580.222] (-582.718) (-578.536) (-580.644) -- 0:01:13
461500 -- (-578.058) [-574.828] (-573.932) (-575.638) * (-578.548) (-585.714) [-579.334] (-578.380) -- 0:01:13
462000 -- (-577.993) (-579.766) (-577.160) [-574.687] * (-577.318) (-579.962) [-593.374] (-579.460) -- 0:01:13
462500 -- [-585.656] (-578.454) (-577.983) (-578.339) * (-577.257) (-577.733) [-575.456] (-576.593) -- 0:01:13
463000 -- (-582.406) [-577.849] (-581.308) (-576.881) * (-578.375) [-580.057] (-580.804) (-584.267) -- 0:01:13
463500 -- (-579.373) (-582.495) (-582.533) [-583.481] * (-581.135) (-588.309) (-576.292) [-581.565] -- 0:01:12
464000 -- (-575.957) (-583.960) (-577.760) [-574.068] * (-578.585) (-582.191) (-581.490) [-578.399] -- 0:01:13
464500 -- (-577.402) (-576.797) [-577.960] (-588.745) * [-580.543] (-583.457) (-581.528) (-581.291) -- 0:01:13
465000 -- (-580.913) (-577.098) (-584.113) [-579.490] * [-582.933] (-583.472) (-579.623) (-578.523) -- 0:01:13
Average standard deviation of split frequencies: 0.009682
465500 -- (-575.701) (-576.282) [-587.618] (-577.896) * (-584.087) (-584.843) [-586.605] (-588.757) -- 0:01:13
466000 -- (-577.941) [-578.983] (-584.089) (-583.659) * (-587.006) (-583.099) [-581.174] (-582.436) -- 0:01:13
466500 -- (-581.703) [-577.627] (-586.027) (-577.925) * [-578.307] (-583.391) (-573.308) (-580.648) -- 0:01:13
467000 -- (-577.885) (-579.801) (-586.251) [-577.829] * (-581.694) (-579.040) [-573.679] (-574.865) -- 0:01:13
467500 -- (-585.523) (-586.350) (-580.596) [-580.289] * (-582.887) (-582.395) (-583.006) [-578.192] -- 0:01:12
468000 -- (-584.139) (-585.598) [-574.877] (-583.163) * [-583.111] (-580.440) (-582.299) (-583.731) -- 0:01:12
468500 -- (-578.138) (-581.273) (-577.118) [-580.574] * (-585.851) (-580.438) [-574.075] (-588.386) -- 0:01:12
469000 -- (-581.647) (-588.512) [-578.290] (-580.661) * [-580.095] (-586.039) (-583.257) (-594.808) -- 0:01:12
469500 -- (-584.280) (-577.609) (-583.613) [-580.027] * (-576.765) (-585.912) (-577.001) [-584.468] -- 0:01:12
470000 -- (-586.305) (-586.090) (-586.570) [-582.114] * (-581.402) (-579.440) [-581.618] (-580.683) -- 0:01:12
Average standard deviation of split frequencies: 0.009873
470500 -- (-574.795) (-582.982) (-578.461) [-579.134] * [-579.179] (-582.589) (-575.518) (-590.334) -- 0:01:12
471000 -- (-579.966) [-576.686] (-576.951) (-583.497) * [-576.088] (-579.909) (-579.038) (-581.153) -- 0:01:11
471500 -- (-579.357) (-584.476) [-574.581] (-584.364) * (-575.478) (-579.412) [-575.146] (-582.785) -- 0:01:12
472000 -- (-587.709) (-587.349) [-576.099] (-578.912) * (-583.370) (-577.040) [-583.504] (-588.527) -- 0:01:12
472500 -- [-573.208] (-578.092) (-576.906) (-583.014) * [-578.586] (-577.100) (-577.386) (-582.564) -- 0:01:12
473000 -- (-579.391) (-573.468) (-576.492) [-578.301] * [-578.246] (-579.379) (-584.190) (-587.456) -- 0:01:12
473500 -- (-573.550) (-577.850) [-575.778] (-583.410) * (-588.621) (-578.294) (-582.535) [-579.375] -- 0:01:12
474000 -- (-578.198) [-575.008] (-575.872) (-584.944) * [-582.161] (-583.057) (-578.662) (-580.795) -- 0:01:12
474500 -- (-582.774) (-575.506) [-577.499] (-583.557) * (-581.896) [-585.466] (-578.452) (-583.061) -- 0:01:11
475000 -- (-577.309) [-579.387] (-582.249) (-587.337) * (-581.045) [-576.071] (-579.980) (-586.063) -- 0:01:11
Average standard deviation of split frequencies: 0.009479
475500 -- (-575.276) [-577.510] (-580.236) (-584.113) * (-586.397) [-581.044] (-576.180) (-583.045) -- 0:01:11
476000 -- (-577.396) (-583.264) [-575.034] (-585.122) * [-580.611] (-584.651) (-580.592) (-580.639) -- 0:01:11
476500 -- [-579.956] (-577.703) (-586.327) (-583.497) * (-583.957) (-579.899) [-580.295] (-581.458) -- 0:01:11
477000 -- [-581.546] (-582.970) (-580.212) (-577.679) * (-581.186) [-577.381] (-574.922) (-582.066) -- 0:01:11
477500 -- (-582.594) (-577.214) (-583.779) [-578.047] * (-588.828) (-579.480) (-578.500) [-580.957] -- 0:01:11
478000 -- [-580.957] (-581.728) (-583.739) (-576.593) * [-584.602] (-576.669) (-584.765) (-583.077) -- 0:01:10
478500 -- [-581.659] (-580.471) (-578.185) (-576.160) * [-584.915] (-579.150) (-583.955) (-580.055) -- 0:01:10
479000 -- [-577.589] (-585.290) (-580.306) (-577.246) * (-581.393) (-581.817) (-579.640) [-584.678] -- 0:01:11
479500 -- (-583.908) (-584.319) [-582.290] (-578.716) * (-577.226) (-590.740) [-576.481] (-579.668) -- 0:01:11
480000 -- (-577.465) (-576.384) [-584.425] (-581.485) * [-574.378] (-586.404) (-575.507) (-577.819) -- 0:01:11
Average standard deviation of split frequencies: 0.011489
480500 -- (-583.027) (-583.749) (-581.604) [-577.481] * (-582.354) (-585.774) [-578.635] (-587.258) -- 0:01:11
481000 -- [-581.923] (-586.468) (-581.055) (-575.114) * (-581.018) [-579.959] (-578.305) (-580.947) -- 0:01:11
481500 -- (-579.118) (-579.042) (-579.326) [-582.166] * [-578.908] (-574.150) (-579.157) (-575.145) -- 0:01:11
482000 -- (-579.164) (-582.688) (-582.700) [-579.248] * (-584.219) (-583.385) (-583.445) [-574.612] -- 0:01:10
482500 -- (-584.403) (-577.837) [-574.373] (-577.872) * (-585.151) (-580.598) (-574.253) [-577.699] -- 0:01:10
483000 -- (-580.574) [-577.071] (-583.039) (-576.445) * [-579.223] (-578.790) (-577.829) (-575.835) -- 0:01:10
483500 -- (-582.242) (-577.356) [-580.596] (-577.988) * (-576.775) (-581.544) [-575.896] (-577.790) -- 0:01:10
484000 -- (-576.797) [-581.536] (-586.422) (-575.452) * (-577.703) (-585.232) [-578.159] (-589.974) -- 0:01:10
484500 -- [-576.356] (-577.115) (-586.084) (-574.579) * [-578.536] (-582.527) (-578.187) (-579.004) -- 0:01:10
485000 -- (-581.212) (-580.001) (-580.169) [-579.356] * [-578.753] (-587.067) (-579.094) (-580.061) -- 0:01:10
Average standard deviation of split frequencies: 0.011501
485500 -- (-581.593) (-585.772) [-582.467] (-574.408) * (-579.583) [-580.796] (-575.055) (-580.381) -- 0:01:09
486000 -- (-577.869) (-581.674) (-579.036) [-582.331] * (-579.187) (-581.416) (-580.060) [-576.619] -- 0:01:09
486500 -- (-575.942) [-582.689] (-583.086) (-585.331) * [-579.299] (-589.402) (-581.254) (-585.218) -- 0:01:10
487000 -- [-581.209] (-576.824) (-578.621) (-572.829) * [-580.374] (-582.946) (-579.112) (-578.804) -- 0:01:10
487500 -- (-578.717) (-576.633) [-580.736] (-575.605) * (-583.985) (-576.615) (-576.667) [-578.902] -- 0:01:10
488000 -- (-578.901) [-575.474] (-582.599) (-583.851) * (-585.712) [-585.690] (-574.587) (-578.181) -- 0:01:10
488500 -- (-581.533) (-585.569) (-579.509) [-581.299] * (-585.103) (-582.130) [-580.685] (-577.702) -- 0:01:10
489000 -- (-581.315) [-579.145] (-579.324) (-577.978) * [-578.905] (-585.596) (-578.281) (-578.582) -- 0:01:10
489500 -- [-577.735] (-580.753) (-577.391) (-576.652) * (-583.548) (-580.946) (-581.069) [-578.104] -- 0:01:09
490000 -- [-581.157] (-573.631) (-576.639) (-580.638) * (-583.613) [-581.859] (-584.214) (-577.099) -- 0:01:09
Average standard deviation of split frequencies: 0.010843
490500 -- (-578.520) (-578.128) [-576.579] (-579.167) * (-582.506) (-578.110) [-577.349] (-575.408) -- 0:01:09
491000 -- (-581.180) (-578.180) [-578.067] (-584.390) * (-580.071) (-580.632) (-577.627) [-578.146] -- 0:01:09
491500 -- (-590.066) (-578.617) (-581.059) [-577.563] * (-584.158) [-582.662] (-577.241) (-576.924) -- 0:01:09
492000 -- [-580.920] (-579.051) (-575.969) (-577.312) * (-579.783) (-578.819) [-581.327] (-578.960) -- 0:01:09
492500 -- (-587.440) (-582.258) (-575.664) [-579.731] * (-579.930) [-575.800] (-581.716) (-578.625) -- 0:01:09
493000 -- (-586.196) [-582.099] (-580.847) (-581.355) * (-581.492) (-580.856) (-577.040) [-581.354] -- 0:01:08
493500 -- (-578.783) (-577.166) [-577.009] (-578.369) * (-580.371) (-577.114) [-576.818] (-583.223) -- 0:01:09
494000 -- (-591.158) (-585.573) (-577.790) [-584.128] * [-577.217] (-585.642) (-588.806) (-580.954) -- 0:01:09
494500 -- [-581.664] (-589.260) (-573.697) (-585.384) * [-572.508] (-575.215) (-581.260) (-580.563) -- 0:01:09
495000 -- (-579.263) (-585.921) [-579.777] (-584.571) * (-574.230) (-576.129) (-583.341) [-582.999] -- 0:01:09
Average standard deviation of split frequencies: 0.010726
495500 -- (-581.887) (-576.415) [-576.084] (-579.924) * (-576.692) (-587.275) (-582.288) [-577.915] -- 0:01:09
496000 -- (-580.772) (-579.277) [-574.218] (-580.990) * [-581.091] (-575.391) (-582.158) (-577.228) -- 0:01:09
496500 -- (-581.519) (-576.291) [-575.962] (-578.513) * [-586.168] (-579.651) (-588.010) (-586.699) -- 0:01:08
497000 -- [-580.066] (-581.557) (-581.712) (-584.177) * [-577.882] (-583.089) (-589.331) (-579.545) -- 0:01:08
497500 -- (-584.716) [-577.395] (-582.448) (-573.956) * (-580.391) (-580.467) (-580.807) [-583.863] -- 0:01:08
498000 -- (-590.128) [-579.869] (-581.868) (-574.830) * (-578.957) [-580.528] (-583.292) (-581.010) -- 0:01:08
498500 -- (-579.042) (-571.727) [-577.568] (-578.799) * (-576.010) (-579.228) [-578.620] (-579.436) -- 0:01:08
499000 -- (-578.437) (-578.130) [-580.103] (-584.138) * (-577.509) (-581.572) [-584.950] (-582.365) -- 0:01:08
499500 -- [-581.141] (-583.560) (-578.492) (-574.721) * [-576.360] (-580.574) (-583.468) (-579.744) -- 0:01:08
500000 -- [-577.022] (-584.860) (-581.490) (-577.554) * [-578.085] (-588.302) (-588.118) (-584.108) -- 0:01:08
Average standard deviation of split frequencies: 0.011030
500500 -- (-577.620) (-586.442) (-576.995) [-577.891] * (-577.057) [-573.937] (-589.864) (-583.470) -- 0:01:07
501000 -- (-583.389) (-576.728) [-578.153] (-576.284) * (-582.645) (-576.644) [-581.618] (-583.666) -- 0:01:08
501500 -- (-575.666) (-581.997) [-579.229] (-576.469) * (-579.624) [-576.367] (-585.341) (-579.938) -- 0:01:08
502000 -- (-577.577) (-578.924) (-580.530) [-577.864] * (-576.126) [-582.014] (-588.852) (-580.774) -- 0:01:08
502500 -- (-580.500) (-589.107) (-575.712) [-580.006] * [-575.344] (-579.810) (-578.256) (-583.648) -- 0:01:08
503000 -- [-576.723] (-575.989) (-579.562) (-580.271) * (-571.920) [-579.458] (-586.313) (-582.510) -- 0:01:08
503500 -- (-578.905) (-579.692) (-577.328) [-575.121] * (-580.621) (-586.307) [-581.115] (-592.007) -- 0:01:08
504000 -- (-582.601) (-581.071) (-579.437) [-578.363] * [-578.977] (-581.691) (-578.372) (-591.866) -- 0:01:07
504500 -- [-581.440] (-590.974) (-584.363) (-577.086) * [-575.893] (-580.932) (-580.618) (-584.780) -- 0:01:07
505000 -- [-577.045] (-589.194) (-582.297) (-576.681) * (-576.541) (-579.493) (-581.734) [-579.541] -- 0:01:07
Average standard deviation of split frequencies: 0.009849
505500 -- (-576.535) (-595.286) [-584.080] (-582.250) * [-577.416] (-579.727) (-582.738) (-577.438) -- 0:01:07
506000 -- (-575.700) (-591.800) (-574.860) [-576.773] * [-577.823] (-583.081) (-577.267) (-583.008) -- 0:01:07
506500 -- (-584.281) (-585.516) (-581.832) [-573.050] * [-577.042] (-579.968) (-581.865) (-579.841) -- 0:01:07
507000 -- (-586.268) [-586.282] (-581.098) (-574.779) * [-583.170] (-575.969) (-582.282) (-576.743) -- 0:01:07
507500 -- (-578.806) (-579.501) [-578.795] (-577.275) * [-577.354] (-579.617) (-584.021) (-582.519) -- 0:01:06
508000 -- (-577.419) [-575.376] (-579.979) (-576.505) * (-576.379) (-581.454) (-579.085) [-575.720] -- 0:01:06
508500 -- [-579.967] (-575.112) (-575.053) (-578.964) * (-582.496) (-582.301) (-577.116) [-581.338] -- 0:01:07
509000 -- (-583.342) (-580.376) (-578.339) [-586.146] * (-575.641) [-574.074] (-575.612) (-583.564) -- 0:01:07
509500 -- [-575.841] (-573.398) (-574.890) (-579.039) * (-578.569) [-576.112] (-580.395) (-586.527) -- 0:01:07
510000 -- (-582.810) [-578.151] (-577.231) (-577.896) * (-577.507) (-584.774) (-579.354) [-576.001] -- 0:01:07
Average standard deviation of split frequencies: 0.009495
510500 -- (-581.671) [-578.345] (-582.349) (-576.742) * [-577.924] (-580.062) (-575.844) (-578.028) -- 0:01:07
511000 -- (-579.427) [-581.512] (-578.640) (-577.123) * (-573.777) (-580.872) [-576.791] (-578.915) -- 0:01:06
511500 -- (-579.143) [-590.484] (-579.112) (-581.775) * [-575.633] (-578.954) (-575.945) (-579.711) -- 0:01:06
512000 -- (-583.982) [-580.070] (-577.346) (-579.702) * (-576.424) [-577.664] (-581.133) (-584.523) -- 0:01:06
512500 -- [-578.477] (-578.523) (-591.917) (-578.415) * [-575.917] (-576.911) (-578.899) (-588.620) -- 0:01:06
513000 -- (-575.630) (-579.069) (-579.508) [-578.039] * [-576.639] (-577.979) (-579.325) (-586.842) -- 0:01:06
513500 -- (-579.020) [-578.046] (-582.624) (-583.338) * (-579.250) (-582.668) (-584.416) [-579.565] -- 0:01:06
514000 -- [-575.229] (-584.130) (-577.277) (-583.740) * (-580.675) (-577.628) [-577.890] (-582.019) -- 0:01:06
514500 -- [-579.113] (-576.988) (-581.628) (-585.492) * (-580.081) (-578.975) (-577.442) [-575.752] -- 0:01:06
515000 -- (-582.439) (-578.965) [-575.011] (-590.184) * [-578.500] (-583.847) (-575.623) (-577.198) -- 0:01:05
Average standard deviation of split frequencies: 0.010180
515500 -- (-576.827) [-575.019] (-574.107) (-577.537) * (-581.271) (-585.173) [-574.451] (-582.831) -- 0:01:06
516000 -- (-582.937) (-580.785) [-577.453] (-580.823) * (-578.480) (-583.203) (-584.400) [-582.642] -- 0:01:06
516500 -- (-583.250) [-577.669] (-576.333) (-583.370) * (-576.581) (-581.146) [-583.401] (-584.502) -- 0:01:06
517000 -- (-582.251) (-574.823) [-577.563] (-583.804) * (-580.938) (-580.298) [-580.433] (-583.754) -- 0:01:06
517500 -- [-575.307] (-577.411) (-581.222) (-578.785) * (-578.862) (-581.630) (-576.567) [-581.672] -- 0:01:06
518000 -- [-578.598] (-581.332) (-584.278) (-579.462) * (-576.353) (-585.530) (-577.982) [-575.708] -- 0:01:06
518500 -- (-576.610) [-577.533] (-574.597) (-579.993) * (-581.071) [-577.779] (-579.977) (-583.581) -- 0:01:05
519000 -- [-581.396] (-580.043) (-576.366) (-579.182) * (-577.802) (-586.068) (-581.021) [-578.847] -- 0:01:05
519500 -- (-575.918) (-582.037) [-581.356] (-581.176) * (-578.018) (-587.765) [-580.203] (-586.021) -- 0:01:05
520000 -- [-574.637] (-576.684) (-584.299) (-585.327) * [-579.159] (-584.966) (-579.186) (-580.890) -- 0:01:05
Average standard deviation of split frequencies: 0.009959
520500 -- (-579.848) (-579.608) (-596.292) [-580.929] * [-579.254] (-582.405) (-584.798) (-583.787) -- 0:01:05
521000 -- [-579.584] (-583.336) (-580.662) (-575.323) * (-579.896) (-580.035) (-584.655) [-576.315] -- 0:01:05
521500 -- (-588.303) (-581.966) [-577.491] (-579.150) * (-579.594) (-582.117) [-580.077] (-575.837) -- 0:01:05
522000 -- (-583.752) (-581.346) (-585.601) [-578.045] * (-584.198) (-586.886) (-580.964) [-581.179] -- 0:01:05
522500 -- [-578.999] (-583.514) (-582.033) (-576.035) * (-582.601) (-576.799) (-585.510) [-576.951] -- 0:01:04
523000 -- (-576.677) (-582.730) (-582.204) [-581.330] * (-576.814) [-583.569] (-587.874) (-577.354) -- 0:01:05
523500 -- (-585.317) [-584.331] (-586.813) (-579.299) * (-579.151) (-578.610) (-587.904) [-576.527] -- 0:01:05
524000 -- (-585.599) [-579.652] (-580.477) (-578.887) * [-576.971] (-576.998) (-583.271) (-579.092) -- 0:01:05
524500 -- (-586.764) [-581.899] (-587.439) (-577.822) * (-577.113) [-577.286] (-579.241) (-580.538) -- 0:01:05
525000 -- [-584.469] (-582.133) (-579.248) (-583.559) * (-581.985) [-582.329] (-582.066) (-582.065) -- 0:01:05
Average standard deviation of split frequencies: 0.009346
525500 -- (-577.080) (-577.622) [-579.633] (-579.895) * (-576.100) (-579.769) [-580.534] (-577.858) -- 0:01:05
526000 -- (-579.820) (-579.288) (-587.312) [-579.339] * [-586.091] (-579.356) (-584.297) (-581.856) -- 0:01:04
526500 -- (-579.166) [-575.954] (-576.750) (-582.402) * (-578.123) [-583.136] (-586.175) (-580.738) -- 0:01:04
527000 -- (-580.902) [-574.524] (-582.964) (-583.948) * (-586.801) (-579.273) (-577.977) [-575.223] -- 0:01:04
527500 -- (-579.457) (-574.811) (-578.517) [-577.687] * (-578.667) (-580.380) [-575.607] (-577.062) -- 0:01:04
528000 -- (-586.428) (-578.382) [-580.636] (-577.105) * [-576.708] (-577.914) (-585.835) (-576.717) -- 0:01:04
528500 -- (-585.936) (-577.299) (-579.126) [-577.683] * (-579.274) [-580.870] (-582.627) (-576.705) -- 0:01:04
529000 -- (-578.434) (-584.935) [-580.649] (-579.122) * (-583.402) (-578.551) [-580.401] (-589.012) -- 0:01:04
529500 -- (-578.783) (-578.429) (-585.068) [-576.634] * (-579.992) (-579.962) [-581.389] (-582.108) -- 0:01:03
530000 -- [-582.245] (-582.444) (-580.625) (-582.642) * (-583.228) [-576.987] (-578.356) (-578.478) -- 0:01:04
Average standard deviation of split frequencies: 0.008249
530500 -- (-581.775) (-582.585) [-578.930] (-580.034) * (-590.437) (-577.256) [-584.471] (-579.358) -- 0:01:04
531000 -- (-581.389) [-580.839] (-584.455) (-573.384) * (-585.406) [-577.045] (-577.542) (-580.065) -- 0:01:04
531500 -- (-582.009) (-577.296) (-580.411) [-580.273] * (-579.393) [-580.760] (-579.269) (-582.538) -- 0:01:04
532000 -- (-576.487) [-579.521] (-578.761) (-574.822) * (-582.908) (-584.443) (-584.244) [-579.616] -- 0:01:04
532500 -- (-579.635) (-582.552) (-580.141) [-576.355] * (-581.896) (-577.199) (-581.795) [-582.464] -- 0:01:04
533000 -- (-587.143) (-587.788) [-575.310] (-578.965) * [-583.663] (-575.873) (-586.537) (-580.631) -- 0:01:03
533500 -- (-577.326) (-584.431) [-577.261] (-581.765) * (-581.394) [-581.033] (-580.880) (-581.601) -- 0:01:03
534000 -- (-579.309) [-580.430] (-582.179) (-587.431) * (-581.080) (-577.786) (-580.282) [-584.000] -- 0:01:03
534500 -- (-580.885) (-580.038) [-577.798] (-584.178) * [-587.141] (-580.346) (-575.282) (-579.231) -- 0:01:03
535000 -- (-584.349) [-583.263] (-579.084) (-576.872) * (-583.486) [-573.284] (-579.377) (-584.658) -- 0:01:03
Average standard deviation of split frequencies: 0.007538
535500 -- (-588.703) (-579.227) (-581.597) [-583.318] * [-579.652] (-582.042) (-580.364) (-588.214) -- 0:01:03
536000 -- (-579.433) (-577.899) (-579.132) [-581.808] * (-580.962) [-577.775] (-576.159) (-583.464) -- 0:01:03
536500 -- (-577.319) (-579.523) (-585.022) [-577.902] * (-578.391) [-580.610] (-578.749) (-581.995) -- 0:01:03
537000 -- (-586.084) (-583.463) (-582.935) [-582.805] * (-577.139) [-577.912] (-578.860) (-578.551) -- 0:01:02
537500 -- (-579.338) (-583.849) (-582.904) [-583.076] * (-578.225) (-574.995) [-583.281] (-578.963) -- 0:01:03
538000 -- (-577.209) (-579.644) (-584.791) [-579.597] * (-580.138) (-576.097) [-572.385] (-578.259) -- 0:01:03
538500 -- (-583.270) (-577.437) [-577.195] (-582.031) * [-575.381] (-580.957) (-582.352) (-576.946) -- 0:01:03
539000 -- [-575.880] (-581.460) (-582.136) (-580.904) * (-580.046) (-577.307) [-581.844] (-579.923) -- 0:01:03
539500 -- (-576.328) (-578.903) [-579.770] (-580.155) * (-581.653) (-579.013) [-578.874] (-578.087) -- 0:01:03
540000 -- [-582.065] (-585.245) (-576.314) (-575.448) * (-578.055) (-581.701) (-579.151) [-576.612] -- 0:01:03
Average standard deviation of split frequencies: 0.007224
540500 -- [-578.450] (-585.312) (-579.103) (-577.380) * (-583.465) [-578.619] (-589.856) (-580.784) -- 0:01:02
541000 -- [-575.743] (-582.721) (-582.001) (-580.922) * [-587.504] (-577.441) (-582.907) (-581.310) -- 0:01:02
541500 -- [-575.571] (-577.849) (-575.686) (-584.261) * (-584.140) [-578.949] (-578.459) (-580.883) -- 0:01:02
542000 -- [-580.790] (-582.539) (-575.810) (-582.253) * (-587.961) (-580.363) [-582.454] (-581.244) -- 0:01:02
542500 -- [-580.925] (-580.564) (-584.898) (-579.172) * (-583.963) (-578.680) [-578.410] (-581.224) -- 0:01:02
543000 -- [-578.320] (-576.288) (-578.332) (-578.317) * (-581.875) (-583.487) (-582.212) [-577.893] -- 0:01:02
543500 -- [-576.018] (-578.232) (-583.375) (-578.676) * (-578.755) (-579.584) (-580.508) [-581.239] -- 0:01:02
544000 -- [-578.749] (-577.811) (-578.437) (-580.262) * (-581.811) [-579.497] (-575.412) (-584.144) -- 0:01:02
544500 -- [-575.089] (-578.994) (-577.126) (-576.690) * (-585.636) [-576.148] (-578.895) (-585.288) -- 0:01:02
545000 -- (-581.050) (-578.030) (-583.857) [-579.930] * [-577.185] (-580.655) (-578.241) (-580.990) -- 0:01:02
Average standard deviation of split frequencies: 0.006660
545500 -- [-577.260] (-579.247) (-581.276) (-578.007) * (-579.400) (-577.150) (-583.118) [-580.513] -- 0:01:02
546000 -- (-576.666) (-576.862) [-578.823] (-589.600) * [-582.403] (-584.380) (-579.234) (-579.726) -- 0:01:02
546500 -- (-579.951) (-580.511) (-583.169) [-580.392] * (-580.450) (-582.703) (-580.904) [-578.578] -- 0:01:02
547000 -- (-586.571) (-580.126) (-579.453) [-583.198] * (-584.131) (-588.115) (-576.213) [-574.801] -- 0:01:02
547500 -- (-581.527) [-576.241] (-577.559) (-582.623) * (-577.393) [-576.338] (-586.219) (-577.210) -- 0:01:01
548000 -- (-579.710) (-579.253) [-580.603] (-582.169) * (-576.439) [-575.836] (-577.696) (-581.461) -- 0:01:01
548500 -- (-583.675) (-581.194) [-580.598] (-576.700) * (-581.052) [-577.028] (-574.744) (-574.734) -- 0:01:01
549000 -- [-578.928] (-580.007) (-585.177) (-579.377) * (-578.215) (-576.936) [-578.135] (-578.973) -- 0:01:01
549500 -- (-582.854) (-586.297) [-583.495] (-575.229) * (-578.076) (-577.510) [-580.015] (-578.895) -- 0:01:01
550000 -- (-583.533) (-580.796) (-581.413) [-578.095] * (-575.980) (-580.012) (-580.932) [-576.503] -- 0:01:01
Average standard deviation of split frequencies: 0.006482
550500 -- (-582.939) (-575.823) [-576.285] (-587.735) * (-580.453) [-577.395] (-593.441) (-578.553) -- 0:01:01
551000 -- (-579.525) (-573.768) (-578.171) [-577.167] * [-574.750] (-579.890) (-584.296) (-582.819) -- 0:01:01
551500 -- (-578.480) [-579.099] (-575.077) (-579.859) * (-572.288) [-580.109] (-588.025) (-575.980) -- 0:01:00
552000 -- (-581.665) (-580.066) [-577.400] (-580.783) * [-575.485] (-584.082) (-577.363) (-576.472) -- 0:01:01
552500 -- (-585.008) (-582.468) [-576.434] (-581.766) * (-576.894) (-579.051) [-583.239] (-581.343) -- 0:01:01
553000 -- (-587.941) [-575.736] (-582.417) (-577.181) * [-575.699] (-578.548) (-581.773) (-575.816) -- 0:01:01
553500 -- (-584.207) (-576.500) [-576.009] (-578.152) * (-577.238) [-575.223] (-579.665) (-575.716) -- 0:01:01
554000 -- (-579.339) [-575.477] (-574.939) (-578.251) * (-584.240) (-585.175) [-580.045] (-579.594) -- 0:01:01
554500 -- (-578.782) (-580.722) (-585.787) [-581.417] * (-577.292) (-584.036) (-580.007) [-577.336] -- 0:01:01
555000 -- [-575.388] (-577.530) (-577.208) (-581.615) * [-576.695] (-584.281) (-581.664) (-580.633) -- 0:01:00
Average standard deviation of split frequencies: 0.006662
555500 -- [-577.605] (-577.181) (-583.053) (-580.959) * [-574.875] (-579.814) (-578.327) (-582.654) -- 0:01:00
556000 -- (-576.270) (-583.598) [-582.119] (-583.654) * (-577.520) (-586.620) (-580.232) [-579.113] -- 0:01:00
556500 -- (-579.543) [-584.268] (-579.730) (-583.512) * [-581.380] (-584.468) (-579.345) (-574.766) -- 0:01:00
557000 -- (-575.199) [-584.384] (-576.656) (-584.324) * (-580.489) (-586.579) [-579.935] (-579.627) -- 0:01:00
557500 -- (-578.164) (-584.227) (-583.201) [-580.395] * (-577.601) [-581.476] (-577.321) (-581.705) -- 0:01:00
558000 -- (-583.339) (-585.910) (-574.390) [-581.259] * [-578.701] (-576.151) (-578.464) (-586.450) -- 0:01:00
558500 -- (-575.112) (-576.905) [-577.767] (-578.882) * [-575.926] (-578.888) (-582.050) (-580.098) -- 0:01:00
559000 -- (-581.965) (-582.082) [-577.842] (-579.582) * (-576.574) [-586.315] (-582.050) (-582.439) -- 0:00:59
559500 -- (-579.141) (-580.336) [-582.260] (-580.339) * (-584.677) (-587.093) [-577.850] (-578.837) -- 0:01:00
560000 -- (-581.329) (-581.771) (-587.043) [-580.427] * (-578.166) (-580.868) [-577.870] (-578.437) -- 0:01:00
Average standard deviation of split frequencies: 0.006486
560500 -- [-582.028] (-575.961) (-586.661) (-581.334) * (-577.841) (-587.832) (-575.245) [-576.794] -- 0:01:00
561000 -- (-580.968) (-582.852) (-585.696) [-576.533] * [-578.714] (-588.968) (-578.477) (-584.919) -- 0:01:00
561500 -- (-578.838) (-581.672) [-582.640] (-581.297) * [-577.447] (-584.913) (-584.228) (-583.035) -- 0:01:00
562000 -- (-584.483) [-574.758] (-580.245) (-579.318) * (-584.416) (-583.020) [-579.850] (-577.087) -- 0:01:00
562500 -- (-580.863) [-580.237] (-580.602) (-580.306) * [-580.228] (-582.700) (-578.187) (-578.624) -- 0:00:59
563000 -- (-583.755) (-581.070) (-575.447) [-574.470] * (-579.231) (-578.027) [-577.968] (-576.488) -- 0:00:59
563500 -- [-582.783] (-588.722) (-578.550) (-580.912) * (-574.779) (-580.023) (-576.752) [-585.239] -- 0:00:59
564000 -- [-583.039] (-576.414) (-578.073) (-580.126) * (-575.738) [-585.245] (-574.137) (-577.460) -- 0:00:59
564500 -- (-582.343) [-577.938] (-577.684) (-579.454) * (-576.830) [-580.993] (-579.385) (-582.900) -- 0:00:59
565000 -- (-589.480) [-575.326] (-576.565) (-585.625) * (-583.073) (-575.642) (-577.483) [-579.936] -- 0:00:59
Average standard deviation of split frequencies: 0.006187
565500 -- (-586.641) [-580.416] (-575.659) (-577.712) * (-579.468) (-579.384) [-576.628] (-580.617) -- 0:00:59
566000 -- (-583.438) [-580.205] (-576.316) (-576.387) * (-580.455) [-575.933] (-581.106) (-578.350) -- 0:00:59
566500 -- (-576.527) (-574.993) (-577.867) [-582.091] * [-589.595] (-577.814) (-578.648) (-583.289) -- 0:00:59
567000 -- [-575.509] (-582.887) (-595.714) (-576.412) * (-583.103) (-584.310) [-577.059] (-582.556) -- 0:00:59
567500 -- (-577.292) [-577.757] (-577.413) (-584.334) * (-587.011) (-579.405) [-575.414] (-586.039) -- 0:00:59
568000 -- (-585.230) (-576.875) [-576.730] (-580.242) * [-583.003] (-581.698) (-575.314) (-581.280) -- 0:00:59
568500 -- [-583.849] (-578.240) (-577.755) (-581.956) * (-579.685) [-579.268] (-581.720) (-579.504) -- 0:00:59
569000 -- (-587.717) (-580.455) [-579.136] (-586.351) * [-581.678] (-580.822) (-573.813) (-580.485) -- 0:00:59
569500 -- (-583.216) (-577.913) (-585.235) [-580.887] * (-582.237) (-580.310) [-576.522] (-590.791) -- 0:00:58
570000 -- (-576.923) (-579.100) (-576.329) [-582.485] * (-584.443) (-578.249) [-573.604] (-587.403) -- 0:00:58
Average standard deviation of split frequencies: 0.005192
570500 -- (-581.891) (-578.759) (-583.562) [-581.189] * [-576.631] (-581.085) (-580.261) (-583.708) -- 0:00:58
571000 -- (-583.548) (-583.335) [-576.353] (-579.213) * (-580.509) [-574.839] (-582.459) (-582.130) -- 0:00:58
571500 -- (-579.064) [-575.626] (-579.876) (-579.216) * [-582.645] (-584.713) (-577.316) (-589.788) -- 0:00:58
572000 -- (-584.924) (-577.367) (-578.212) [-577.368] * [-576.758] (-579.061) (-580.469) (-580.621) -- 0:00:58
572500 -- [-579.157] (-576.991) (-575.741) (-580.945) * (-582.838) (-581.879) (-580.805) [-577.066] -- 0:00:58
573000 -- (-577.576) [-575.632] (-579.456) (-589.344) * [-578.812] (-588.197) (-580.798) (-577.913) -- 0:00:58
573500 -- (-582.518) (-579.697) [-576.977] (-581.665) * (-580.548) [-577.860] (-579.160) (-578.592) -- 0:00:58
574000 -- (-578.407) [-576.099] (-586.528) (-582.541) * (-581.670) (-578.724) (-583.646) [-578.536] -- 0:00:58
574500 -- (-578.743) [-574.787] (-582.220) (-584.174) * [-583.559] (-576.803) (-587.276) (-576.719) -- 0:00:58
575000 -- [-585.055] (-582.846) (-578.605) (-580.251) * (-581.501) (-578.071) (-579.425) [-575.622] -- 0:00:58
Average standard deviation of split frequencies: 0.005963
575500 -- [-585.165] (-580.030) (-584.316) (-585.319) * (-587.517) (-576.341) [-579.876] (-574.412) -- 0:00:58
576000 -- (-586.601) (-589.285) [-580.407] (-587.238) * (-579.876) [-578.614] (-575.348) (-577.313) -- 0:00:58
576500 -- (-587.273) (-579.911) (-577.109) [-584.668] * [-589.903] (-580.675) (-579.780) (-578.704) -- 0:00:58
577000 -- (-583.328) (-585.125) [-581.101] (-579.902) * (-580.299) (-575.882) (-583.022) [-574.256] -- 0:00:57
577500 -- (-579.831) (-580.043) (-578.425) [-576.610] * (-588.807) [-582.166] (-577.287) (-573.909) -- 0:00:57
578000 -- (-577.745) (-578.981) [-585.797] (-579.133) * (-578.905) [-573.726] (-583.408) (-575.576) -- 0:00:57
578500 -- (-587.114) (-584.025) (-582.572) [-577.144] * [-578.343] (-578.657) (-574.348) (-580.191) -- 0:00:57
579000 -- [-578.799] (-576.087) (-576.595) (-577.571) * (-580.035) (-583.404) [-578.508] (-577.351) -- 0:00:57
579500 -- (-582.432) (-576.669) (-581.496) [-575.747] * (-589.090) (-579.436) (-576.465) [-576.090] -- 0:00:57
580000 -- (-575.633) (-574.068) (-575.434) [-576.043] * (-575.424) (-581.724) (-578.737) [-577.455] -- 0:00:57
Average standard deviation of split frequencies: 0.006611
580500 -- [-574.827] (-578.590) (-581.797) (-575.220) * (-578.676) (-578.780) [-580.042] (-581.338) -- 0:00:57
581000 -- (-578.140) (-576.045) [-586.854] (-578.851) * (-582.753) (-577.096) [-579.124] (-578.964) -- 0:00:56
581500 -- (-582.435) [-580.526] (-588.487) (-575.021) * (-583.049) (-576.984) (-577.688) [-576.911] -- 0:00:57
582000 -- [-576.456] (-574.995) (-578.147) (-575.668) * (-579.536) (-580.756) [-576.385] (-576.293) -- 0:00:57
582500 -- (-579.467) (-585.758) (-580.830) [-576.967] * (-580.435) (-595.150) (-575.477) [-577.843] -- 0:00:57
583000 -- [-582.740] (-579.805) (-583.350) (-577.532) * [-577.787] (-576.718) (-577.210) (-582.694) -- 0:00:57
583500 -- (-580.634) [-580.201] (-580.478) (-576.228) * [-577.715] (-579.396) (-578.648) (-582.304) -- 0:00:57
584000 -- (-579.506) (-586.176) (-582.431) [-577.045] * (-579.752) (-586.366) [-574.337] (-580.119) -- 0:00:56
584500 -- [-576.152] (-585.294) (-579.588) (-580.134) * [-582.529] (-579.511) (-583.031) (-579.921) -- 0:00:56
585000 -- (-581.294) (-583.422) (-576.194) [-578.056] * [-578.107] (-579.861) (-578.171) (-583.376) -- 0:00:56
Average standard deviation of split frequencies: 0.007125
585500 -- [-580.052] (-587.322) (-577.441) (-574.476) * [-580.993] (-577.027) (-578.830) (-586.778) -- 0:00:56
586000 -- (-579.537) [-579.252] (-580.878) (-574.727) * (-581.389) [-578.650] (-578.864) (-579.734) -- 0:00:56
586500 -- (-584.484) (-581.128) (-587.640) [-575.626] * [-578.657] (-576.897) (-583.506) (-583.929) -- 0:00:56
587000 -- (-580.727) (-581.502) (-580.859) [-581.598] * [-579.077] (-576.662) (-583.456) (-583.617) -- 0:00:56
587500 -- (-580.063) [-577.552] (-574.662) (-580.314) * (-586.003) (-587.665) [-574.258] (-581.319) -- 0:00:56
588000 -- [-580.884] (-577.940) (-576.456) (-580.319) * [-579.640] (-581.263) (-578.638) (-591.158) -- 0:00:56
588500 -- [-581.890] (-583.369) (-579.795) (-576.819) * (-576.228) (-583.341) [-581.197] (-584.193) -- 0:00:56
589000 -- (-578.885) (-582.393) [-576.442] (-581.071) * (-579.272) (-578.937) (-585.701) [-580.390] -- 0:00:56
589500 -- [-582.544] (-584.772) (-577.568) (-576.054) * (-576.604) (-591.238) (-578.644) [-576.041] -- 0:00:56
590000 -- (-582.449) (-581.992) (-581.316) [-578.655] * (-586.841) [-581.841] (-578.679) (-581.201) -- 0:00:56
Average standard deviation of split frequencies: 0.006499
590500 -- (-581.837) (-587.560) (-574.543) [-580.156] * (-584.036) (-588.976) (-585.581) [-583.318] -- 0:00:56
591000 -- (-581.061) (-582.219) [-579.814] (-576.394) * (-579.680) (-583.683) [-577.112] (-580.560) -- 0:00:56
591500 -- (-583.104) [-583.877] (-575.932) (-579.299) * (-581.791) (-582.765) [-581.184] (-579.300) -- 0:00:55
592000 -- (-580.770) (-581.250) [-579.700] (-581.598) * (-579.316) (-577.512) [-574.886] (-580.546) -- 0:00:55
592500 -- (-578.270) [-578.292] (-583.368) (-579.318) * (-574.592) (-584.706) [-575.438] (-579.557) -- 0:00:55
593000 -- (-585.515) (-582.092) [-576.110] (-580.216) * (-577.344) (-581.417) [-576.141] (-573.357) -- 0:00:55
593500 -- [-580.582] (-577.357) (-583.105) (-577.435) * (-575.592) (-581.525) (-575.507) [-578.074] -- 0:00:55
594000 -- (-578.029) (-577.673) [-577.169] (-575.769) * (-584.341) (-579.926) [-579.835] (-582.537) -- 0:00:55
594500 -- (-578.596) [-577.383] (-580.917) (-578.577) * (-579.434) (-582.083) [-576.251] (-579.378) -- 0:00:55
595000 -- (-580.545) [-580.554] (-584.702) (-581.218) * (-584.517) (-580.998) (-583.400) [-583.629] -- 0:00:55
Average standard deviation of split frequencies: 0.005650
595500 -- (-581.706) (-581.473) [-583.879] (-581.122) * (-578.122) [-575.359] (-580.052) (-579.504) -- 0:00:55
596000 -- (-574.846) (-582.237) (-586.248) [-579.255] * [-580.609] (-580.503) (-582.259) (-577.116) -- 0:00:55
596500 -- (-578.792) (-582.937) (-584.689) [-577.101] * (-579.382) (-577.914) [-573.999] (-582.867) -- 0:00:55
597000 -- (-583.863) (-585.546) [-583.462] (-587.044) * (-578.220) (-575.762) (-578.550) [-578.516] -- 0:00:55
597500 -- [-576.226] (-582.351) (-581.496) (-577.156) * (-578.047) (-583.155) (-578.263) [-576.458] -- 0:00:55
598000 -- (-577.237) (-581.746) [-582.998] (-577.234) * (-579.505) (-581.090) [-577.015] (-582.903) -- 0:00:55
598500 -- (-575.985) (-574.360) [-581.652] (-577.868) * (-577.674) [-578.877] (-579.430) (-576.507) -- 0:00:55
599000 -- (-578.303) (-582.606) [-580.674] (-579.258) * (-576.245) (-578.296) [-577.790] (-585.779) -- 0:00:54
599500 -- (-579.874) (-578.463) [-574.915] (-575.996) * [-578.739] (-579.153) (-579.777) (-577.082) -- 0:00:54
600000 -- (-578.888) [-575.653] (-583.449) (-579.792) * (-579.673) (-580.479) (-575.106) [-583.585] -- 0:00:54
Average standard deviation of split frequencies: 0.005830
600500 -- (-581.400) (-577.446) (-581.180) [-577.598] * [-579.144] (-582.812) (-577.074) (-578.985) -- 0:00:54
601000 -- (-576.478) (-579.886) [-576.829] (-580.485) * (-577.257) (-579.270) [-576.291] (-576.060) -- 0:00:54
601500 -- [-574.851] (-576.503) (-575.455) (-581.143) * (-583.666) [-582.230] (-581.088) (-579.327) -- 0:00:54
602000 -- [-578.180] (-580.150) (-578.472) (-579.124) * (-584.386) (-578.626) (-581.937) [-579.118] -- 0:00:54
602500 -- (-576.166) [-579.618] (-586.281) (-578.997) * (-579.559) [-575.444] (-581.605) (-580.181) -- 0:00:54
603000 -- (-583.591) (-581.925) [-576.643] (-578.074) * (-577.826) (-581.606) (-575.889) [-577.868] -- 0:00:53
603500 -- (-575.354) (-580.630) [-591.371] (-575.649) * (-577.397) (-581.324) [-582.224] (-578.822) -- 0:00:54
604000 -- (-586.590) (-579.408) [-576.008] (-584.408) * (-577.152) [-582.494] (-578.745) (-579.156) -- 0:00:54
604500 -- (-580.511) [-583.274] (-582.315) (-581.589) * (-579.544) (-583.593) (-582.372) [-577.648] -- 0:00:54
605000 -- (-581.186) (-579.614) (-592.660) [-578.123] * (-580.738) (-579.503) [-578.032] (-577.316) -- 0:00:54
Average standard deviation of split frequencies: 0.005890
605500 -- (-579.502) (-582.075) [-579.821] (-578.888) * (-578.944) (-575.846) [-578.372] (-583.915) -- 0:00:54
606000 -- (-582.257) (-573.945) [-576.831] (-581.795) * [-579.915] (-575.565) (-577.491) (-579.580) -- 0:00:53
606500 -- (-582.979) (-575.146) (-582.988) [-576.067] * (-586.743) (-574.241) [-575.230] (-580.643) -- 0:00:53
607000 -- [-587.303] (-578.542) (-575.379) (-578.682) * [-577.301] (-581.152) (-579.473) (-575.922) -- 0:00:53
607500 -- (-582.578) [-572.912] (-579.646) (-579.403) * (-584.666) (-578.242) (-578.586) [-576.702] -- 0:00:53
608000 -- (-586.808) [-574.872] (-577.648) (-583.721) * (-583.512) [-577.162] (-576.817) (-578.803) -- 0:00:53
608500 -- (-576.971) (-577.497) [-575.579] (-578.074) * (-577.680) (-574.715) [-578.608] (-581.670) -- 0:00:53
609000 -- (-581.101) [-578.369] (-581.719) (-580.201) * (-578.975) (-578.670) (-575.204) [-577.671] -- 0:00:53
609500 -- (-579.863) [-575.556] (-579.477) (-576.618) * (-575.575) (-578.609) [-577.557] (-581.581) -- 0:00:53
610000 -- (-574.156) (-577.738) [-577.980] (-579.954) * (-577.355) (-579.957) [-574.991] (-576.678) -- 0:00:53
Average standard deviation of split frequencies: 0.005624
610500 -- (-580.977) [-578.179] (-575.414) (-586.532) * (-580.779) (-580.019) (-579.015) [-573.377] -- 0:00:53
611000 -- (-577.128) [-577.851] (-578.079) (-578.016) * (-579.224) (-582.901) (-576.154) [-578.850] -- 0:00:53
611500 -- [-577.928] (-586.239) (-576.700) (-577.303) * (-578.852) (-590.644) [-577.410] (-585.184) -- 0:00:53
612000 -- (-579.433) (-577.649) [-579.684] (-577.990) * (-578.966) [-581.305] (-580.843) (-578.663) -- 0:00:53
612500 -- (-576.300) (-575.408) (-576.795) [-577.130] * (-576.975) (-580.193) [-574.744] (-578.018) -- 0:00:53
613000 -- [-575.000] (-577.210) (-576.598) (-580.085) * [-575.478] (-580.226) (-580.160) (-585.930) -- 0:00:53
613500 -- (-580.278) (-576.584) [-578.860] (-579.472) * (-577.555) (-579.603) (-576.598) [-581.216] -- 0:00:52
614000 -- (-585.273) (-581.341) (-575.968) [-580.141] * (-588.177) (-584.523) [-578.178] (-582.513) -- 0:00:52
614500 -- (-582.238) [-577.243] (-582.624) (-583.780) * (-584.418) (-584.474) [-578.540] (-580.622) -- 0:00:52
615000 -- (-587.406) [-579.780] (-577.524) (-577.653) * (-579.517) [-583.200] (-578.638) (-579.000) -- 0:00:52
Average standard deviation of split frequencies: 0.005248
615500 -- (-581.916) (-580.002) (-581.669) [-576.386] * [-580.923] (-582.567) (-578.215) (-576.197) -- 0:00:52
616000 -- (-574.940) [-577.809] (-581.100) (-584.284) * (-577.904) [-578.548] (-578.502) (-584.379) -- 0:00:52
616500 -- (-582.645) [-578.568] (-581.828) (-577.126) * (-579.748) [-577.152] (-597.344) (-582.813) -- 0:00:52
617000 -- [-582.234] (-584.677) (-580.207) (-579.250) * (-577.884) (-579.086) (-587.807) [-583.878] -- 0:00:52
617500 -- (-580.594) (-585.035) [-579.381] (-578.461) * (-580.925) (-576.500) (-579.794) [-580.970] -- 0:00:52
618000 -- [-575.732] (-585.738) (-579.254) (-580.527) * (-580.411) [-580.940] (-575.189) (-584.497) -- 0:00:52
618500 -- [-581.011] (-584.252) (-584.585) (-576.285) * (-585.574) (-584.449) (-579.693) [-581.248] -- 0:00:52
619000 -- (-575.688) (-576.017) (-578.655) [-578.656] * (-587.464) (-581.230) [-577.719] (-577.267) -- 0:00:52
619500 -- (-578.633) (-583.775) (-579.571) [-580.844] * (-590.842) [-580.171] (-580.982) (-581.158) -- 0:00:52
620000 -- (-576.112) [-579.937] (-576.713) (-573.539) * (-582.313) (-576.226) (-577.641) [-578.686] -- 0:00:52
Average standard deviation of split frequencies: 0.004883
620500 -- (-580.666) [-575.315] (-575.204) (-578.675) * [-579.718] (-573.846) (-581.767) (-583.727) -- 0:00:51
621000 -- [-576.351] (-586.827) (-582.869) (-580.845) * (-575.345) [-582.295] (-583.626) (-576.556) -- 0:00:51
621500 -- (-579.949) [-586.437] (-580.482) (-579.106) * (-576.390) (-577.716) [-586.702] (-582.025) -- 0:00:51
622000 -- [-583.182] (-581.141) (-577.350) (-580.354) * (-578.034) (-584.694) [-586.500] (-579.237) -- 0:00:51
622500 -- (-577.192) [-580.593] (-578.784) (-583.980) * (-582.649) (-578.067) (-575.457) [-576.373] -- 0:00:51
623000 -- (-585.586) (-576.866) (-578.371) [-576.153] * (-576.980) [-580.375] (-574.849) (-573.869) -- 0:00:51
623500 -- (-579.252) (-585.938) (-583.074) [-576.122] * (-585.616) (-582.140) (-577.422) [-575.894] -- 0:00:51
624000 -- [-579.645] (-579.190) (-580.805) (-578.552) * [-577.510] (-583.257) (-581.596) (-578.442) -- 0:00:51
624500 -- [-584.316] (-574.023) (-581.166) (-577.714) * (-580.588) [-579.721] (-580.333) (-578.731) -- 0:00:51
625000 -- (-579.015) (-577.595) (-577.334) [-582.235] * [-580.070] (-580.753) (-586.396) (-583.233) -- 0:00:51
Average standard deviation of split frequencies: 0.005164
625500 -- (-586.247) [-575.305] (-584.502) (-581.085) * (-579.274) (-583.390) (-575.441) [-577.573] -- 0:00:51
626000 -- (-584.119) (-580.388) [-582.424] (-581.866) * (-576.625) (-581.452) (-584.729) [-575.487] -- 0:00:51
626500 -- (-582.924) [-574.615] (-579.767) (-581.021) * (-574.309) (-576.805) [-580.550] (-578.869) -- 0:00:51
627000 -- (-581.331) (-581.037) [-579.659] (-577.517) * [-575.544] (-581.145) (-579.711) (-584.183) -- 0:00:51
627500 -- (-581.211) [-578.255] (-577.602) (-577.488) * [-575.849] (-580.374) (-579.447) (-578.903) -- 0:00:51
628000 -- (-588.736) (-581.992) (-580.714) [-575.355] * [-574.834] (-581.820) (-579.803) (-575.718) -- 0:00:50
628500 -- (-588.010) [-575.912] (-585.954) (-583.837) * (-580.306) (-578.113) (-581.382) [-576.772] -- 0:00:50
629000 -- (-582.169) (-583.418) (-586.813) [-582.701] * [-581.015] (-579.311) (-583.340) (-580.100) -- 0:00:50
629500 -- [-582.643] (-582.717) (-581.145) (-577.292) * [-580.757] (-579.900) (-584.010) (-575.939) -- 0:00:50
630000 -- (-583.455) [-581.337] (-579.467) (-581.569) * (-582.400) (-582.917) (-580.884) [-580.464] -- 0:00:50
Average standard deviation of split frequencies: 0.004378
630500 -- [-583.021] (-587.651) (-581.454) (-577.559) * (-582.557) [-576.729] (-573.970) (-575.274) -- 0:00:50
631000 -- [-575.215] (-584.899) (-577.806) (-577.786) * (-577.259) [-579.691] (-582.188) (-578.396) -- 0:00:50
631500 -- (-578.667) (-578.301) (-578.783) [-582.954] * [-571.929] (-577.734) (-585.073) (-579.690) -- 0:00:50
632000 -- [-577.261] (-580.105) (-581.076) (-586.423) * (-581.611) (-584.474) [-578.832] (-573.777) -- 0:00:50
632500 -- (-579.856) [-586.600] (-586.001) (-576.762) * (-579.456) (-580.942) [-577.226] (-578.449) -- 0:00:50
633000 -- (-579.425) (-586.158) [-577.383] (-587.784) * (-577.262) (-575.115) (-581.011) [-576.041] -- 0:00:50
633500 -- (-577.578) [-580.603] (-583.356) (-583.591) * [-578.272] (-582.916) (-579.999) (-576.588) -- 0:00:50
634000 -- (-576.721) (-580.006) (-584.257) [-577.074] * [-577.243] (-585.476) (-579.340) (-576.530) -- 0:00:50
634500 -- [-580.288] (-585.812) (-581.624) (-584.564) * [-578.856] (-577.250) (-577.378) (-579.785) -- 0:00:50
635000 -- (-577.675) (-584.792) [-576.175] (-583.335) * [-580.051] (-576.817) (-582.171) (-579.117) -- 0:00:50
Average standard deviation of split frequencies: 0.003918
635500 -- [-576.838] (-579.701) (-578.514) (-579.071) * (-583.933) (-574.897) (-575.195) [-578.041] -- 0:00:49
636000 -- (-577.974) [-576.790] (-575.226) (-588.154) * (-584.433) [-576.061] (-575.159) (-580.388) -- 0:00:49
636500 -- (-584.458) (-577.909) [-577.785] (-579.789) * (-576.123) (-579.305) (-589.001) [-580.452] -- 0:00:49
637000 -- (-577.109) (-580.890) [-577.439] (-579.783) * [-584.764] (-590.943) (-579.964) (-574.445) -- 0:00:49
637500 -- [-583.445] (-579.533) (-582.232) (-583.502) * (-583.661) [-581.308] (-592.920) (-580.762) -- 0:00:49
638000 -- [-585.028] (-579.284) (-581.987) (-578.920) * [-578.448] (-584.119) (-584.249) (-577.587) -- 0:00:49
638500 -- (-580.409) [-579.173] (-588.748) (-577.058) * (-579.439) (-580.790) (-582.161) [-575.703] -- 0:00:49
639000 -- (-590.465) (-578.455) (-585.731) [-575.258] * (-575.260) [-576.062] (-578.304) (-584.856) -- 0:00:49
639500 -- (-578.495) (-582.057) (-575.893) [-578.566] * (-577.323) [-578.165] (-581.476) (-575.710) -- 0:00:49
640000 -- (-576.815) (-574.849) (-577.395) [-578.780] * (-577.450) (-581.303) [-589.201] (-576.570) -- 0:00:49
Average standard deviation of split frequencies: 0.004520
640500 -- (-579.685) [-573.838] (-582.875) (-574.541) * (-583.282) [-575.949] (-579.200) (-574.933) -- 0:00:49
641000 -- (-579.255) (-582.899) (-580.266) [-575.728] * (-581.450) (-577.686) [-580.069] (-576.241) -- 0:00:49
641500 -- (-585.718) (-578.942) (-575.751) [-576.034] * (-580.422) (-578.092) [-577.248] (-580.102) -- 0:00:49
642000 -- [-584.391] (-579.989) (-577.491) (-581.665) * (-583.836) (-578.270) [-576.599] (-578.132) -- 0:00:49
642500 -- (-576.667) (-578.063) [-576.083] (-589.815) * (-584.145) [-576.931] (-587.979) (-579.339) -- 0:00:48
643000 -- [-577.079] (-580.861) (-577.426) (-584.938) * (-575.817) [-581.556] (-584.286) (-581.832) -- 0:00:48
643500 -- (-582.752) (-584.222) [-574.512] (-585.384) * [-576.219] (-572.840) (-584.463) (-579.380) -- 0:00:48
644000 -- (-592.270) (-583.420) [-579.550] (-588.141) * (-582.642) (-585.780) (-582.246) [-578.916] -- 0:00:48
644500 -- (-576.447) (-577.845) (-579.272) [-580.932] * [-582.100] (-577.474) (-577.540) (-588.728) -- 0:00:48
645000 -- (-577.294) (-576.573) (-581.061) [-588.111] * (-581.043) [-580.700] (-579.281) (-578.556) -- 0:00:48
Average standard deviation of split frequencies: 0.004587
645500 -- [-583.540] (-579.235) (-577.205) (-587.324) * (-579.493) (-583.921) [-578.127] (-575.899) -- 0:00:48
646000 -- (-578.632) (-577.167) [-575.627] (-581.253) * [-576.074] (-581.748) (-581.771) (-588.492) -- 0:00:48
646500 -- (-577.403) (-575.799) (-578.142) [-578.453] * (-582.978) (-579.957) (-578.153) [-578.449] -- 0:00:48
647000 -- [-578.254] (-576.796) (-588.407) (-580.047) * [-575.065] (-577.596) (-579.389) (-577.864) -- 0:00:48
647500 -- [-583.226] (-576.181) (-582.658) (-577.326) * (-579.987) (-582.368) (-583.709) [-579.237] -- 0:00:48
648000 -- [-576.699] (-585.006) (-587.290) (-582.892) * (-583.679) (-578.342) (-582.436) [-579.199] -- 0:00:48
648500 -- [-579.062] (-582.783) (-577.511) (-579.019) * (-583.017) (-579.291) (-585.086) [-580.836] -- 0:00:48
649000 -- (-579.056) [-577.871] (-587.767) (-579.630) * (-580.349) (-576.804) (-582.481) [-580.650] -- 0:00:48
649500 -- [-579.781] (-575.744) (-582.355) (-578.761) * (-580.928) (-578.128) [-575.254] (-574.445) -- 0:00:48
650000 -- (-578.202) [-574.110] (-582.925) (-580.984) * [-586.015] (-576.191) (-578.135) (-574.888) -- 0:00:47
Average standard deviation of split frequencies: 0.004243
650500 -- (-581.945) (-577.125) [-579.462] (-579.744) * (-578.957) [-579.765] (-574.922) (-578.037) -- 0:00:47
651000 -- (-577.538) (-583.402) (-584.400) [-577.943] * [-578.629] (-580.673) (-587.842) (-578.222) -- 0:00:47
651500 -- (-577.911) (-579.298) [-580.526] (-577.353) * (-585.543) [-581.751] (-576.524) (-575.852) -- 0:00:47
652000 -- (-581.591) (-582.165) [-576.743] (-581.334) * (-577.797) (-584.711) (-579.926) [-580.373] -- 0:00:47
652500 -- (-581.450) [-575.844] (-579.740) (-579.925) * (-579.367) (-589.527) (-580.416) [-579.964] -- 0:00:47
653000 -- (-585.329) (-579.378) [-581.539] (-597.397) * (-575.984) (-582.625) (-582.877) [-576.235] -- 0:00:47
653500 -- (-576.130) (-578.919) [-582.980] (-586.740) * (-581.852) (-580.017) [-581.328] (-581.910) -- 0:00:47
654000 -- (-579.757) [-574.957] (-579.897) (-579.049) * (-578.570) (-578.980) (-587.171) [-576.154] -- 0:00:47
654500 -- (-575.490) [-580.021] (-576.990) (-581.206) * (-581.082) (-581.197) [-577.319] (-580.266) -- 0:00:47
655000 -- (-582.257) (-574.596) [-579.331] (-579.168) * [-580.025] (-577.871) (-583.981) (-575.424) -- 0:00:47
Average standard deviation of split frequencies: 0.004414
655500 -- [-574.394] (-579.299) (-579.550) (-579.843) * [-578.317] (-584.764) (-578.727) (-578.828) -- 0:00:47
656000 -- (-574.570) [-575.785] (-576.016) (-582.133) * (-578.301) [-573.491] (-574.888) (-585.803) -- 0:00:47
656500 -- [-573.934] (-576.193) (-580.605) (-581.203) * [-577.282] (-585.427) (-577.539) (-578.834) -- 0:00:47
657000 -- (-583.446) (-574.992) [-579.933] (-584.931) * (-579.939) (-580.423) [-577.170] (-578.263) -- 0:00:46
657500 -- (-581.554) [-577.757] (-579.034) (-583.340) * (-582.466) [-579.529] (-578.225) (-585.645) -- 0:00:46
658000 -- (-586.945) [-575.824] (-579.775) (-579.646) * (-574.141) (-579.419) [-575.217] (-577.844) -- 0:00:46
658500 -- (-583.550) [-573.470] (-580.100) (-575.399) * (-580.688) (-584.308) (-581.191) [-576.818] -- 0:00:46
659000 -- (-575.588) [-578.869] (-579.679) (-580.551) * (-575.669) (-579.392) (-581.119) [-578.046] -- 0:00:46
659500 -- (-579.464) [-577.225] (-582.670) (-583.166) * (-579.249) (-578.781) [-575.754] (-579.248) -- 0:00:46
660000 -- (-579.836) (-578.486) (-575.118) [-581.859] * (-583.885) (-582.989) (-574.684) [-578.092] -- 0:00:46
Average standard deviation of split frequencies: 0.003670
660500 -- (-574.727) (-579.934) [-576.551] (-586.987) * [-575.814] (-576.591) (-577.972) (-580.560) -- 0:00:46
661000 -- (-579.623) (-579.958) (-587.078) [-580.117] * [-579.146] (-579.170) (-582.442) (-578.366) -- 0:00:46
661500 -- [-577.977] (-581.534) (-581.605) (-576.201) * [-574.878] (-580.979) (-581.078) (-584.679) -- 0:00:46
662000 -- [-578.381] (-578.606) (-586.350) (-583.377) * (-575.198) [-582.419] (-575.794) (-577.355) -- 0:00:46
662500 -- (-580.291) (-583.607) (-581.114) [-581.840] * (-576.762) [-575.757] (-577.634) (-574.889) -- 0:00:46
663000 -- (-583.547) [-575.886] (-583.856) (-581.637) * (-584.257) (-581.089) (-579.778) [-583.329] -- 0:00:46
663500 -- (-585.478) (-578.324) [-579.875] (-578.329) * (-582.307) [-579.352] (-577.029) (-578.499) -- 0:00:46
664000 -- (-579.802) (-584.391) (-578.615) [-580.344] * [-583.404] (-581.380) (-574.035) (-581.991) -- 0:00:46
664500 -- [-576.033] (-576.963) (-579.403) (-582.049) * (-583.705) (-582.853) (-578.008) [-579.049] -- 0:00:45
665000 -- [-575.545] (-578.997) (-578.719) (-577.797) * (-584.121) (-583.898) (-579.559) [-582.932] -- 0:00:45
Average standard deviation of split frequencies: 0.003337
665500 -- (-577.188) [-573.476] (-581.483) (-578.322) * (-586.937) [-584.080] (-578.101) (-582.348) -- 0:00:45
666000 -- (-580.389) [-579.031] (-578.644) (-585.176) * (-587.858) [-579.097] (-587.350) (-581.138) -- 0:00:45
666500 -- (-581.369) [-579.980] (-578.435) (-588.543) * (-575.542) (-576.832) [-580.482] (-576.053) -- 0:00:45
667000 -- [-578.200] (-587.531) (-577.203) (-578.204) * (-579.840) (-576.242) [-574.193] (-580.802) -- 0:00:45
667500 -- (-583.658) (-583.598) [-580.072] (-585.742) * (-580.635) (-582.125) (-583.298) [-578.735] -- 0:00:45
668000 -- (-583.582) [-581.680] (-576.873) (-579.738) * (-581.254) (-577.336) [-575.902] (-584.332) -- 0:00:45
668500 -- [-584.724] (-581.717) (-583.436) (-585.257) * (-582.219) (-589.140) [-583.822] (-581.585) -- 0:00:45
669000 -- (-580.299) (-586.726) (-581.400) [-578.564] * (-576.461) (-580.107) [-576.972] (-577.833) -- 0:00:45
669500 -- (-576.587) (-577.737) (-578.647) [-574.885] * [-577.183] (-582.093) (-575.563) (-576.000) -- 0:00:45
670000 -- (-590.374) (-577.420) (-579.969) [-579.456] * (-580.991) [-583.386] (-580.742) (-578.555) -- 0:00:45
Average standard deviation of split frequencies: 0.002912
670500 -- (-579.602) (-576.753) (-580.262) [-586.775] * (-579.508) (-579.796) (-582.645) [-578.386] -- 0:00:45
671000 -- [-572.660] (-576.092) (-585.058) (-580.416) * (-577.534) (-582.918) [-579.510] (-578.420) -- 0:00:45
671500 -- (-579.175) [-577.013] (-579.380) (-584.163) * (-577.051) (-577.981) [-577.860] (-581.945) -- 0:00:45
672000 -- (-577.168) [-585.746] (-583.337) (-582.862) * (-583.347) (-585.216) [-573.545] (-586.453) -- 0:00:44
672500 -- (-581.833) [-580.506] (-579.596) (-585.365) * (-583.070) (-584.487) (-577.465) [-582.421] -- 0:00:44
673000 -- [-575.973] (-578.012) (-578.289) (-575.966) * (-578.844) [-578.977] (-576.906) (-582.649) -- 0:00:44
673500 -- (-582.937) [-578.086] (-580.501) (-578.843) * (-584.134) (-574.742) (-579.552) [-579.109] -- 0:00:44
674000 -- (-579.799) (-578.251) [-579.760] (-587.849) * [-578.923] (-578.030) (-577.335) (-578.775) -- 0:00:44
674500 -- (-577.245) (-577.567) (-576.099) [-575.579] * (-578.460) (-575.343) [-576.035] (-578.064) -- 0:00:44
675000 -- [-577.222] (-580.798) (-580.551) (-576.873) * [-577.719] (-574.041) (-578.406) (-578.946) -- 0:00:44
Average standard deviation of split frequencies: 0.003387
675500 -- (-578.351) (-578.485) [-574.829] (-581.882) * (-580.282) (-581.996) [-578.795] (-585.595) -- 0:00:44
676000 -- (-580.308) [-576.215] (-580.235) (-576.191) * [-577.770] (-577.209) (-580.682) (-585.050) -- 0:00:44
676500 -- (-575.984) (-577.221) [-582.156] (-575.358) * (-574.816) [-572.734] (-574.729) (-591.734) -- 0:00:44
677000 -- (-577.408) (-580.327) (-576.830) [-581.742] * (-577.101) (-576.355) (-576.345) [-585.240] -- 0:00:44
677500 -- (-578.673) [-575.598] (-574.226) (-579.512) * (-575.806) (-576.156) (-580.328) [-582.746] -- 0:00:44
678000 -- [-582.129] (-578.882) (-577.666) (-577.998) * [-576.103] (-577.884) (-578.953) (-578.598) -- 0:00:44
678500 -- (-576.951) [-580.607] (-580.353) (-583.557) * (-576.375) (-582.184) (-576.775) [-579.862] -- 0:00:44
679000 -- (-576.497) (-576.653) [-579.864] (-584.692) * (-576.630) [-579.464] (-578.688) (-577.160) -- 0:00:43
679500 -- [-581.021] (-583.225) (-579.135) (-580.558) * [-577.036] (-587.018) (-575.593) (-580.430) -- 0:00:43
680000 -- (-577.216) (-575.477) [-577.470] (-579.980) * (-581.137) (-583.608) (-582.743) [-577.904] -- 0:00:43
Average standard deviation of split frequencies: 0.003364
680500 -- (-581.187) (-579.250) [-577.867] (-581.870) * (-580.512) (-588.563) [-581.641] (-579.396) -- 0:00:43
681000 -- (-582.281) (-579.961) (-577.941) [-572.614] * (-581.997) (-581.948) [-581.192] (-581.273) -- 0:00:43
681500 -- (-577.278) (-584.871) (-578.873) [-577.158] * (-577.974) [-576.501] (-578.914) (-578.016) -- 0:00:43
682000 -- [-578.338] (-587.112) (-580.036) (-583.270) * (-580.338) [-586.479] (-577.566) (-577.090) -- 0:00:43
682500 -- (-579.278) (-574.650) [-580.018] (-576.772) * (-584.740) (-578.796) [-578.370] (-581.077) -- 0:00:43
683000 -- (-584.868) (-580.311) [-578.694] (-578.952) * (-576.675) [-582.446] (-574.381) (-577.986) -- 0:00:43
683500 -- [-582.715] (-582.499) (-584.499) (-576.455) * [-574.931] (-581.671) (-577.435) (-579.212) -- 0:00:43
684000 -- (-587.665) (-575.473) [-580.040] (-581.499) * [-578.782] (-587.402) (-583.549) (-579.459) -- 0:00:43
684500 -- (-579.508) [-585.013] (-576.065) (-579.689) * (-575.273) (-578.154) (-579.168) [-582.505] -- 0:00:43
685000 -- [-580.609] (-583.606) (-584.122) (-583.100) * [-578.483] (-591.419) (-585.195) (-584.269) -- 0:00:43
Average standard deviation of split frequencies: 0.003829
685500 -- [-579.578] (-582.124) (-583.387) (-577.590) * (-584.898) (-581.193) (-584.122) [-578.333] -- 0:00:43
686000 -- [-579.678] (-579.037) (-579.737) (-579.584) * (-579.949) (-580.356) (-582.430) [-581.538] -- 0:00:43
686500 -- [-580.705] (-582.342) (-581.741) (-578.517) * [-582.060] (-581.107) (-579.607) (-589.095) -- 0:00:42
687000 -- [-579.308] (-584.227) (-581.475) (-584.245) * (-586.403) [-578.486] (-579.431) (-587.477) -- 0:00:42
687500 -- [-573.777] (-581.023) (-583.930) (-580.823) * (-577.086) [-575.094] (-576.783) (-585.091) -- 0:00:42
688000 -- (-572.826) [-576.507] (-580.287) (-574.588) * [-575.946] (-578.527) (-578.588) (-581.109) -- 0:00:42
688500 -- (-579.832) (-580.719) (-582.306) [-576.614] * (-582.881) (-581.724) (-578.389) [-574.190] -- 0:00:42
689000 -- [-576.316] (-581.310) (-585.433) (-586.475) * (-579.195) (-581.307) (-584.553) [-580.580] -- 0:00:42
689500 -- (-580.381) (-578.394) (-581.128) [-574.312] * (-576.300) (-580.542) (-579.967) [-576.467] -- 0:00:42
690000 -- (-583.889) (-573.786) (-577.772) [-576.244] * (-585.007) (-582.162) [-581.938] (-579.228) -- 0:00:42
Average standard deviation of split frequencies: 0.003998
690500 -- (-575.512) (-582.495) [-576.095] (-575.497) * [-577.125] (-581.223) (-575.180) (-572.792) -- 0:00:42
691000 -- (-577.620) (-583.597) (-580.724) [-576.209] * (-583.548) [-574.575] (-577.478) (-575.847) -- 0:00:42
691500 -- [-580.629] (-576.716) (-580.879) (-583.230) * (-579.627) (-577.022) [-575.748] (-574.146) -- 0:00:42
692000 -- [-575.020] (-582.411) (-579.342) (-584.148) * [-576.349] (-577.874) (-580.994) (-579.899) -- 0:00:42
692500 -- (-580.007) (-580.797) [-580.109] (-582.030) * (-575.138) (-584.765) [-581.833] (-586.920) -- 0:00:42
693000 -- [-584.115] (-584.592) (-578.711) (-581.793) * (-577.562) [-576.916] (-580.303) (-589.703) -- 0:00:42
693500 -- [-581.924] (-590.480) (-584.809) (-581.224) * [-581.069] (-582.142) (-584.470) (-577.923) -- 0:00:41
694000 -- (-572.792) (-581.072) [-582.011] (-582.963) * (-584.036) [-575.325] (-578.718) (-580.326) -- 0:00:41
694500 -- (-579.123) [-575.090] (-582.564) (-595.292) * (-586.376) [-577.232] (-582.590) (-584.798) -- 0:00:41
695000 -- (-580.123) [-578.331] (-580.976) (-582.256) * (-578.937) (-578.733) [-574.622] (-582.479) -- 0:00:41
Average standard deviation of split frequencies: 0.003290
695500 -- (-575.610) (-586.894) (-578.845) [-582.280] * [-578.681] (-576.881) (-579.724) (-580.596) -- 0:00:41
696000 -- (-579.702) (-580.873) [-580.824] (-575.858) * (-577.499) (-582.364) [-577.150] (-585.576) -- 0:00:41
696500 -- (-579.087) [-578.056] (-577.831) (-581.842) * (-578.492) (-573.824) [-579.596] (-577.301) -- 0:00:41
697000 -- (-584.638) (-573.990) [-586.029] (-576.361) * [-581.524] (-576.944) (-577.333) (-574.935) -- 0:00:41
697500 -- [-579.112] (-576.657) (-584.910) (-580.313) * [-579.656] (-579.178) (-582.417) (-578.549) -- 0:00:41
698000 -- (-574.849) (-578.001) [-582.226] (-577.986) * (-584.367) (-585.472) (-578.951) [-572.361] -- 0:00:41
698500 -- (-576.700) (-581.129) [-581.842] (-575.415) * (-584.008) [-578.414] (-584.039) (-577.111) -- 0:00:41
699000 -- (-582.054) [-577.994] (-578.209) (-584.695) * [-582.939] (-576.531) (-584.832) (-583.728) -- 0:00:41
699500 -- (-578.764) [-575.844] (-576.874) (-578.339) * (-584.718) [-578.089] (-586.025) (-578.474) -- 0:00:41
700000 -- [-577.395] (-575.722) (-577.435) (-578.246) * (-581.872) [-575.780] (-579.041) (-581.103) -- 0:00:41
Average standard deviation of split frequencies: 0.003556
700500 -- [-575.879] (-578.366) (-580.385) (-579.095) * (-581.748) (-579.063) (-576.536) [-575.331] -- 0:00:41
701000 -- (-579.676) [-577.872] (-576.945) (-577.343) * [-576.655] (-581.119) (-579.998) (-576.010) -- 0:00:40
701500 -- [-578.317] (-586.035) (-578.134) (-578.184) * (-581.845) (-585.049) [-579.546] (-572.565) -- 0:00:40
702000 -- (-580.470) (-580.014) [-577.370] (-580.043) * (-584.915) [-583.273] (-578.224) (-587.405) -- 0:00:40
702500 -- [-590.977] (-581.208) (-581.586) (-583.772) * (-579.265) (-578.473) (-578.803) [-575.613] -- 0:00:40
703000 -- (-590.409) [-584.156] (-583.128) (-587.777) * (-577.844) [-577.567] (-580.044) (-579.273) -- 0:00:40
703500 -- (-576.609) (-586.084) [-577.814] (-578.527) * (-579.327) (-582.362) (-579.930) [-579.943] -- 0:00:40
704000 -- (-576.334) (-577.052) (-580.716) [-584.788] * [-577.457] (-577.056) (-578.576) (-581.810) -- 0:00:40
704500 -- (-580.351) (-579.246) [-580.589] (-589.493) * [-576.550] (-576.496) (-577.324) (-575.767) -- 0:00:40
705000 -- [-574.877] (-581.872) (-579.149) (-589.303) * (-582.876) (-580.805) (-574.951) [-581.775] -- 0:00:40
Average standard deviation of split frequencies: 0.003529
705500 -- (-575.850) [-576.401] (-584.463) (-593.999) * (-583.044) [-576.165] (-576.842) (-582.534) -- 0:00:40
706000 -- (-580.259) (-586.195) [-576.238] (-581.833) * (-585.501) [-578.577] (-578.614) (-576.463) -- 0:00:40
706500 -- [-580.589] (-582.306) (-578.853) (-576.274) * (-582.545) (-581.140) (-580.463) [-579.701] -- 0:00:40
707000 -- (-577.770) (-578.338) (-580.631) [-575.089] * [-575.849] (-577.339) (-583.095) (-579.961) -- 0:00:40
707500 -- (-579.210) (-583.327) (-582.238) [-577.674] * (-577.856) (-577.164) [-576.531] (-576.380) -- 0:00:40
708000 -- (-585.876) (-583.033) [-578.552] (-580.880) * [-578.350] (-583.078) (-577.655) (-578.369) -- 0:00:40
708500 -- (-580.240) [-575.919] (-583.096) (-585.839) * [-577.928] (-582.117) (-584.105) (-577.157) -- 0:00:39
709000 -- (-580.139) (-581.958) [-583.726] (-585.074) * [-581.489] (-583.416) (-585.263) (-577.775) -- 0:00:39
709500 -- (-577.543) (-584.512) (-575.477) [-581.050] * (-578.442) [-580.846] (-588.894) (-581.878) -- 0:00:39
710000 -- (-582.702) (-581.216) (-581.174) [-585.172] * (-576.556) (-576.753) (-587.358) [-580.709] -- 0:00:39
Average standard deviation of split frequencies: 0.003506
710500 -- (-576.648) [-578.379] (-578.336) (-583.914) * [-575.067] (-580.750) (-579.229) (-580.503) -- 0:00:39
711000 -- (-578.750) [-579.185] (-575.533) (-590.486) * [-577.399] (-580.748) (-584.010) (-581.189) -- 0:00:39
711500 -- (-576.286) (-580.527) [-575.575] (-587.990) * (-579.452) (-578.458) (-579.031) [-580.219] -- 0:00:39
712000 -- (-578.802) (-580.292) (-573.327) [-578.331] * (-576.417) (-586.164) [-577.713] (-575.869) -- 0:00:39
712500 -- [-582.975] (-583.728) (-574.181) (-575.492) * (-578.262) (-578.122) (-583.124) [-587.921] -- 0:00:39
713000 -- (-579.056) (-580.638) (-583.666) [-574.888] * (-579.838) (-583.622) [-574.810] (-584.581) -- 0:00:39
713500 -- (-580.725) [-583.838] (-577.128) (-578.793) * (-586.545) (-577.730) (-580.209) [-576.448] -- 0:00:39
714000 -- (-581.871) (-581.205) (-579.720) [-578.814] * [-578.951] (-578.900) (-580.310) (-580.980) -- 0:00:39
714500 -- [-577.129] (-579.874) (-580.366) (-580.809) * (-587.613) [-577.394] (-583.366) (-589.324) -- 0:00:39
715000 -- (-578.829) (-580.538) (-587.502) [-581.106] * (-578.481) (-581.207) [-578.398] (-583.025) -- 0:00:39
Average standard deviation of split frequencies: 0.004232
715500 -- [-578.487] (-578.531) (-589.727) (-584.501) * [-578.135] (-581.759) (-584.401) (-577.439) -- 0:00:38
716000 -- [-581.075] (-578.844) (-584.421) (-578.366) * (-591.532) [-582.746] (-576.894) (-592.289) -- 0:00:38
716500 -- [-578.644] (-577.765) (-580.149) (-580.936) * (-579.899) (-580.711) (-581.479) [-586.115] -- 0:00:38
717000 -- (-577.930) [-575.119] (-592.663) (-585.625) * (-578.828) [-576.558] (-580.640) (-584.035) -- 0:00:38
717500 -- (-581.179) [-578.805] (-589.627) (-580.895) * [-578.207] (-583.666) (-579.906) (-581.764) -- 0:00:38
718000 -- [-579.720] (-581.561) (-586.960) (-579.550) * [-581.189] (-589.709) (-578.006) (-582.771) -- 0:00:38
718500 -- (-591.371) (-578.375) [-586.802] (-580.826) * [-578.820] (-578.743) (-577.542) (-585.921) -- 0:00:38
719000 -- (-577.151) [-578.540] (-585.048) (-579.819) * (-580.085) [-578.339] (-581.558) (-580.328) -- 0:00:38
719500 -- (-578.813) (-578.564) (-582.692) [-578.390] * (-580.926) (-579.403) [-577.744] (-584.617) -- 0:00:38
720000 -- (-580.283) [-579.258] (-580.592) (-578.207) * (-586.190) [-577.585] (-583.110) (-578.218) -- 0:00:38
Average standard deviation of split frequencies: 0.004112
720500 -- (-580.044) (-581.070) [-574.421] (-581.944) * (-579.934) (-584.506) (-579.604) [-580.169] -- 0:00:38
721000 -- (-580.614) (-584.805) (-578.491) [-583.266] * (-579.854) (-585.655) (-580.750) [-576.214] -- 0:00:38
721500 -- (-579.660) [-583.688] (-578.337) (-585.122) * (-576.658) (-583.882) [-579.186] (-582.145) -- 0:00:38
722000 -- (-582.048) (-578.946) (-579.493) [-576.056] * (-575.653) (-579.313) [-579.299] (-581.627) -- 0:00:38
722500 -- (-581.426) (-575.154) [-586.616] (-582.411) * (-580.888) (-581.140) (-578.288) [-579.700] -- 0:00:38
723000 -- [-584.051] (-578.214) (-582.557) (-577.664) * (-586.659) (-576.763) [-581.997] (-579.349) -- 0:00:37
723500 -- [-578.749] (-580.174) (-583.592) (-578.145) * (-574.491) [-578.188] (-580.782) (-577.136) -- 0:00:37
724000 -- (-579.884) (-586.348) [-577.902] (-580.108) * (-578.331) [-581.373] (-581.341) (-576.868) -- 0:00:37
724500 -- [-578.742] (-576.219) (-578.077) (-587.208) * (-575.179) (-585.652) [-573.995] (-574.375) -- 0:00:37
725000 -- [-580.293] (-578.816) (-581.834) (-575.287) * [-579.818] (-583.966) (-579.068) (-575.314) -- 0:00:37
Average standard deviation of split frequencies: 0.004360
725500 -- [-584.242] (-579.175) (-588.962) (-577.846) * (-578.106) (-576.951) (-578.795) [-576.244] -- 0:00:37
726000 -- (-574.793) (-577.813) [-584.207] (-585.864) * [-579.736] (-575.471) (-575.998) (-573.158) -- 0:00:37
726500 -- [-574.309] (-577.910) (-581.932) (-576.216) * [-576.062] (-579.175) (-574.780) (-582.232) -- 0:00:37
727000 -- (-578.632) (-579.092) (-576.121) [-578.457] * (-577.316) [-574.826] (-572.810) (-580.774) -- 0:00:37
727500 -- (-580.536) [-576.881] (-574.616) (-580.494) * (-579.444) (-577.409) [-575.105] (-583.078) -- 0:00:37
728000 -- (-580.237) (-577.971) (-581.413) [-580.604] * (-583.467) [-578.187] (-586.196) (-576.469) -- 0:00:37
728500 -- (-582.649) (-577.219) (-577.563) [-576.519] * [-589.975] (-577.733) (-579.696) (-580.443) -- 0:00:37
729000 -- (-582.078) (-575.934) [-577.544] (-578.254) * [-577.503] (-581.394) (-586.644) (-577.149) -- 0:00:37
729500 -- (-587.564) (-582.117) [-575.588] (-584.060) * (-581.871) (-577.106) (-581.142) [-577.764] -- 0:00:37
730000 -- (-588.674) (-577.961) [-580.215] (-585.966) * (-576.531) (-574.175) (-576.920) [-579.762] -- 0:00:36
Average standard deviation of split frequencies: 0.005069
730500 -- (-581.525) (-581.346) [-581.202] (-581.025) * (-582.561) [-577.451] (-588.169) (-581.966) -- 0:00:36
731000 -- (-585.550) (-576.472) (-579.255) [-576.351] * (-584.962) (-582.973) (-576.604) [-582.867] -- 0:00:36
731500 -- (-589.929) [-579.025] (-580.548) (-587.345) * (-581.901) [-579.488] (-578.959) (-585.278) -- 0:00:36
732000 -- (-578.791) (-578.848) (-580.373) [-581.886] * [-581.157] (-579.536) (-581.053) (-577.474) -- 0:00:36
732500 -- [-579.864] (-583.260) (-578.128) (-577.719) * [-585.858] (-581.800) (-578.856) (-576.477) -- 0:00:36
733000 -- [-575.679] (-583.742) (-579.382) (-577.243) * (-578.203) [-578.778] (-578.361) (-578.167) -- 0:00:36
733500 -- [-582.297] (-585.011) (-582.660) (-578.213) * (-579.444) (-579.531) [-576.460] (-578.902) -- 0:00:36
734000 -- (-580.275) (-582.610) [-576.338] (-576.053) * [-575.176] (-580.494) (-577.173) (-584.927) -- 0:00:36
734500 -- (-583.023) [-577.723] (-584.300) (-579.743) * (-574.831) (-589.404) [-576.163] (-583.267) -- 0:00:36
735000 -- [-581.441] (-583.641) (-575.873) (-584.704) * [-580.915] (-588.542) (-575.713) (-576.720) -- 0:00:36
Average standard deviation of split frequencies: 0.004941
735500 -- (-580.198) (-577.455) [-583.650] (-580.014) * (-580.809) (-586.790) [-576.505] (-582.472) -- 0:00:36
736000 -- (-579.348) (-575.203) [-574.098] (-578.856) * (-582.508) (-585.785) [-574.484] (-576.122) -- 0:00:36
736500 -- (-581.853) (-575.777) [-578.350] (-587.255) * (-589.152) (-585.349) (-582.480) [-580.656] -- 0:00:36
737000 -- (-586.765) (-578.442) (-579.412) [-578.208] * (-578.316) (-589.605) (-574.000) [-578.562] -- 0:00:36
737500 -- (-579.014) [-582.206] (-577.544) (-574.492) * [-576.170] (-588.307) (-577.891) (-580.720) -- 0:00:35
738000 -- (-590.491) (-581.473) (-576.360) [-575.298] * [-576.291] (-598.285) (-579.035) (-579.910) -- 0:00:35
738500 -- (-580.978) (-575.521) [-573.575] (-581.511) * (-580.695) (-587.902) [-577.884] (-586.316) -- 0:00:35
739000 -- (-577.575) (-576.747) (-579.681) [-579.141] * (-581.632) (-586.625) (-578.554) [-585.165] -- 0:00:35
739500 -- (-577.462) (-578.396) [-580.784] (-579.307) * (-576.293) (-593.856) [-584.633] (-580.025) -- 0:00:35
740000 -- [-574.443] (-574.200) (-578.331) (-574.849) * (-580.552) (-590.486) [-582.074] (-578.283) -- 0:00:35
Average standard deviation of split frequencies: 0.004001
740500 -- (-578.836) (-579.282) [-578.336] (-577.934) * (-589.115) (-595.258) [-576.666] (-583.450) -- 0:00:35
741000 -- (-578.998) [-576.073] (-578.306) (-578.236) * [-576.644] (-594.079) (-580.767) (-578.171) -- 0:00:35
741500 -- (-577.202) (-577.196) (-582.618) [-582.876] * (-579.516) (-585.039) [-578.313] (-573.910) -- 0:00:35
742000 -- (-581.572) (-578.255) (-575.352) [-574.845] * [-579.040] (-585.533) (-580.019) (-580.305) -- 0:00:35
742500 -- [-580.849] (-576.267) (-581.929) (-577.394) * (-581.627) (-578.912) [-581.710] (-580.929) -- 0:00:35
743000 -- (-578.028) (-578.176) [-574.872] (-580.581) * (-578.233) (-587.576) (-588.784) [-581.360] -- 0:00:35
743500 -- (-580.103) (-580.909) [-582.207] (-574.955) * [-577.697] (-584.429) (-580.648) (-584.358) -- 0:00:35
744000 -- (-574.987) (-581.540) [-578.286] (-577.440) * [-577.394] (-578.255) (-578.083) (-579.730) -- 0:00:35
744500 -- (-583.821) (-583.057) (-581.796) [-576.798] * [-576.137] (-578.925) (-573.327) (-573.493) -- 0:00:35
745000 -- [-576.465] (-577.209) (-583.604) (-578.540) * (-575.629) (-582.360) (-582.272) [-579.509] -- 0:00:34
Average standard deviation of split frequencies: 0.003701
745500 -- [-580.883] (-577.810) (-581.324) (-579.976) * (-575.969) (-577.823) [-578.698] (-582.033) -- 0:00:34
746000 -- (-576.743) [-583.409] (-587.182) (-581.944) * [-584.318] (-583.822) (-580.143) (-580.386) -- 0:00:34
746500 -- (-576.498) (-577.563) [-578.603] (-578.099) * (-576.882) (-582.813) (-585.330) [-574.492] -- 0:00:34
747000 -- (-575.147) (-577.368) (-578.829) [-579.836] * [-577.532] (-577.404) (-585.508) (-575.519) -- 0:00:34
747500 -- (-578.105) [-577.657] (-580.280) (-575.163) * [-575.616] (-581.534) (-581.677) (-579.738) -- 0:00:34
748000 -- (-576.163) (-578.939) [-578.886] (-575.475) * [-573.964] (-581.704) (-580.363) (-577.816) -- 0:00:34
748500 -- (-576.876) (-586.201) [-576.390] (-577.426) * (-572.578) (-583.728) [-574.576] (-581.684) -- 0:00:34
749000 -- (-581.536) (-582.218) [-578.305] (-583.510) * [-576.183] (-575.887) (-575.343) (-575.995) -- 0:00:34
749500 -- [-581.445] (-580.416) (-579.715) (-580.114) * (-583.378) (-583.569) (-576.037) [-577.383] -- 0:00:34
750000 -- (-576.135) [-576.691] (-580.026) (-580.561) * [-578.742] (-585.082) (-582.799) (-575.560) -- 0:00:34
Average standard deviation of split frequencies: 0.003858
750500 -- (-582.635) (-587.241) [-575.513] (-574.349) * (-584.354) [-578.340] (-577.491) (-575.421) -- 0:00:34
751000 -- (-574.360) [-578.833] (-581.093) (-576.374) * (-578.841) (-582.967) (-583.678) [-578.857] -- 0:00:34
751500 -- (-574.751) [-581.096] (-574.640) (-583.211) * (-583.429) (-576.890) [-578.673] (-574.516) -- 0:00:34
752000 -- (-575.696) [-576.999] (-581.131) (-578.150) * (-583.269) (-581.380) (-577.577) [-576.989] -- 0:00:33
752500 -- [-584.068] (-579.880) (-575.793) (-581.834) * (-580.116) [-578.025] (-584.339) (-577.310) -- 0:00:33
753000 -- (-577.707) (-584.324) [-576.316] (-580.201) * [-575.018] (-577.305) (-582.548) (-577.695) -- 0:00:33
753500 -- (-582.695) (-580.459) (-585.207) [-576.608] * (-584.965) (-581.937) (-580.570) [-577.054] -- 0:00:33
754000 -- (-576.040) (-579.605) (-580.302) [-578.615] * (-584.489) (-581.292) [-582.600] (-577.425) -- 0:00:33
754500 -- (-583.138) (-580.633) [-583.482] (-581.987) * (-581.465) (-578.874) (-584.251) [-577.856] -- 0:00:33
755000 -- (-578.732) (-576.343) (-588.374) [-580.389] * [-580.292] (-585.416) (-585.340) (-582.506) -- 0:00:33
Average standard deviation of split frequencies: 0.004721
755500 -- (-584.695) (-588.667) (-578.958) [-576.610] * (-578.153) (-580.233) (-582.438) [-582.805] -- 0:00:33
756000 -- (-577.403) [-582.710] (-583.898) (-575.966) * (-580.163) (-582.312) (-586.969) [-578.892] -- 0:00:33
756500 -- [-574.414] (-582.776) (-578.705) (-577.864) * (-581.821) [-577.705] (-587.470) (-574.811) -- 0:00:33
757000 -- [-578.909] (-586.904) (-578.526) (-577.222) * (-586.064) (-581.595) [-582.601] (-578.624) -- 0:00:33
757500 -- (-579.693) (-583.878) (-579.898) [-580.040] * (-582.964) (-576.844) [-582.624] (-578.091) -- 0:00:33
758000 -- (-580.210) (-589.677) [-582.146] (-582.615) * (-584.637) (-580.982) (-586.742) [-575.379] -- 0:00:33
758500 -- (-580.585) [-579.113] (-579.235) (-577.174) * (-586.445) (-575.605) (-584.434) [-578.149] -- 0:00:33
759000 -- [-582.810] (-581.201) (-577.801) (-579.218) * (-576.991) [-574.106] (-586.268) (-578.297) -- 0:00:33
759500 -- [-582.517] (-584.260) (-584.049) (-579.410) * [-579.042] (-580.610) (-578.520) (-586.275) -- 0:00:32
760000 -- [-576.633] (-577.719) (-587.937) (-578.052) * (-582.065) [-578.253] (-572.365) (-579.455) -- 0:00:32
Average standard deviation of split frequencies: 0.004781
760500 -- [-577.665] (-583.283) (-572.995) (-586.163) * (-589.305) [-575.314] (-579.121) (-580.062) -- 0:00:32
761000 -- [-579.256] (-578.054) (-578.586) (-575.972) * [-583.925] (-580.236) (-581.239) (-576.906) -- 0:00:32
761500 -- (-577.960) (-578.884) (-579.457) [-577.121] * [-582.218] (-577.800) (-580.885) (-578.263) -- 0:00:32
762000 -- (-581.818) (-586.826) [-574.454] (-580.085) * (-582.376) (-584.890) (-576.671) [-582.028] -- 0:00:32
762500 -- (-578.697) (-584.715) [-578.768] (-580.822) * (-582.898) [-579.317] (-576.713) (-582.675) -- 0:00:32
763000 -- (-579.657) (-586.331) (-578.268) [-577.028] * (-589.514) [-573.804] (-576.926) (-575.933) -- 0:00:32
763500 -- (-581.232) (-576.767) (-575.530) [-575.714] * [-584.818] (-586.562) (-577.681) (-581.510) -- 0:00:32
764000 -- [-580.213] (-585.385) (-580.039) (-577.126) * (-577.426) (-577.828) (-582.612) [-577.269] -- 0:00:32
764500 -- (-579.752) (-581.223) (-575.627) [-577.014] * [-579.835] (-578.968) (-585.553) (-580.729) -- 0:00:32
765000 -- [-580.554] (-578.801) (-584.620) (-583.065) * (-579.733) (-578.470) (-582.572) [-581.722] -- 0:00:32
Average standard deviation of split frequencies: 0.005011
765500 -- (-579.580) (-578.362) [-578.556] (-581.827) * (-578.618) (-579.286) (-579.659) [-575.974] -- 0:00:32
766000 -- (-584.425) [-578.697] (-578.327) (-573.588) * (-575.986) [-575.445] (-581.123) (-581.229) -- 0:00:32
766500 -- (-581.364) [-576.073] (-578.150) (-574.993) * (-577.869) (-579.716) (-575.854) [-581.147] -- 0:00:31
767000 -- (-579.072) (-575.113) [-577.004] (-580.267) * (-581.663) [-577.195] (-580.214) (-582.041) -- 0:00:31
767500 -- (-580.966) [-573.598] (-594.277) (-581.117) * [-578.045] (-574.178) (-586.225) (-577.952) -- 0:00:31
768000 -- (-579.567) (-578.952) (-578.723) [-576.834] * (-580.411) (-576.489) (-578.428) [-578.295] -- 0:00:31
768500 -- [-579.202] (-579.963) (-583.447) (-583.907) * [-575.968] (-579.576) (-577.788) (-584.292) -- 0:00:31
769000 -- (-584.996) (-576.241) [-578.768] (-583.403) * [-579.242] (-582.479) (-582.577) (-588.981) -- 0:00:31
769500 -- (-587.485) (-587.294) (-580.245) [-577.665] * (-579.753) [-578.293] (-581.225) (-580.511) -- 0:00:31
770000 -- [-575.628] (-585.498) (-578.502) (-579.221) * [-577.688] (-577.257) (-580.327) (-582.716) -- 0:00:31
Average standard deviation of split frequencies: 0.006292
770500 -- (-578.910) (-574.899) [-581.848] (-578.673) * [-575.673] (-582.467) (-582.917) (-581.154) -- 0:00:31
771000 -- [-583.173] (-578.614) (-587.007) (-576.034) * [-581.911] (-580.119) (-580.129) (-582.739) -- 0:00:31
771500 -- (-583.694) (-578.159) [-576.871] (-586.569) * (-579.173) [-582.705] (-582.946) (-581.584) -- 0:00:31
772000 -- (-583.972) (-574.600) [-575.527] (-584.146) * (-584.202) (-579.414) [-579.811] (-578.225) -- 0:00:31
772500 -- (-588.572) (-577.233) [-577.667] (-582.134) * (-581.821) [-578.127] (-574.662) (-576.394) -- 0:00:31
773000 -- (-580.160) (-580.199) (-581.755) [-577.248] * [-577.692] (-576.098) (-579.241) (-576.213) -- 0:00:31
773500 -- [-585.043] (-578.592) (-577.331) (-582.834) * (-577.404) (-577.113) (-578.175) [-582.268] -- 0:00:31
774000 -- [-582.729] (-584.916) (-574.120) (-577.189) * [-576.904] (-577.865) (-580.763) (-582.597) -- 0:00:30
774500 -- [-580.714] (-584.201) (-582.739) (-582.591) * [-576.207] (-586.481) (-575.771) (-586.637) -- 0:00:30
775000 -- (-585.052) (-579.478) [-575.773] (-578.634) * (-573.460) (-578.618) (-577.138) [-576.535] -- 0:00:30
Average standard deviation of split frequencies: 0.006248
775500 -- [-584.534] (-580.524) (-581.932) (-580.602) * (-577.804) [-578.245] (-579.916) (-590.680) -- 0:00:30
776000 -- (-581.848) (-574.449) [-577.259] (-578.974) * [-576.387] (-579.914) (-576.966) (-583.007) -- 0:00:30
776500 -- (-582.132) (-580.109) (-579.720) [-579.447] * (-578.580) (-579.326) (-580.341) [-576.615] -- 0:00:30
777000 -- (-583.217) (-579.553) [-577.360] (-583.543) * (-575.914) [-580.487] (-579.220) (-582.163) -- 0:00:30
777500 -- [-578.097] (-575.189) (-579.959) (-579.579) * (-583.661) (-584.202) [-576.467] (-580.112) -- 0:00:30
778000 -- (-589.833) [-581.394] (-577.405) (-582.817) * (-587.368) [-577.271] (-578.670) (-582.777) -- 0:00:30
778500 -- (-588.815) (-575.882) (-582.682) [-580.076] * [-577.933] (-576.645) (-577.874) (-578.820) -- 0:00:30
779000 -- [-576.477] (-579.533) (-582.478) (-576.985) * (-587.102) [-577.090] (-574.444) (-579.253) -- 0:00:30
779500 -- (-575.946) (-587.083) [-582.133] (-581.669) * (-581.103) (-579.829) (-578.448) [-575.597] -- 0:00:30
780000 -- (-580.407) [-576.079] (-580.409) (-579.541) * (-580.705) (-579.028) (-575.971) [-580.053] -- 0:00:30
Average standard deviation of split frequencies: 0.005952
780500 -- [-578.599] (-575.784) (-580.604) (-581.064) * (-580.789) [-580.637] (-586.955) (-587.286) -- 0:00:30
781000 -- (-581.092) [-578.301] (-576.994) (-580.801) * (-585.276) [-583.794] (-575.882) (-578.748) -- 0:00:30
781500 -- (-583.287) [-577.662] (-579.905) (-576.479) * [-576.939] (-578.484) (-581.547) (-576.730) -- 0:00:29
782000 -- (-580.322) [-580.415] (-580.811) (-581.451) * [-576.601] (-578.622) (-585.467) (-579.074) -- 0:00:29
782500 -- [-575.323] (-585.937) (-586.436) (-579.815) * [-576.917] (-577.140) (-581.026) (-579.486) -- 0:00:29
783000 -- (-574.597) [-576.131] (-579.230) (-576.336) * (-587.225) [-578.584] (-576.576) (-578.482) -- 0:00:29
783500 -- (-580.390) [-577.825] (-583.504) (-577.499) * (-584.814) [-581.393] (-583.678) (-579.057) -- 0:00:29
784000 -- (-579.781) [-582.202] (-580.383) (-578.503) * (-593.876) (-583.182) (-580.428) [-578.708] -- 0:00:29
784500 -- (-580.137) (-586.379) (-586.574) [-577.389] * [-580.003] (-579.831) (-576.114) (-582.112) -- 0:00:29
785000 -- (-577.574) [-577.292] (-574.696) (-589.465) * (-574.883) (-583.263) (-577.543) [-581.738] -- 0:00:29
Average standard deviation of split frequencies: 0.005826
785500 -- (-577.425) (-576.021) [-576.521] (-578.750) * [-573.505] (-581.044) (-580.422) (-576.854) -- 0:00:29
786000 -- [-580.459] (-584.081) (-579.138) (-577.252) * (-576.319) (-583.552) [-578.451] (-576.165) -- 0:00:29
786500 -- (-578.441) [-578.837] (-578.788) (-577.925) * (-583.659) [-579.149] (-581.113) (-580.422) -- 0:00:29
787000 -- (-582.478) [-584.936] (-576.998) (-580.320) * (-585.259) [-580.616] (-580.070) (-579.288) -- 0:00:29
787500 -- (-580.951) (-581.681) [-578.451] (-581.400) * [-582.311] (-583.505) (-582.272) (-577.970) -- 0:00:29
788000 -- (-579.683) (-577.795) (-581.767) [-582.653] * (-583.501) (-578.621) (-580.262) [-578.752] -- 0:00:29
788500 -- (-580.044) [-575.892] (-584.401) (-590.160) * (-582.544) (-576.015) (-579.538) [-580.424] -- 0:00:28
789000 -- (-580.055) (-589.785) [-578.230] (-584.526) * [-579.053] (-576.657) (-583.471) (-583.775) -- 0:00:28
789500 -- (-577.551) (-579.794) [-581.342] (-581.396) * (-576.801) (-580.153) [-580.363] (-576.366) -- 0:00:28
790000 -- (-584.526) (-580.228) [-575.384] (-581.528) * (-579.924) (-574.817) [-576.566] (-587.302) -- 0:00:28
Average standard deviation of split frequencies: 0.005962
790500 -- (-580.895) (-576.802) [-577.251] (-579.131) * (-578.825) (-577.015) (-577.140) [-580.374] -- 0:00:28
791000 -- [-578.547] (-581.606) (-579.863) (-577.974) * (-574.889) [-577.592] (-574.874) (-576.987) -- 0:00:28
791500 -- [-580.624] (-577.709) (-581.641) (-576.215) * (-576.562) [-579.608] (-578.949) (-574.625) -- 0:00:28
792000 -- (-577.561) [-578.723] (-579.479) (-581.094) * [-581.259] (-582.457) (-580.235) (-576.433) -- 0:00:28
792500 -- (-580.612) (-582.290) [-575.321] (-580.203) * (-584.233) (-578.897) (-581.427) [-576.583] -- 0:00:28
793000 -- [-577.700] (-578.697) (-575.528) (-576.009) * (-584.619) (-580.928) [-580.766] (-579.532) -- 0:00:28
793500 -- (-580.452) (-584.901) [-582.545] (-581.731) * (-579.904) (-585.503) [-581.656] (-584.312) -- 0:00:28
794000 -- (-574.229) (-582.366) [-577.982] (-578.881) * (-580.163) [-577.150] (-589.037) (-579.011) -- 0:00:28
794500 -- [-582.606] (-584.354) (-580.765) (-576.509) * (-588.244) (-583.933) [-583.275] (-584.658) -- 0:00:28
795000 -- [-586.093] (-582.958) (-576.943) (-578.818) * [-579.122] (-579.915) (-585.046) (-577.084) -- 0:00:28
Average standard deviation of split frequencies: 0.005668
795500 -- (-578.912) (-592.678) (-583.250) [-580.868] * [-583.391] (-576.700) (-579.500) (-582.712) -- 0:00:28
796000 -- [-583.564] (-587.388) (-578.668) (-582.204) * [-579.210] (-576.303) (-587.550) (-578.394) -- 0:00:27
796500 -- [-577.938] (-584.310) (-587.269) (-574.859) * (-589.836) (-575.770) [-575.190] (-579.257) -- 0:00:27
797000 -- (-577.299) [-582.652] (-586.435) (-583.096) * (-582.104) (-579.332) [-577.573] (-590.511) -- 0:00:27
797500 -- (-579.933) [-585.928] (-578.872) (-580.235) * (-576.059) (-585.032) [-576.100] (-580.911) -- 0:00:27
798000 -- (-580.876) (-582.727) [-582.402] (-578.565) * (-580.166) [-580.499] (-581.612) (-587.303) -- 0:00:27
798500 -- (-578.106) (-581.834) [-574.595] (-584.132) * (-583.362) (-581.291) [-578.945] (-587.342) -- 0:00:27
799000 -- (-574.464) (-587.578) (-580.728) [-583.954] * [-582.681] (-576.865) (-577.933) (-587.138) -- 0:00:27
799500 -- (-574.085) (-581.253) [-577.324] (-585.365) * (-581.114) [-576.542] (-581.371) (-575.499) -- 0:00:27
800000 -- (-579.129) [-574.747] (-581.682) (-579.836) * (-584.155) (-580.657) [-574.516] (-579.836) -- 0:00:27
Average standard deviation of split frequencies: 0.005635
800500 -- (-578.420) (-577.577) (-579.741) [-578.527] * (-583.951) [-577.837] (-578.125) (-577.740) -- 0:00:27
801000 -- [-573.914] (-581.713) (-582.239) (-575.261) * (-584.640) (-579.710) [-573.669] (-580.123) -- 0:00:27
801500 -- [-578.670] (-579.497) (-581.903) (-581.870) * (-582.123) (-581.746) [-575.157] (-574.259) -- 0:00:27
802000 -- (-577.519) [-579.706] (-581.674) (-576.728) * (-589.137) [-576.129] (-579.711) (-578.826) -- 0:00:27
802500 -- [-578.384] (-580.453) (-577.144) (-581.913) * (-588.215) [-580.123] (-575.391) (-582.956) -- 0:00:27
803000 -- (-572.879) [-580.765] (-579.475) (-583.765) * (-583.757) (-581.076) [-578.605] (-574.229) -- 0:00:26
803500 -- [-580.542] (-578.526) (-579.440) (-581.168) * [-586.604] (-585.175) (-579.081) (-579.901) -- 0:00:26
804000 -- (-573.995) (-586.715) (-575.048) [-575.804] * (-588.760) (-581.188) [-578.535] (-577.552) -- 0:00:26
804500 -- (-577.238) (-577.329) (-582.777) [-576.522] * (-586.161) (-581.596) [-578.270] (-576.293) -- 0:00:26
805000 -- [-578.553] (-581.106) (-582.893) (-577.953) * (-579.803) [-581.367] (-578.648) (-574.469) -- 0:00:26
Average standard deviation of split frequencies: 0.006183
805500 -- (-579.632) (-584.395) (-580.711) [-577.710] * (-577.859) [-581.162] (-577.820) (-577.409) -- 0:00:26
806000 -- (-578.926) (-581.726) (-580.716) [-576.624] * [-580.881] (-581.955) (-578.836) (-576.481) -- 0:00:26
806500 -- (-577.937) [-578.614] (-576.411) (-576.987) * (-584.199) (-583.210) (-584.090) [-578.033] -- 0:00:26
807000 -- [-575.929] (-578.290) (-580.998) (-580.497) * (-578.985) (-579.667) [-579.087] (-580.747) -- 0:00:26
807500 -- (-581.475) (-577.312) (-576.083) [-578.970] * (-583.359) (-578.545) [-573.675] (-579.953) -- 0:00:26
808000 -- [-576.397] (-577.520) (-575.616) (-578.703) * (-585.105) (-582.893) [-578.493] (-581.724) -- 0:00:26
808500 -- (-580.236) (-579.051) (-580.900) [-580.113] * (-581.748) [-584.982] (-575.488) (-578.334) -- 0:00:26
809000 -- (-576.402) (-578.320) [-579.306] (-581.095) * (-579.895) [-576.615] (-584.533) (-580.106) -- 0:00:26
809500 -- (-575.974) (-581.473) (-584.007) [-580.610] * (-582.900) (-579.614) [-577.846] (-578.051) -- 0:00:26
810000 -- [-577.598] (-576.765) (-583.601) (-579.259) * (-578.504) (-579.663) [-580.141] (-586.355) -- 0:00:26
Average standard deviation of split frequencies: 0.006313
810500 -- (-581.245) (-579.622) (-580.716) [-577.421] * (-579.087) [-581.942] (-585.728) (-579.026) -- 0:00:25
811000 -- (-579.117) (-577.234) (-576.307) [-575.518] * (-587.441) (-579.195) (-580.615) [-579.087] -- 0:00:25
811500 -- (-584.081) (-577.274) [-577.557] (-584.102) * (-587.123) (-579.227) [-577.340] (-577.607) -- 0:00:25
812000 -- (-578.416) [-578.432] (-583.764) (-575.432) * (-583.209) (-585.669) (-580.307) [-583.064] -- 0:00:25
812500 -- (-579.157) (-583.376) [-577.048] (-584.402) * (-575.826) (-589.225) (-576.056) [-583.150] -- 0:00:25
813000 -- (-580.517) (-581.510) [-577.534] (-580.217) * (-577.393) (-576.896) [-579.394] (-579.415) -- 0:00:25
813500 -- (-574.935) [-586.266] (-582.394) (-582.280) * (-582.255) [-576.594] (-581.444) (-578.466) -- 0:00:25
814000 -- [-579.722] (-580.110) (-581.019) (-578.062) * (-577.059) (-579.849) [-581.831] (-578.122) -- 0:00:25
814500 -- (-576.489) (-577.273) (-585.250) [-574.965] * (-578.612) (-578.477) (-577.941) [-582.001] -- 0:00:25
815000 -- [-575.917] (-580.292) (-583.866) (-577.929) * (-577.491) (-574.677) [-574.650] (-577.205) -- 0:00:25
Average standard deviation of split frequencies: 0.006437
815500 -- (-579.969) [-575.702] (-588.321) (-586.768) * (-579.203) (-580.763) [-574.739] (-580.255) -- 0:00:25
816000 -- (-578.381) (-580.474) [-581.673] (-578.450) * [-578.514] (-581.998) (-574.589) (-582.359) -- 0:00:25
816500 -- [-580.614] (-574.867) (-584.863) (-576.669) * (-577.968) (-582.601) [-578.158] (-582.454) -- 0:00:25
817000 -- (-578.916) [-574.103] (-587.599) (-578.038) * (-579.600) [-573.913] (-575.563) (-579.059) -- 0:00:25
817500 -- (-580.100) (-580.890) (-575.669) [-574.749] * [-576.620] (-580.935) (-578.092) (-580.694) -- 0:00:25
818000 -- (-580.817) [-574.252] (-582.264) (-576.869) * (-580.170) (-581.305) (-586.451) [-576.990] -- 0:00:24
818500 -- (-581.630) [-576.641] (-573.928) (-584.930) * [-578.337] (-585.235) (-580.144) (-578.316) -- 0:00:24
819000 -- (-584.845) (-581.824) [-577.730] (-581.125) * (-579.324) (-578.850) (-581.864) [-579.786] -- 0:00:24
819500 -- [-580.722] (-577.576) (-577.691) (-577.559) * (-576.504) (-579.428) (-579.305) [-576.787] -- 0:00:24
820000 -- (-583.342) [-574.846] (-580.941) (-577.184) * (-583.942) [-585.346] (-577.849) (-579.029) -- 0:00:24
Average standard deviation of split frequencies: 0.006729
820500 -- [-577.843] (-579.920) (-583.749) (-581.566) * [-579.644] (-580.249) (-577.323) (-576.889) -- 0:00:24
821000 -- (-578.176) (-585.560) [-579.748] (-590.809) * [-574.443] (-584.536) (-575.934) (-583.956) -- 0:00:24
821500 -- (-583.718) [-580.635] (-577.244) (-577.937) * (-583.208) [-582.003] (-575.904) (-580.862) -- 0:00:24
822000 -- [-575.223] (-582.288) (-577.412) (-576.100) * (-576.737) (-582.392) [-580.172] (-575.588) -- 0:00:24
822500 -- (-579.698) [-582.689] (-590.343) (-579.027) * (-576.543) (-584.449) (-582.132) [-578.849] -- 0:00:24
823000 -- (-576.957) (-579.388) [-577.755] (-580.903) * [-577.045] (-585.608) (-577.809) (-580.862) -- 0:00:24
823500 -- (-576.774) [-580.537] (-590.056) (-579.086) * [-588.137] (-579.134) (-579.248) (-578.164) -- 0:00:24
824000 -- (-580.168) (-583.705) (-583.798) [-581.195] * [-577.226] (-581.174) (-577.295) (-577.834) -- 0:00:24
824500 -- (-577.152) (-583.515) [-577.752] (-580.285) * (-582.005) (-576.440) [-579.872] (-582.746) -- 0:00:24
825000 -- (-583.220) (-583.717) (-580.077) [-581.493] * (-574.810) (-577.902) [-581.547] (-585.943) -- 0:00:23
Average standard deviation of split frequencies: 0.006848
825500 -- (-580.567) [-582.058] (-581.405) (-581.810) * [-574.427] (-582.172) (-585.542) (-581.106) -- 0:00:23
826000 -- (-579.291) (-579.569) (-591.454) [-583.866] * [-575.118] (-581.652) (-582.414) (-580.174) -- 0:00:23
826500 -- [-583.756] (-577.842) (-587.299) (-584.756) * (-577.601) [-580.048] (-580.355) (-577.679) -- 0:00:23
827000 -- (-577.152) (-582.301) (-578.421) [-574.694] * (-578.122) (-582.678) (-584.930) [-572.934] -- 0:00:23
827500 -- (-577.040) (-582.437) (-578.861) [-575.386] * (-574.993) (-583.212) (-578.283) [-576.318] -- 0:00:23
828000 -- (-573.495) (-580.338) (-581.815) [-580.713] * [-581.850] (-583.659) (-576.391) (-575.065) -- 0:00:23
828500 -- (-580.502) (-579.100) (-579.696) [-578.650] * (-580.218) (-582.214) (-581.016) [-580.141] -- 0:00:23
829000 -- [-591.171] (-583.875) (-580.631) (-579.917) * (-581.969) [-584.156] (-577.797) (-573.896) -- 0:00:23
829500 -- (-581.507) (-581.960) (-579.686) [-579.509] * (-578.591) (-577.895) (-575.822) [-573.550] -- 0:00:23
830000 -- (-586.224) (-578.498) (-579.170) [-576.112] * [-578.817] (-581.199) (-574.667) (-579.849) -- 0:00:23
Average standard deviation of split frequencies: 0.006648
830500 -- (-578.233) [-576.576] (-582.064) (-580.713) * (-584.352) (-580.915) (-578.491) [-577.702] -- 0:00:23
831000 -- (-576.018) [-575.235] (-579.083) (-579.089) * (-580.047) (-577.052) [-579.856] (-575.311) -- 0:00:23
831500 -- (-585.630) (-583.445) [-576.326] (-584.741) * (-581.208) [-576.488] (-580.793) (-578.602) -- 0:00:23
832000 -- (-581.138) (-578.252) [-576.499] (-580.375) * [-581.004] (-577.888) (-577.128) (-575.944) -- 0:00:23
832500 -- [-574.494] (-578.202) (-575.930) (-574.539) * (-580.813) (-578.625) [-576.925] (-582.218) -- 0:00:22
833000 -- (-584.525) (-576.936) [-575.289] (-584.086) * [-578.435] (-584.766) (-580.239) (-574.348) -- 0:00:22
833500 -- (-587.117) (-579.946) (-577.953) [-580.786] * [-576.463] (-576.256) (-583.235) (-577.252) -- 0:00:22
834000 -- (-576.448) [-578.425] (-579.935) (-582.649) * [-576.426] (-575.305) (-580.820) (-592.214) -- 0:00:22
834500 -- (-581.072) (-586.912) [-580.029] (-582.103) * (-580.723) [-576.929] (-578.148) (-582.395) -- 0:00:22
835000 -- (-584.375) (-585.266) [-577.246] (-583.533) * (-576.963) (-582.165) (-585.204) [-582.111] -- 0:00:22
Average standard deviation of split frequencies: 0.006686
835500 -- (-578.428) [-580.353] (-575.634) (-578.276) * (-582.986) (-577.810) (-579.947) [-581.709] -- 0:00:22
836000 -- (-576.624) (-578.060) [-578.086] (-581.620) * (-577.360) [-574.811] (-582.030) (-581.408) -- 0:00:22
836500 -- (-577.267) [-587.192] (-575.299) (-582.795) * [-577.481] (-576.934) (-580.173) (-577.328) -- 0:00:22
837000 -- (-576.076) (-582.594) [-573.818] (-580.126) * (-576.517) (-575.843) (-582.194) [-581.851] -- 0:00:22
837500 -- (-577.409) [-583.960] (-576.933) (-576.559) * (-580.374) (-575.978) [-573.607] (-576.300) -- 0:00:22
838000 -- (-577.612) (-581.247) [-580.443] (-579.377) * (-578.095) [-578.980] (-583.432) (-578.891) -- 0:00:22
838500 -- [-578.570] (-576.712) (-576.360) (-581.937) * [-577.605] (-576.063) (-577.617) (-579.820) -- 0:00:22
839000 -- (-578.237) [-577.865] (-582.653) (-580.214) * (-581.075) (-578.907) (-580.876) [-577.113] -- 0:00:22
839500 -- [-583.741] (-582.930) (-581.300) (-576.522) * [-579.900] (-579.508) (-575.705) (-580.466) -- 0:00:21
840000 -- (-576.435) [-581.392] (-576.849) (-578.820) * (-576.398) [-578.991] (-587.027) (-581.516) -- 0:00:21
Average standard deviation of split frequencies: 0.006168
840500 -- [-579.780] (-583.743) (-576.815) (-576.470) * (-579.827) (-578.519) (-582.271) [-579.241] -- 0:00:21
841000 -- (-583.032) (-579.845) (-578.591) [-579.504] * (-576.698) [-580.616] (-579.518) (-578.043) -- 0:00:21
841500 -- (-580.121) (-577.815) (-576.192) [-581.695] * (-584.663) (-583.597) [-578.304] (-582.667) -- 0:00:21
842000 -- [-580.637] (-580.657) (-577.910) (-577.301) * (-580.300) (-581.815) [-576.794] (-577.599) -- 0:00:21
842500 -- (-581.213) (-579.319) (-580.531) [-578.075] * (-582.943) (-578.764) [-579.521] (-576.532) -- 0:00:21
843000 -- (-584.026) (-581.307) (-588.078) [-577.273] * (-578.422) [-580.578] (-577.862) (-580.412) -- 0:00:21
843500 -- (-576.039) [-582.012] (-580.110) (-580.069) * (-582.347) (-576.971) [-579.458] (-579.598) -- 0:00:21
844000 -- (-578.564) (-579.880) [-579.048] (-581.688) * [-580.456] (-577.532) (-584.554) (-576.117) -- 0:00:21
844500 -- (-583.007) (-577.743) [-582.869] (-580.659) * (-583.652) (-574.057) [-579.970] (-582.441) -- 0:00:21
845000 -- (-579.859) [-575.772] (-577.948) (-580.366) * (-580.569) (-579.353) [-582.429] (-580.852) -- 0:00:21
Average standard deviation of split frequencies: 0.005970
845500 -- (-574.348) (-576.178) [-586.895] (-580.759) * (-583.020) (-584.917) [-577.500] (-579.440) -- 0:00:21
846000 -- (-576.406) [-580.174] (-590.653) (-585.208) * (-586.439) (-578.683) [-578.863] (-583.361) -- 0:00:21
846500 -- (-580.195) [-579.578] (-585.958) (-590.579) * (-579.670) [-579.870] (-579.235) (-574.776) -- 0:00:21
847000 -- (-578.078) (-577.949) (-593.184) [-585.222] * (-575.745) (-583.940) (-577.408) [-574.558] -- 0:00:20
847500 -- (-580.063) (-577.432) (-581.875) [-576.892] * [-577.661] (-578.298) (-578.458) (-586.152) -- 0:00:20
848000 -- (-580.931) [-578.305] (-580.243) (-581.902) * (-583.147) [-581.060] (-583.245) (-577.945) -- 0:00:20
848500 -- (-580.009) [-578.310] (-579.324) (-582.308) * (-578.802) (-580.625) (-577.496) [-577.669] -- 0:00:20
849000 -- [-577.735] (-578.135) (-578.041) (-580.125) * [-576.321] (-579.283) (-577.331) (-583.185) -- 0:00:20
849500 -- [-579.005] (-578.551) (-584.030) (-577.531) * [-577.207] (-572.330) (-577.925) (-579.688) -- 0:00:20
850000 -- (-579.387) (-576.655) (-578.140) [-579.603] * (-586.619) (-575.090) [-580.440] (-582.897) -- 0:00:20
Average standard deviation of split frequencies: 0.005542
850500 -- [-579.232] (-574.603) (-578.664) (-577.823) * [-577.382] (-578.805) (-581.045) (-586.721) -- 0:00:20
851000 -- (-577.512) (-581.258) (-581.722) [-578.058] * (-580.425) [-577.126] (-578.656) (-582.031) -- 0:00:20
851500 -- (-578.064) (-577.598) (-590.720) [-577.355] * (-584.171) (-584.082) (-578.914) [-580.049] -- 0:00:20
852000 -- [-582.600] (-583.574) (-576.675) (-577.573) * (-588.700) (-587.604) (-577.949) [-578.537] -- 0:00:20
852500 -- (-578.541) (-582.563) (-575.959) [-580.236] * (-581.286) [-582.608] (-578.660) (-587.991) -- 0:00:20
853000 -- (-580.449) [-582.147] (-584.579) (-580.580) * (-588.328) (-575.086) [-577.063] (-584.196) -- 0:00:20
853500 -- (-577.915) [-588.130] (-580.762) (-583.531) * (-585.218) [-576.508] (-575.547) (-584.786) -- 0:00:20
854000 -- [-577.929] (-580.169) (-578.053) (-579.725) * (-589.542) [-582.448] (-574.725) (-577.815) -- 0:00:20
854500 -- (-577.712) (-578.393) (-576.025) [-581.710] * [-588.430] (-577.660) (-578.002) (-578.738) -- 0:00:19
855000 -- (-580.330) [-580.002] (-576.951) (-576.686) * (-583.657) (-580.027) (-578.907) [-578.963] -- 0:00:19
Average standard deviation of split frequencies: 0.005114
855500 -- (-581.473) [-583.514] (-577.384) (-582.157) * (-580.535) (-581.277) [-579.524] (-583.255) -- 0:00:19
856000 -- (-581.282) [-580.109] (-574.950) (-580.898) * (-577.076) [-579.011] (-577.528) (-583.068) -- 0:00:19
856500 -- (-585.784) [-577.242] (-578.153) (-577.611) * [-577.053] (-578.306) (-577.618) (-584.744) -- 0:00:19
857000 -- (-580.285) (-582.551) [-576.908] (-576.962) * (-578.425) [-578.681] (-573.244) (-586.175) -- 0:00:19
857500 -- (-581.503) (-578.436) [-577.733] (-585.739) * [-581.247] (-581.013) (-575.874) (-578.458) -- 0:00:19
858000 -- (-580.181) (-577.200) [-580.029] (-580.005) * (-581.021) [-582.879] (-579.365) (-582.171) -- 0:00:19
858500 -- (-575.605) (-582.595) (-581.086) [-576.015] * (-582.581) [-581.748] (-581.402) (-578.336) -- 0:00:19
859000 -- (-576.930) (-580.108) [-578.253] (-583.032) * [-575.687] (-578.022) (-580.727) (-578.837) -- 0:00:19
859500 -- [-580.438] (-581.112) (-580.117) (-585.327) * (-581.080) [-576.587] (-577.234) (-580.936) -- 0:00:19
860000 -- (-578.639) (-579.747) (-578.616) [-577.476] * (-579.672) [-577.502] (-583.047) (-579.033) -- 0:00:19
Average standard deviation of split frequencies: 0.004773
860500 -- (-577.547) (-580.356) (-583.086) [-575.440] * (-578.616) (-579.264) [-582.140] (-576.714) -- 0:00:19
861000 -- (-583.701) [-578.006] (-579.284) (-582.000) * (-578.868) (-583.822) [-580.105] (-579.428) -- 0:00:19
861500 -- [-580.346] (-577.613) (-579.833) (-575.814) * (-578.650) (-582.786) (-582.207) [-583.936] -- 0:00:18
862000 -- (-578.400) [-579.831] (-576.590) (-582.569) * (-579.415) [-581.329] (-576.618) (-582.902) -- 0:00:18
862500 -- [-580.969] (-580.590) (-577.523) (-579.280) * (-583.412) (-575.351) [-579.071] (-577.612) -- 0:00:18
863000 -- (-580.251) [-578.991] (-577.937) (-578.344) * (-590.562) [-576.980] (-583.812) (-578.557) -- 0:00:18
863500 -- [-580.198] (-583.987) (-581.229) (-580.097) * (-578.849) (-580.385) (-580.231) [-578.934] -- 0:00:18
864000 -- (-585.188) (-581.291) [-577.415] (-575.410) * (-579.270) [-582.569] (-577.921) (-577.728) -- 0:00:18
864500 -- (-585.795) (-586.821) [-582.480] (-585.921) * (-583.111) (-583.571) (-579.620) [-575.453] -- 0:00:18
865000 -- (-590.215) (-581.381) [-579.734] (-581.771) * (-576.812) (-575.595) [-575.761] (-579.987) -- 0:00:18
Average standard deviation of split frequencies: 0.004199
865500 -- [-581.849] (-583.329) (-586.129) (-579.518) * (-577.356) (-574.557) (-577.469) [-577.228] -- 0:00:18
866000 -- [-586.534] (-580.724) (-585.839) (-583.287) * [-580.782] (-574.608) (-583.685) (-577.970) -- 0:00:18
866500 -- (-578.393) (-579.131) (-586.700) [-578.339] * (-580.045) (-582.551) [-578.225] (-579.820) -- 0:00:18
867000 -- (-586.173) (-584.870) [-577.711] (-577.084) * (-575.824) [-577.345] (-579.290) (-585.506) -- 0:00:18
867500 -- (-581.642) (-574.802) [-577.032] (-575.385) * [-573.456] (-574.050) (-579.920) (-582.340) -- 0:00:18
868000 -- (-579.354) (-572.763) [-578.580] (-577.122) * (-581.781) (-581.706) (-583.366) [-582.103] -- 0:00:18
868500 -- [-579.993] (-583.073) (-583.353) (-578.294) * (-575.550) (-578.346) [-574.750] (-579.306) -- 0:00:18
869000 -- (-582.278) [-577.368] (-578.868) (-580.667) * (-576.889) (-578.351) [-576.862] (-584.047) -- 0:00:17
869500 -- (-579.610) [-574.917] (-574.806) (-589.038) * (-578.189) [-576.997] (-577.960) (-587.422) -- 0:00:17
870000 -- (-582.144) (-577.600) [-574.665] (-579.530) * (-577.437) (-576.862) [-581.130] (-576.629) -- 0:00:17
Average standard deviation of split frequencies: 0.003481
870500 -- (-584.083) (-581.385) (-576.205) [-580.517] * (-582.545) [-581.240] (-578.695) (-578.287) -- 0:00:17
871000 -- (-578.383) (-578.118) (-576.589) [-577.158] * [-576.799] (-578.338) (-577.336) (-578.327) -- 0:00:17
871500 -- (-583.564) (-575.329) [-580.532] (-576.161) * (-573.367) (-582.534) (-591.549) [-576.517] -- 0:00:17
872000 -- (-583.060) (-580.832) [-575.215] (-582.030) * [-574.527] (-576.251) (-577.382) (-577.797) -- 0:00:17
872500 -- (-576.431) (-581.902) (-574.190) [-579.158] * (-580.810) [-583.181] (-583.612) (-578.806) -- 0:00:17
873000 -- [-581.524] (-585.771) (-582.755) (-578.894) * [-575.224] (-575.998) (-583.024) (-578.649) -- 0:00:17
873500 -- (-573.814) (-576.846) [-577.123] (-578.868) * (-572.832) (-583.407) [-577.810] (-582.739) -- 0:00:17
874000 -- (-590.790) [-584.954] (-580.380) (-580.656) * (-581.600) [-579.605] (-578.780) (-583.710) -- 0:00:17
874500 -- (-574.949) [-580.748] (-582.155) (-584.325) * (-579.148) (-578.198) (-581.609) [-579.188] -- 0:00:17
875000 -- (-577.713) [-581.455] (-578.064) (-584.837) * (-577.917) [-580.192] (-580.577) (-580.739) -- 0:00:17
Average standard deviation of split frequencies: 0.003229
875500 -- (-573.439) (-591.082) (-574.691) [-582.016] * (-582.649) [-579.176] (-582.413) (-580.001) -- 0:00:17
876000 -- [-578.926] (-584.853) (-583.150) (-583.749) * (-583.933) [-574.087] (-580.780) (-577.818) -- 0:00:16
876500 -- (-577.399) (-581.801) (-580.944) [-577.092] * [-577.559] (-582.391) (-581.415) (-584.555) -- 0:00:16
877000 -- (-580.195) (-579.882) (-576.928) [-577.714] * (-587.032) [-581.854] (-580.470) (-579.203) -- 0:00:16
877500 -- (-579.714) (-584.411) (-581.979) [-580.018] * (-578.989) (-577.017) (-579.463) [-574.153] -- 0:00:16
878000 -- (-579.586) (-577.898) (-587.037) [-577.671] * (-578.736) (-583.158) [-577.940] (-580.118) -- 0:00:16
878500 -- [-574.207] (-576.612) (-581.214) (-576.398) * [-578.111] (-579.577) (-578.428) (-582.567) -- 0:00:16
879000 -- (-577.218) (-583.257) (-581.935) [-577.725] * [-581.714] (-578.660) (-582.155) (-577.833) -- 0:00:16
879500 -- (-582.133) (-578.156) (-579.736) [-578.590] * (-575.483) (-577.449) (-578.871) [-578.140] -- 0:00:16
880000 -- (-580.154) (-573.839) [-581.091] (-576.035) * (-577.716) (-578.987) [-584.228] (-585.157) -- 0:00:16
Average standard deviation of split frequencies: 0.003671
880500 -- (-580.690) [-578.561] (-578.516) (-582.383) * [-578.967] (-574.371) (-587.435) (-585.442) -- 0:00:16
881000 -- (-581.910) [-581.259] (-578.223) (-582.461) * (-579.641) [-584.072] (-577.982) (-579.236) -- 0:00:16
881500 -- (-580.373) (-579.761) [-585.215] (-579.351) * (-592.300) (-575.828) (-579.194) [-577.978] -- 0:00:16
882000 -- (-577.466) (-584.794) (-578.122) [-577.286] * (-581.645) [-575.673] (-580.898) (-580.297) -- 0:00:16
882500 -- (-579.223) (-585.118) [-580.316] (-579.113) * [-579.327] (-578.491) (-577.278) (-590.191) -- 0:00:16
883000 -- [-578.518] (-580.737) (-577.539) (-575.651) * (-580.187) [-577.963] (-592.762) (-582.353) -- 0:00:16
883500 -- (-585.167) (-581.871) [-576.710] (-576.315) * (-579.015) (-575.276) [-576.496] (-576.330) -- 0:00:15
884000 -- (-579.389) (-583.965) (-575.532) [-579.988] * (-576.770) [-574.196] (-580.426) (-576.906) -- 0:00:15
884500 -- (-579.748) (-580.180) [-576.458] (-580.200) * [-576.651] (-582.916) (-582.756) (-581.117) -- 0:00:15
885000 -- [-577.700] (-582.190) (-575.076) (-577.842) * (-576.686) (-579.652) [-585.082] (-587.634) -- 0:00:15
Average standard deviation of split frequencies: 0.003952
885500 -- (-578.130) [-580.004] (-578.112) (-582.105) * (-578.585) (-583.940) [-579.814] (-583.836) -- 0:00:15
886000 -- (-581.566) (-577.059) [-577.044] (-577.426) * (-581.582) [-577.822] (-581.154) (-579.031) -- 0:00:15
886500 -- (-585.080) (-579.613) [-574.758] (-585.009) * (-580.441) [-576.344] (-574.182) (-579.274) -- 0:00:15
887000 -- [-580.243] (-579.739) (-578.851) (-576.225) * [-581.007] (-579.765) (-580.743) (-575.295) -- 0:00:15
887500 -- (-586.785) (-581.363) (-578.836) [-582.230] * (-583.480) (-577.213) [-581.110] (-583.497) -- 0:00:15
888000 -- (-585.111) [-575.606] (-576.878) (-576.807) * (-579.113) (-581.232) [-584.914] (-579.929) -- 0:00:15
888500 -- (-574.466) (-576.626) [-579.566] (-582.613) * [-581.550] (-581.919) (-578.656) (-578.542) -- 0:00:15
889000 -- (-580.015) (-577.982) [-579.047] (-578.675) * [-577.621] (-580.053) (-576.982) (-581.267) -- 0:00:15
889500 -- (-576.443) [-574.379] (-578.696) (-579.727) * (-577.545) (-583.816) (-579.122) [-580.001] -- 0:00:15
890000 -- (-578.823) [-581.535] (-578.539) (-583.196) * [-580.706] (-579.610) (-574.428) (-580.265) -- 0:00:15
Average standard deviation of split frequencies: 0.004385
890500 -- (-578.652) (-579.536) [-575.559] (-580.562) * (-580.322) (-583.514) [-578.148] (-590.976) -- 0:00:15
891000 -- [-577.342] (-577.725) (-580.839) (-582.175) * (-583.231) (-579.011) (-581.075) [-578.197] -- 0:00:14
891500 -- (-578.091) (-575.254) [-578.670] (-580.314) * (-579.578) (-575.957) [-579.399] (-579.780) -- 0:00:14
892000 -- [-576.970] (-578.444) (-586.604) (-578.881) * (-585.837) [-579.744] (-585.288) (-578.324) -- 0:00:14
892500 -- (-582.383) (-584.080) (-584.339) [-576.336] * (-581.639) [-577.399] (-578.246) (-578.080) -- 0:00:14
893000 -- (-576.723) (-582.951) (-585.005) [-582.482] * (-581.968) (-574.948) [-579.660] (-586.036) -- 0:00:14
893500 -- (-578.019) [-580.186] (-590.939) (-578.003) * (-581.016) [-575.266] (-573.683) (-576.465) -- 0:00:14
894000 -- (-579.042) (-577.116) (-577.826) [-575.501] * (-579.832) [-583.429] (-579.232) (-584.020) -- 0:00:14
894500 -- [-580.301] (-584.164) (-577.281) (-580.880) * (-581.966) [-579.647] (-577.803) (-582.567) -- 0:00:14
895000 -- (-580.066) (-579.807) (-575.602) [-581.406] * [-582.269] (-579.068) (-576.605) (-577.707) -- 0:00:14
Average standard deviation of split frequencies: 0.004134
895500 -- (-578.889) [-580.084] (-579.632) (-577.031) * (-577.589) (-580.426) [-577.133] (-578.098) -- 0:00:14
896000 -- (-583.860) (-583.250) [-575.236] (-578.934) * [-578.364] (-581.316) (-576.899) (-581.237) -- 0:00:14
896500 -- [-580.928] (-583.580) (-573.997) (-577.031) * (-579.747) (-580.030) [-575.547] (-577.230) -- 0:00:14
897000 -- (-578.593) [-579.821] (-578.443) (-580.602) * (-586.169) (-575.197) (-582.986) [-573.800] -- 0:00:14
897500 -- [-580.348] (-581.189) (-583.881) (-575.287) * (-588.435) (-579.813) (-577.909) [-576.013] -- 0:00:14
898000 -- (-585.349) [-578.839] (-578.607) (-575.650) * (-592.497) (-577.856) (-578.766) [-576.755] -- 0:00:13
898500 -- [-578.849] (-581.745) (-577.957) (-576.408) * (-582.460) [-576.679] (-581.111) (-576.328) -- 0:00:13
899000 -- (-576.352) [-582.647] (-577.806) (-577.781) * (-583.373) (-575.540) (-580.489) [-581.376] -- 0:00:13
899500 -- (-576.299) (-579.409) [-576.628] (-582.898) * [-581.819] (-581.428) (-579.949) (-585.666) -- 0:00:13
900000 -- [-577.994] (-580.969) (-579.759) (-578.482) * [-577.981] (-588.145) (-578.777) (-581.845) -- 0:00:13
Average standard deviation of split frequencies: 0.004112
900500 -- (-586.959) [-581.837] (-586.823) (-575.126) * (-582.831) (-587.802) (-578.038) [-581.418] -- 0:00:13
901000 -- [-577.962] (-586.370) (-577.065) (-579.280) * (-578.841) [-575.558] (-582.783) (-579.636) -- 0:00:13
901500 -- (-582.125) (-583.932) (-576.730) [-581.071] * (-581.920) (-573.491) (-576.934) [-579.002] -- 0:00:13
902000 -- (-580.264) (-580.953) [-582.388] (-575.599) * (-581.047) [-578.141] (-581.636) (-581.836) -- 0:00:13
902500 -- [-579.770] (-578.818) (-582.168) (-588.576) * (-578.951) (-583.348) [-584.136] (-579.729) -- 0:00:13
903000 -- [-583.293] (-580.135) (-580.782) (-583.061) * [-577.479] (-579.860) (-582.284) (-583.134) -- 0:00:13
903500 -- (-576.432) [-575.796] (-576.904) (-577.550) * [-576.723] (-574.444) (-581.864) (-574.315) -- 0:00:13
904000 -- (-582.830) (-583.506) [-579.389] (-580.258) * (-580.656) (-578.257) [-583.147] (-577.128) -- 0:00:13
904500 -- (-582.671) (-578.884) [-576.226] (-581.450) * (-582.511) [-571.903] (-581.472) (-584.198) -- 0:00:13
905000 -- (-585.332) [-580.114] (-576.463) (-577.844) * (-579.208) [-575.786] (-581.781) (-580.467) -- 0:00:13
Average standard deviation of split frequencies: 0.004608
905500 -- (-577.812) (-578.803) (-579.432) [-576.374] * (-576.146) (-578.697) (-578.609) [-582.262] -- 0:00:12
906000 -- (-577.813) (-579.183) [-581.399] (-585.132) * (-580.204) (-578.245) [-578.607] (-580.208) -- 0:00:12
906500 -- (-577.475) [-576.645] (-577.602) (-579.914) * (-581.287) [-575.654] (-596.062) (-581.414) -- 0:00:12
907000 -- (-577.591) (-577.060) (-583.688) [-585.297] * [-582.262] (-584.045) (-586.256) (-579.833) -- 0:00:12
907500 -- (-581.525) (-576.627) (-581.361) [-576.852] * (-582.710) [-577.231] (-582.995) (-577.344) -- 0:00:12
908000 -- (-586.728) (-577.823) (-578.072) [-575.196] * [-575.497] (-578.551) (-578.894) (-581.336) -- 0:00:12
908500 -- (-583.108) (-587.659) (-584.974) [-575.781] * [-577.609] (-587.619) (-578.213) (-578.341) -- 0:00:12
909000 -- (-583.721) (-582.644) (-582.300) [-573.466] * (-580.613) (-585.603) [-578.706] (-581.801) -- 0:00:12
909500 -- (-580.885) (-583.374) [-575.695] (-585.557) * (-585.831) (-578.485) (-575.779) [-578.608] -- 0:00:12
910000 -- (-576.615) (-585.377) (-579.787) [-581.768] * [-573.248] (-580.772) (-576.450) (-588.481) -- 0:00:12
Average standard deviation of split frequencies: 0.004215
910500 -- (-579.134) (-582.401) (-579.989) [-577.583] * [-576.285] (-581.276) (-580.407) (-580.030) -- 0:00:12
911000 -- (-580.038) [-580.402] (-580.456) (-575.881) * (-580.250) [-584.108] (-576.248) (-583.257) -- 0:00:12
911500 -- (-578.586) (-582.260) (-575.754) [-579.331] * (-577.557) [-577.518] (-582.248) (-577.672) -- 0:00:12
912000 -- (-577.412) (-581.607) (-579.057) [-572.333] * [-574.606] (-579.485) (-579.292) (-581.666) -- 0:00:12
912500 -- (-576.915) (-582.111) (-583.124) [-581.149] * [-573.305] (-577.741) (-577.591) (-578.421) -- 0:00:11
913000 -- [-579.605] (-587.299) (-580.506) (-577.056) * (-584.191) (-574.982) [-580.027] (-582.996) -- 0:00:11
913500 -- (-581.480) (-581.612) (-581.615) [-579.097] * [-575.960] (-580.786) (-578.804) (-581.349) -- 0:00:11
914000 -- (-580.539) (-582.549) [-579.997] (-580.991) * (-587.566) (-576.849) (-574.805) [-575.596] -- 0:00:11
914500 -- [-575.329] (-582.621) (-586.575) (-581.977) * (-577.746) (-577.882) (-576.966) [-576.571] -- 0:00:11
915000 -- (-580.403) (-585.876) [-578.948] (-583.410) * (-584.700) [-575.284] (-583.505) (-577.634) -- 0:00:11
Average standard deviation of split frequencies: 0.004558
915500 -- (-580.939) (-587.534) (-583.733) [-579.823] * (-576.189) (-577.860) [-578.442] (-582.602) -- 0:00:11
916000 -- (-579.702) (-582.570) [-581.448] (-579.579) * [-578.096] (-580.844) (-578.148) (-584.721) -- 0:00:11
916500 -- (-581.081) (-583.161) (-584.301) [-579.325] * (-577.081) (-581.907) [-576.586] (-585.591) -- 0:00:11
917000 -- (-579.353) (-577.561) (-583.273) [-576.673] * [-579.924] (-582.724) (-583.918) (-582.768) -- 0:00:11
917500 -- (-582.868) [-581.434] (-579.675) (-580.894) * (-585.084) (-581.127) [-576.462] (-585.818) -- 0:00:11
918000 -- (-582.150) (-580.355) (-580.732) [-580.173] * (-584.496) (-581.255) [-576.590] (-577.163) -- 0:00:11
918500 -- (-584.157) [-581.448] (-579.045) (-575.620) * [-577.408] (-583.168) (-585.334) (-579.867) -- 0:00:11
919000 -- (-578.075) (-576.316) [-580.297] (-589.369) * (-578.709) (-583.659) [-578.168] (-582.097) -- 0:00:11
919500 -- (-582.082) (-580.288) (-576.791) [-576.341] * (-580.570) (-587.705) [-573.193] (-589.509) -- 0:00:11
920000 -- (-585.443) (-583.500) (-580.551) [-581.257] * [-580.886] (-581.877) (-577.919) (-578.026) -- 0:00:10
Average standard deviation of split frequencies: 0.004681
920500 -- [-576.759] (-579.945) (-577.960) (-587.536) * (-579.048) [-575.850] (-583.302) (-577.697) -- 0:00:10
921000 -- (-578.930) (-580.045) (-587.464) [-584.877] * (-579.098) (-579.528) [-577.222] (-584.881) -- 0:00:10
921500 -- (-578.970) (-580.412) (-577.466) [-576.862] * [-577.644] (-576.495) (-574.443) (-577.128) -- 0:00:10
922000 -- [-576.625] (-582.425) (-577.812) (-581.707) * (-582.066) (-578.073) (-585.135) [-576.697] -- 0:00:10
922500 -- [-575.142] (-581.976) (-579.516) (-583.680) * (-579.350) (-582.903) (-578.927) [-578.712] -- 0:00:10
923000 -- [-579.136] (-578.690) (-577.397) (-590.618) * (-584.763) (-578.510) [-580.786] (-574.918) -- 0:00:10
923500 -- (-575.790) (-578.822) [-576.372] (-584.208) * [-578.129] (-587.204) (-581.846) (-578.173) -- 0:00:10
924000 -- (-578.677) (-580.716) (-578.667) [-580.147] * [-575.867] (-578.592) (-579.797) (-578.518) -- 0:00:10
924500 -- (-581.171) [-578.225] (-585.329) (-586.818) * (-576.032) [-583.253] (-578.799) (-579.935) -- 0:00:10
925000 -- (-583.586) (-579.033) [-584.309] (-585.831) * (-575.567) (-584.450) [-577.612] (-590.803) -- 0:00:10
Average standard deviation of split frequencies: 0.004436
925500 -- (-581.848) (-582.345) [-581.131] (-586.960) * [-576.159] (-578.581) (-580.093) (-579.792) -- 0:00:10
926000 -- (-577.862) (-579.730) [-575.651] (-579.742) * (-577.129) (-580.025) [-578.605] (-586.933) -- 0:00:10
926500 -- [-585.261] (-576.101) (-577.458) (-574.762) * (-577.684) (-580.534) (-579.040) [-582.321] -- 0:00:10
927000 -- [-578.855] (-584.661) (-581.632) (-582.995) * [-581.263] (-576.483) (-580.619) (-577.382) -- 0:00:10
927500 -- (-577.199) (-574.280) [-579.177] (-578.842) * (-581.405) [-576.342] (-574.229) (-576.451) -- 0:00:09
928000 -- (-578.928) [-576.484] (-577.631) (-581.820) * (-593.072) (-577.520) [-588.944] (-578.952) -- 0:00:09
928500 -- (-579.831) (-576.283) (-578.620) [-576.651] * (-579.647) [-576.035] (-579.439) (-575.594) -- 0:00:09
929000 -- (-578.263) (-581.077) (-584.521) [-579.563] * [-576.737] (-585.149) (-579.960) (-582.474) -- 0:00:09
929500 -- (-577.439) [-578.316] (-579.629) (-579.447) * [-584.976] (-581.256) (-589.555) (-575.214) -- 0:00:09
930000 -- (-577.539) (-587.420) [-576.578] (-584.404) * (-580.878) (-586.527) (-586.639) [-574.880] -- 0:00:09
Average standard deviation of split frequencies: 0.004848
930500 -- (-583.226) (-575.906) (-573.687) [-575.975] * [-581.993] (-581.284) (-582.312) (-580.466) -- 0:00:09
931000 -- [-578.802] (-574.896) (-575.508) (-580.249) * (-581.482) (-576.201) (-574.008) [-580.116] -- 0:00:09
931500 -- (-581.036) (-578.580) [-575.678] (-579.270) * (-578.874) (-575.447) (-575.496) [-583.684] -- 0:00:09
932000 -- (-577.438) [-579.730] (-577.173) (-580.097) * (-586.298) [-577.455] (-575.363) (-580.670) -- 0:00:09
932500 -- (-578.601) (-581.736) (-579.253) [-580.329] * (-580.158) (-583.711) [-574.435] (-580.349) -- 0:00:09
933000 -- (-586.555) [-578.165] (-581.213) (-576.439) * [-577.267] (-578.961) (-580.510) (-578.206) -- 0:00:09
933500 -- (-580.971) [-577.869] (-578.433) (-575.803) * (-597.192) [-577.787] (-574.727) (-579.357) -- 0:00:09
934000 -- (-579.225) [-578.744] (-586.052) (-582.208) * (-576.850) [-576.614] (-579.751) (-588.109) -- 0:00:09
934500 -- [-578.386] (-582.210) (-575.407) (-575.884) * [-577.401] (-580.479) (-589.145) (-582.879) -- 0:00:08
935000 -- [-579.575] (-582.150) (-584.440) (-579.038) * (-581.175) (-583.056) (-581.380) [-577.980] -- 0:00:08
Average standard deviation of split frequencies: 0.004749
935500 -- [-578.521] (-579.711) (-575.978) (-581.390) * (-587.280) [-578.773] (-584.786) (-583.408) -- 0:00:08
936000 -- (-589.143) (-576.876) [-579.459] (-578.303) * (-584.362) (-578.951) [-581.612] (-578.004) -- 0:00:08
936500 -- (-582.999) (-577.058) [-588.266] (-577.550) * (-574.863) (-578.497) [-582.672] (-582.773) -- 0:00:08
937000 -- (-579.351) [-578.000] (-586.249) (-578.553) * (-580.001) (-577.954) [-578.307] (-584.436) -- 0:00:08
937500 -- [-578.846] (-576.086) (-580.959) (-583.136) * (-580.949) [-582.414] (-580.073) (-578.987) -- 0:00:08
938000 -- (-577.856) (-580.195) (-583.402) [-577.784] * (-584.250) (-578.985) (-578.599) [-576.882] -- 0:00:08
938500 -- (-579.842) (-579.183) (-581.215) [-576.205] * (-576.722) [-576.715] (-582.024) (-579.460) -- 0:00:08
939000 -- (-579.008) (-581.721) [-577.327] (-575.459) * (-582.859) (-577.142) (-582.401) [-575.629] -- 0:00:08
939500 -- (-581.470) (-580.456) (-585.874) [-581.722] * [-584.248] (-587.560) (-584.931) (-584.195) -- 0:00:08
940000 -- (-576.257) (-580.234) (-583.271) [-579.215] * (-581.607) (-586.701) [-582.031] (-577.274) -- 0:00:08
Average standard deviation of split frequencies: 0.005298
940500 -- (-577.339) (-579.163) (-583.179) [-582.568] * [-579.909] (-582.019) (-581.366) (-579.545) -- 0:00:08
941000 -- [-578.323] (-574.947) (-578.201) (-580.708) * (-584.119) [-581.686] (-578.872) (-582.620) -- 0:00:08
941500 -- (-579.967) (-576.801) (-579.407) [-582.768] * (-578.975) (-578.268) [-578.216] (-578.018) -- 0:00:08
942000 -- (-577.993) (-578.739) (-583.898) [-586.348] * (-579.359) (-579.283) [-583.125] (-581.434) -- 0:00:07
942500 -- (-576.153) (-576.850) [-578.987] (-584.190) * (-578.964) (-579.275) [-579.053] (-580.072) -- 0:00:07
943000 -- [-574.515] (-576.972) (-577.717) (-578.842) * (-582.260) (-581.124) (-583.540) [-575.051] -- 0:00:07
943500 -- (-576.903) (-579.473) [-574.378] (-575.317) * [-576.821] (-584.011) (-581.391) (-578.564) -- 0:00:07
944000 -- [-574.257] (-580.239) (-577.998) (-578.437) * (-576.363) (-582.271) [-579.193] (-578.435) -- 0:00:07
944500 -- [-577.243] (-576.728) (-580.681) (-581.372) * [-575.183] (-583.891) (-576.465) (-580.573) -- 0:00:07
945000 -- (-582.058) (-583.342) [-578.198] (-583.285) * (-574.539) [-581.559] (-577.404) (-585.747) -- 0:00:07
Average standard deviation of split frequencies: 0.005339
945500 -- [-574.571] (-586.686) (-581.844) (-576.423) * [-583.794] (-578.096) (-582.343) (-582.201) -- 0:00:07
946000 -- [-576.878] (-578.676) (-580.318) (-575.330) * [-577.561] (-586.295) (-580.299) (-578.992) -- 0:00:07
946500 -- (-578.783) (-574.548) (-584.511) [-576.231] * [-581.665] (-580.746) (-584.837) (-579.308) -- 0:00:07
947000 -- [-582.678] (-578.591) (-590.813) (-576.845) * [-582.549] (-580.143) (-583.125) (-579.346) -- 0:00:07
947500 -- (-582.655) (-578.759) [-581.131] (-575.861) * (-585.118) (-575.233) [-579.992] (-583.819) -- 0:00:07
948000 -- [-573.874] (-582.391) (-585.112) (-576.060) * (-581.387) [-579.791] (-576.400) (-585.970) -- 0:00:07
948500 -- (-589.064) (-579.028) (-585.321) [-574.817] * (-579.336) (-578.923) [-575.252] (-578.938) -- 0:00:07
949000 -- (-578.576) (-584.455) (-584.758) [-580.354] * (-576.688) [-588.349] (-583.019) (-585.727) -- 0:00:06
949500 -- (-583.425) (-580.827) (-580.881) [-585.063] * [-574.206] (-584.676) (-575.976) (-589.585) -- 0:00:06
950000 -- [-581.216] (-575.009) (-581.938) (-579.240) * (-575.814) [-579.793] (-583.110) (-586.101) -- 0:00:06
Average standard deviation of split frequencies: 0.005525
950500 -- [-592.056] (-583.994) (-582.448) (-579.599) * (-578.460) (-578.339) [-573.431] (-578.951) -- 0:00:06
951000 -- (-583.670) [-577.565] (-582.711) (-578.563) * [-576.196] (-582.180) (-584.412) (-578.019) -- 0:00:06
951500 -- [-581.999] (-587.772) (-585.424) (-576.240) * (-575.763) [-575.475] (-580.789) (-582.932) -- 0:00:06
952000 -- (-585.611) [-577.240] (-578.041) (-578.883) * (-580.185) (-574.395) (-575.251) [-584.189] -- 0:00:06
952500 -- (-581.574) [-576.774] (-577.864) (-577.130) * (-579.307) (-580.915) [-578.860] (-581.459) -- 0:00:06
953000 -- (-582.201) (-577.624) (-579.537) [-578.061] * (-583.381) (-581.713) [-579.043] (-580.203) -- 0:00:06
953500 -- [-578.185] (-579.032) (-575.512) (-579.371) * (-576.409) [-580.505] (-578.350) (-580.012) -- 0:00:06
954000 -- (-575.546) [-577.982] (-582.266) (-585.172) * (-579.868) [-578.718] (-581.347) (-576.609) -- 0:00:06
954500 -- (-577.371) (-577.739) [-578.207] (-588.586) * (-578.779) [-580.573] (-582.915) (-579.480) -- 0:00:06
955000 -- (-580.359) [-574.797] (-579.574) (-582.105) * (-580.294) (-585.436) (-578.677) [-583.509] -- 0:00:06
Average standard deviation of split frequencies: 0.006058
955500 -- [-576.341] (-577.082) (-579.937) (-583.151) * (-586.404) (-580.825) [-577.785] (-577.025) -- 0:00:06
956000 -- [-576.467] (-577.657) (-578.139) (-582.544) * [-580.529] (-580.521) (-579.001) (-582.190) -- 0:00:06
956500 -- (-573.711) (-576.353) (-579.247) [-580.812] * [-575.404] (-579.071) (-577.116) (-579.326) -- 0:00:05
957000 -- (-580.911) [-581.998] (-584.443) (-580.342) * (-576.204) [-580.782] (-580.783) (-581.818) -- 0:00:05
957500 -- (-580.722) [-578.029] (-577.874) (-578.388) * (-574.400) [-576.979] (-577.704) (-580.225) -- 0:00:05
958000 -- [-581.874] (-582.162) (-581.689) (-577.000) * (-574.392) (-578.376) (-581.232) [-583.555] -- 0:00:05
958500 -- [-582.519] (-581.373) (-575.679) (-583.149) * (-582.424) [-576.918] (-580.006) (-575.403) -- 0:00:05
959000 -- (-576.823) (-579.533) [-581.069] (-582.230) * (-588.373) (-579.198) [-580.081] (-577.222) -- 0:00:05
959500 -- [-578.471] (-584.654) (-577.138) (-584.621) * (-580.385) [-576.090] (-580.398) (-580.429) -- 0:00:05
960000 -- [-583.255] (-576.508) (-577.430) (-584.196) * (-578.445) (-580.659) (-578.003) [-575.913] -- 0:00:05
Average standard deviation of split frequencies: 0.006870
960500 -- (-579.713) [-579.313] (-581.324) (-587.927) * (-584.780) (-580.574) (-579.938) [-585.540] -- 0:00:05
961000 -- (-579.057) (-579.520) (-576.192) [-580.592] * [-581.560] (-591.762) (-578.627) (-577.941) -- 0:00:05
961500 -- [-576.381] (-579.915) (-577.582) (-576.610) * (-583.745) (-583.718) (-577.985) [-577.650] -- 0:00:05
962000 -- (-582.457) [-578.461] (-578.964) (-590.445) * (-579.181) (-578.871) [-586.107] (-578.062) -- 0:00:05
962500 -- (-577.644) [-578.303] (-574.871) (-581.890) * (-579.285) (-577.778) (-580.338) [-579.647] -- 0:00:05
963000 -- (-583.949) [-579.592] (-576.701) (-579.898) * (-578.429) (-577.815) [-580.929] (-578.686) -- 0:00:05
963500 -- [-578.166] (-574.858) (-577.872) (-579.624) * (-576.708) (-587.198) [-577.723] (-585.983) -- 0:00:05
964000 -- [-577.234] (-581.200) (-581.774) (-583.362) * [-578.146] (-585.468) (-587.025) (-576.509) -- 0:00:04
964500 -- (-583.549) (-584.140) [-577.485] (-583.500) * (-576.351) [-578.379] (-579.615) (-578.557) -- 0:00:04
965000 -- [-575.507] (-578.542) (-583.709) (-584.714) * [-576.993] (-577.897) (-581.574) (-576.483) -- 0:00:04
Average standard deviation of split frequencies: 0.007390
965500 -- [-577.443] (-578.193) (-583.604) (-581.591) * [-576.066] (-577.181) (-580.183) (-577.151) -- 0:00:04
966000 -- [-580.927] (-583.409) (-583.682) (-586.368) * (-580.776) (-580.218) (-580.817) [-577.198] -- 0:00:04
966500 -- [-581.218] (-580.038) (-581.679) (-580.651) * (-577.318) (-580.702) (-581.369) [-581.662] -- 0:00:04
967000 -- (-578.103) [-577.836] (-585.708) (-579.478) * (-586.588) (-579.104) [-576.953] (-583.685) -- 0:00:04
967500 -- (-588.001) (-582.239) (-582.628) [-579.792] * (-579.697) (-576.650) (-578.764) [-580.849] -- 0:00:04
968000 -- (-585.343) (-578.093) (-580.681) [-576.631] * (-575.650) (-575.323) [-579.664] (-578.221) -- 0:00:04
968500 -- (-580.962) (-583.261) [-579.848] (-576.541) * (-579.411) (-578.696) (-573.978) [-577.878] -- 0:00:04
969000 -- (-577.402) [-581.389] (-576.619) (-586.326) * (-577.646) (-583.342) (-580.026) [-578.060] -- 0:00:04
969500 -- (-580.768) (-586.193) (-580.501) [-583.226] * (-575.791) (-577.750) [-574.910] (-584.045) -- 0:00:04
970000 -- (-580.405) (-578.993) [-581.915] (-579.426) * (-578.400) (-577.988) (-577.369) [-583.393] -- 0:00:04
Average standard deviation of split frequencies: 0.007146
970500 -- (-578.806) (-579.334) (-577.534) [-586.351] * [-585.241] (-574.628) (-581.503) (-583.094) -- 0:00:04
971000 -- (-581.080) (-582.224) [-581.968] (-582.250) * (-586.172) (-581.016) (-582.255) [-574.822] -- 0:00:03
971500 -- (-583.819) (-583.167) [-582.269] (-584.229) * (-589.451) (-586.639) (-585.683) [-575.975] -- 0:00:03
972000 -- (-581.064) [-580.571] (-582.299) (-585.978) * [-577.067] (-579.394) (-585.088) (-577.399) -- 0:00:03
972500 -- (-578.639) (-581.871) [-581.757] (-581.141) * (-581.424) (-582.048) (-589.598) [-577.641] -- 0:00:03
973000 -- (-579.438) (-584.593) (-586.868) [-581.346] * (-577.353) (-577.650) (-582.322) [-578.072] -- 0:00:03
973500 -- [-577.928] (-587.878) (-579.509) (-577.745) * (-584.665) [-577.366] (-582.926) (-581.846) -- 0:00:03
974000 -- (-580.069) (-589.463) (-577.712) [-579.675] * (-577.163) [-577.572] (-576.428) (-581.446) -- 0:00:03
974500 -- [-579.011] (-581.817) (-580.959) (-580.355) * (-579.067) [-580.646] (-584.077) (-593.538) -- 0:00:03
975000 -- [-583.256] (-577.602) (-579.755) (-581.019) * (-577.914) (-581.640) [-577.450] (-581.069) -- 0:00:03
Average standard deviation of split frequencies: 0.006831
975500 -- (-579.696) (-580.688) [-583.521] (-582.149) * (-580.787) (-576.717) [-579.812] (-582.317) -- 0:00:03
976000 -- [-576.955] (-576.739) (-575.662) (-581.619) * [-575.276] (-585.404) (-579.472) (-579.207) -- 0:00:03
976500 -- (-582.441) [-577.247] (-578.879) (-584.709) * (-579.805) (-577.720) (-580.450) [-583.460] -- 0:00:03
977000 -- (-576.555) (-578.515) [-577.464] (-582.012) * (-583.252) [-583.884] (-574.619) (-579.828) -- 0:00:03
977500 -- (-576.508) (-578.207) (-577.305) [-578.030] * (-583.249) [-580.433] (-585.980) (-576.397) -- 0:00:03
978000 -- (-576.752) (-576.307) (-577.610) [-577.675] * [-585.726] (-578.389) (-576.432) (-582.932) -- 0:00:03
978500 -- (-575.981) (-579.346) [-583.884] (-577.974) * (-584.148) (-580.417) (-577.955) [-581.375] -- 0:00:02
979000 -- (-585.225) (-577.734) [-579.974] (-584.021) * (-586.695) [-584.275] (-581.947) (-583.171) -- 0:00:02
979500 -- (-578.956) (-579.260) (-578.998) [-584.983] * (-576.458) (-585.091) [-576.167] (-581.954) -- 0:00:02
980000 -- (-583.095) (-582.813) [-578.672] (-584.649) * [-578.824] (-585.957) (-581.410) (-578.872) -- 0:00:02
Average standard deviation of split frequencies: 0.006318
980500 -- (-580.358) (-580.086) [-579.132] (-581.360) * (-583.077) [-587.842] (-588.332) (-578.780) -- 0:00:02
981000 -- [-576.136] (-581.380) (-589.032) (-577.730) * (-584.345) [-577.516] (-579.540) (-582.175) -- 0:00:02
981500 -- [-576.435] (-579.862) (-579.120) (-576.284) * (-584.078) [-577.006] (-576.369) (-577.802) -- 0:00:02
982000 -- [-579.005] (-579.801) (-580.808) (-583.097) * (-576.679) (-575.945) (-577.964) [-571.616] -- 0:00:02
982500 -- [-576.350] (-579.413) (-579.006) (-578.332) * [-575.138] (-577.999) (-578.860) (-574.411) -- 0:00:02
983000 -- (-582.413) (-580.369) [-574.890] (-583.162) * [-576.783] (-577.545) (-578.770) (-574.535) -- 0:00:02
983500 -- (-583.862) (-582.233) [-576.905] (-576.590) * (-590.679) [-579.128] (-575.960) (-578.538) -- 0:00:02
984000 -- [-584.022] (-580.978) (-577.154) (-578.469) * [-576.078] (-577.661) (-580.668) (-589.750) -- 0:00:02
984500 -- [-578.567] (-584.391) (-579.100) (-585.797) * (-583.462) (-577.027) (-583.177) [-576.322] -- 0:00:02
985000 -- [-577.459] (-584.369) (-578.166) (-576.641) * (-584.394) (-578.404) (-583.219) [-575.148] -- 0:00:02
Average standard deviation of split frequencies: 0.006284
985500 -- [-585.042] (-582.467) (-577.131) (-591.042) * (-581.940) [-578.389] (-577.414) (-581.007) -- 0:00:01
986000 -- (-576.507) [-579.308] (-579.896) (-580.730) * (-578.005) (-586.097) (-586.969) [-581.852] -- 0:00:01
986500 -- (-582.114) (-584.045) (-576.283) [-579.660] * (-585.874) (-581.969) (-576.418) [-575.703] -- 0:00:01
987000 -- (-575.645) (-583.719) [-579.174] (-582.382) * (-582.975) (-584.265) (-580.136) [-582.223] -- 0:00:01
987500 -- (-580.340) (-580.996) [-576.974] (-588.174) * (-583.831) (-583.973) [-582.163] (-589.026) -- 0:00:01
988000 -- (-584.903) (-585.190) [-578.172] (-578.535) * [-582.100] (-579.917) (-586.488) (-579.003) -- 0:00:01
988500 -- (-581.635) [-582.241] (-577.534) (-581.490) * (-579.437) (-589.852) (-581.989) [-580.523] -- 0:00:01
989000 -- (-582.679) (-583.312) (-576.566) [-581.050] * (-575.074) (-580.714) [-580.773] (-580.575) -- 0:00:01
989500 -- (-588.560) (-579.662) [-575.895] (-580.099) * (-575.364) (-574.659) [-584.324] (-576.454) -- 0:00:01
990000 -- (-585.809) (-579.354) [-579.323] (-579.998) * (-579.036) (-576.327) [-579.292] (-576.285) -- 0:00:01
Average standard deviation of split frequencies: 0.005846
990500 -- (-577.332) (-574.348) (-575.752) [-576.717] * [-577.303] (-579.893) (-583.007) (-582.290) -- 0:00:01
991000 -- (-575.220) (-575.123) (-575.305) [-575.705] * (-576.633) (-577.544) (-579.840) [-578.399] -- 0:00:01
991500 -- (-577.593) (-578.471) [-577.414] (-577.692) * (-579.840) (-573.383) [-577.306] (-575.744) -- 0:00:01
992000 -- [-576.459] (-576.891) (-576.064) (-578.825) * [-575.851] (-577.144) (-576.442) (-576.734) -- 0:00:01
992500 -- (-577.764) (-582.058) (-579.686) [-579.315] * (-575.646) (-579.736) (-582.897) [-574.392] -- 0:00:01
993000 -- (-579.200) (-577.948) (-583.747) [-578.894] * (-577.878) [-582.156] (-575.519) (-576.778) -- 0:00:00
993500 -- (-577.736) [-578.301] (-575.958) (-577.319) * [-578.531] (-586.376) (-580.427) (-577.333) -- 0:00:00
994000 -- (-574.074) [-580.514] (-575.418) (-584.492) * [-581.888] (-590.020) (-579.281) (-580.943) -- 0:00:00
994500 -- (-575.819) (-575.328) [-578.137] (-585.180) * (-586.360) (-596.259) [-578.371] (-582.057) -- 0:00:00
995000 -- (-581.053) [-583.274] (-585.434) (-579.380) * (-583.626) (-578.909) (-583.236) [-575.985] -- 0:00:00
Average standard deviation of split frequencies: 0.006897
995500 -- (-585.526) (-579.005) [-578.375] (-573.925) * (-577.607) (-578.186) (-582.131) [-582.595] -- 0:00:00
996000 -- [-581.495] (-577.171) (-580.621) (-581.715) * (-585.409) (-573.676) [-579.078] (-581.505) -- 0:00:00
996500 -- (-587.606) [-574.797] (-581.105) (-577.109) * [-575.323] (-573.971) (-584.435) (-582.604) -- 0:00:00
997000 -- (-583.036) [-575.262] (-584.899) (-581.196) * [-578.705] (-582.499) (-576.691) (-575.786) -- 0:00:00
997500 -- [-577.592] (-580.534) (-586.885) (-580.188) * (-582.384) [-580.127] (-577.594) (-581.667) -- 0:00:00
998000 -- [-575.282] (-585.842) (-582.464) (-579.885) * [-577.628] (-573.995) (-583.883) (-581.238) -- 0:00:00
998500 -- (-575.542) [-576.075] (-584.392) (-576.655) * (-576.130) (-581.857) [-579.771] (-582.060) -- 0:00:00
999000 -- (-583.073) (-581.160) [-580.039] (-581.672) * (-577.467) (-580.929) (-575.020) [-575.878] -- 0:00:00
999500 -- (-584.440) (-576.681) (-577.183) [-583.902] * (-584.296) [-572.863] (-579.055) (-579.668) -- 0:00:00
1000000 -- (-578.633) (-582.033) [-574.672] (-578.289) * (-578.484) (-576.547) [-573.665] (-575.808) -- 0:00:00
Average standard deviation of split frequencies: 0.006528
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -578.632613 -- 11.442200
Chain 1 -- -578.632601 -- 11.442200
Chain 2 -- -582.033082 -- 13.332464
Chain 2 -- -582.033081 -- 13.332464
Chain 3 -- -574.672432 -- 11.458886
Chain 3 -- -574.672433 -- 11.458886
Chain 4 -- -578.288639 -- 8.413759
Chain 4 -- -578.288640 -- 8.413759
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -578.484163 -- 10.010161
Chain 1 -- -578.484163 -- 10.010161
Chain 2 -- -576.547382 -- 9.688362
Chain 2 -- -576.547382 -- 9.688362
Chain 3 -- -573.664868 -- 11.712757
Chain 3 -- -573.664873 -- 11.712757
Chain 4 -- -575.808368 -- 6.005045
Chain 4 -- -575.808369 -- 6.005045
Analysis completed in 2 mins 17 seconds
Analysis used 137.22 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -571.00
Likelihood of best state for "cold" chain of run 2 was -571.00
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
63.8 % ( 64 %) Dirichlet(Revmat{all})
82.7 % ( 73 %) Slider(Revmat{all})
39.1 % ( 27 %) Dirichlet(Pi{all})
38.6 % ( 17 %) Slider(Pi{all})
61.9 % ( 40 %) Multiplier(Alpha{1,2})
51.1 % ( 20 %) Multiplier(Alpha{3})
65.1 % ( 25 %) Slider(Pinvar{all})
58.8 % ( 63 %) ExtSPR(Tau{all},V{all})
58.9 % ( 63 %) ExtTBR(Tau{all},V{all})
59.2 % ( 61 %) NNI(Tau{all},V{all})
50.7 % ( 49 %) ParsSPR(Tau{all},V{all})
27.0 % ( 24 %) Multiplier(V{all})
49.7 % ( 58 %) Nodeslider(V{all})
27.4 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
64.0 % ( 56 %) Dirichlet(Revmat{all})
83.5 % ( 77 %) Slider(Revmat{all})
38.5 % ( 27 %) Dirichlet(Pi{all})
38.6 % ( 23 %) Slider(Pi{all})
62.3 % ( 37 %) Multiplier(Alpha{1,2})
52.3 % ( 30 %) Multiplier(Alpha{3})
65.2 % ( 29 %) Slider(Pinvar{all})
59.3 % ( 65 %) ExtSPR(Tau{all},V{all})
59.2 % ( 65 %) ExtTBR(Tau{all},V{all})
59.2 % ( 54 %) NNI(Tau{all},V{all})
50.7 % ( 53 %) ParsSPR(Tau{all},V{all})
27.1 % ( 23 %) Multiplier(V{all})
49.5 % ( 54 %) Nodeslider(V{all})
27.9 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.55
2 | 166610 0.84 0.70
3 | 167170 166495 0.86
4 | 166388 166909 166428
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.67 0.55
2 | 166181 0.84 0.70
3 | 166439 166381 0.85
4 | 167191 166761 167047
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -577.47
| 2 2 |
| 1 1 2 |
| 2 2 2 1 |
| 11 * 1 2 1 2 2 |
|1 2 2* 2 2 2 2 2 1|
| 2 2 2 11 1 2 1 * 2 1 1 2 |
| 2 1 2 2 1 2 1 2 2 2|
| 12 2 1 1 1 1 1 22 11 |
| 2 21 21 1 111 2 2 1 2 1* 2 |
| 1 1 1 1 1 21 1 1 1 |
| 1 2 1 2 2 2 1 2 |
| 1 1 11 21 |
| 2 2 2 212 2 1 1 2 1 |
| |
|2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -580.35
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -576.25 -585.74
2 -576.03 -586.24
--------------------------------------
TOTAL -576.13 -586.02
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.555976 0.023233 0.310248 0.868259 0.533075 1047.89 1238.33 1.000
r(A<->C){all} 0.115550 0.003544 0.010014 0.234065 0.107551 593.51 601.48 1.000
r(A<->G){all} 0.259161 0.008544 0.099931 0.450292 0.249983 455.91 542.72 1.002
r(A<->T){all} 0.064466 0.002396 0.000008 0.158003 0.052501 544.20 608.87 1.002
r(C<->G){all} 0.040478 0.000927 0.000058 0.100528 0.033985 614.27 694.18 1.000
r(C<->T){all} 0.479617 0.011005 0.283083 0.683535 0.475838 437.91 563.75 1.004
r(G<->T){all} 0.040728 0.000997 0.000167 0.101589 0.033846 741.75 810.07 1.000
pi(A){all} 0.219509 0.000564 0.173246 0.265629 0.219251 1147.74 1223.31 1.000
pi(C){all} 0.267827 0.000637 0.219691 0.317667 0.267379 1150.83 1211.95 1.002
pi(G){all} 0.258177 0.000702 0.208511 0.312157 0.257154 1174.73 1188.27 1.000
pi(T){all} 0.254486 0.000643 0.204514 0.304208 0.254007 911.52 1062.79 1.001
alpha{1,2} 0.069859 0.002063 0.000120 0.149023 0.066197 1288.24 1310.11 1.001
alpha{3} 1.615937 0.507611 0.509043 3.056982 1.474122 1501.00 1501.00 1.000
pinvar{all} 0.504882 0.010275 0.299282 0.679656 0.516941 1107.19 1167.07 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ..***
7 -- ..*.*
8 -- ...**
9 -- .*.*.
10 -- .*.**
11 -- ..**.
12 -- .**.*
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 1460 0.486342 0.010364 0.479014 0.493671 2
7 1273 0.424051 0.008009 0.418388 0.429714 2
8 981 0.326782 0.003298 0.324450 0.329114 2
9 474 0.157895 0.000942 0.157229 0.158561 2
10 379 0.126249 0.006124 0.121919 0.130580 2
11 375 0.124917 0.009893 0.117921 0.131912 2
12 367 0.122252 0.007066 0.117255 0.127249 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.047374 0.000594 0.007731 0.094219 0.043021 1.001 2
length{all}[2] 0.015767 0.000183 0.000008 0.042874 0.012182 1.000 2
length{all}[3] 0.052026 0.000968 0.002161 0.107982 0.046518 1.000 2
length{all}[4] 0.103700 0.002196 0.027454 0.201949 0.095895 1.000 2
length{all}[5] 0.294259 0.011870 0.116672 0.521737 0.274797 1.000 2
length{all}[6] 0.018991 0.000291 0.000025 0.050294 0.014422 1.001 2
length{all}[7] 0.031744 0.000719 0.000055 0.082389 0.025128 1.001 2
length{all}[8] 0.030204 0.000790 0.000037 0.087096 0.021915 1.001 2
length{all}[9] 0.013360 0.000174 0.000019 0.038278 0.009926 0.998 2
length{all}[10] 0.013197 0.000118 0.000022 0.034842 0.010302 0.998 2
length{all}[11] 0.014978 0.000239 0.000002 0.040326 0.009792 0.997 2
length{all}[12] 0.013335 0.000171 0.000025 0.038847 0.009357 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006528
Maximum standard deviation of split frequencies = 0.010364
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
+------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
|
\------------------------------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/----------- C1 (1)
|
|--- C2 (2)
|
+------------ C3 (3)
|
|------------------------- C4 (4)
|
\------------------------------------------------------------------------ C5 (5)
|------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (15 trees sampled):
50 % credible set contains 3 trees
90 % credible set contains 10 trees
95 % credible set contains 13 trees
99 % credible set contains 15 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 261
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
64 patterns at 87 / 87 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
62464 bytes for conP
8704 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5); MP score: 48
0.089596 0.028252 0.077224 0.118318 0.322526 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -626.279634
Iterating by ming2
Initial: fx= 626.279634
x= 0.08960 0.02825 0.07722 0.11832 0.32253 0.30000 1.30000
1 h-m-p 0.0000 0.0087 88.1642 ++++YCCYCCC 602.177189 6 0.0068 27 | 0/7
2 h-m-p 0.0010 0.0059 605.4689 YCYCCC 586.275704 5 0.0018 46 | 0/7
3 h-m-p 0.0002 0.0012 110.7727 +YYYYCCC 582.174347 6 0.0009 65 | 0/7
4 h-m-p 0.0004 0.0020 195.1126 YCYCCC 575.893463 5 0.0011 83 | 0/7
5 h-m-p 0.0002 0.0010 240.2661 YCYCCC 573.100451 5 0.0005 101 | 0/7
6 h-m-p 0.0005 0.0026 194.1714 +YYCYYCYCYC 549.335186 10 0.0025 125 | 0/7
7 h-m-p 0.0011 0.0055 24.8247 CYCCC 548.848762 4 0.0018 142 | 0/7
8 h-m-p 0.0350 8.0000 1.2578 YCCC 547.532995 3 0.0771 157 | 0/7
9 h-m-p 0.1998 1.2473 0.4854 +YCYCCC 543.337186 5 0.5807 176 | 0/7
10 h-m-p 1.2731 6.3657 0.1195 +YCYCCC 537.220439 5 3.6430 202 | 0/7
11 h-m-p 0.5292 2.6459 0.1240 CYCCCC 536.490547 5 0.8529 228 | 0/7
12 h-m-p 0.8789 5.5462 0.1203 CCCC 536.080151 3 0.8944 251 | 0/7
13 h-m-p 1.4041 8.0000 0.0766 YCCCC 535.553678 4 2.6503 275 | 0/7
14 h-m-p 1.4412 7.2061 0.0662 CYCCCC 535.188219 5 2.0096 301 | 0/7
15 h-m-p 0.9042 8.0000 0.1472 +CYC 534.477644 2 4.0392 322 | 0/7
16 h-m-p 1.6000 8.0000 0.1428 CYC 534.342947 2 1.5714 342 | 0/7
17 h-m-p 1.6000 8.0000 0.0529 YC 534.288262 1 2.8027 360 | 0/7
18 h-m-p 1.6000 8.0000 0.0448 YCCC 534.240452 3 3.1676 382 | 0/7
19 h-m-p 1.6000 8.0000 0.0111 YC 534.238480 1 1.1162 400 | 0/7
20 h-m-p 1.6000 8.0000 0.0044 C 534.238406 0 1.4125 417 | 0/7
21 h-m-p 1.6000 8.0000 0.0016 C 534.238400 0 1.3309 434 | 0/7
22 h-m-p 1.6000 8.0000 0.0000 Y 534.238400 0 1.2734 451 | 0/7
23 h-m-p 0.7762 8.0000 0.0000 Y 534.238400 0 1.4288 468 | 0/7
24 h-m-p 1.6000 8.0000 0.0000 Y 534.238400 0 1.1046 485 | 0/7
25 h-m-p 1.6000 8.0000 0.0000 Y 534.238400 0 0.7136 502 | 0/7
26 h-m-p 1.6000 8.0000 0.0000 Y 534.238400 0 1.6000 519 | 0/7
27 h-m-p 1.6000 8.0000 0.0000 --------------N 534.238400 0 0.0000 550
Out..
lnL = -534.238400
551 lfun, 551 eigenQcodon, 2755 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5); MP score: 48
0.089596 0.028252 0.077224 0.118318 0.322526 3.167372 0.755520 0.234606
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.517166
np = 8
lnL0 = -552.668267
Iterating by ming2
Initial: fx= 552.668267
x= 0.08960 0.02825 0.07722 0.11832 0.32253 3.16737 0.75552 0.23461
1 h-m-p 0.0000 0.0053 58.6163 +++++ 536.587538 m 0.0053 16 | 0/8
2 h-m-p 0.0005 0.0027 27.8499 +YYCYCCC 535.798032 6 0.0018 37 | 0/8
3 h-m-p 0.0002 0.0010 32.8617 CYC 535.742243 2 0.0002 51 | 0/8
4 h-m-p 0.0013 0.0306 4.8257 +CCCC 535.590700 3 0.0062 69 | 0/8
5 h-m-p 0.0041 0.1073 7.3641 YCCC 535.491033 3 0.0024 85 | 0/8
6 h-m-p 0.0027 0.0395 6.4130 +YYCCCCC 534.644264 6 0.0136 107 | 0/8
7 h-m-p 0.0012 0.0061 35.7825 YCCCC 533.748050 4 0.0026 125 | 0/8
8 h-m-p 0.0083 0.0413 5.6511 CCCC 533.545244 3 0.0087 142 | 0/8
9 h-m-p 0.6606 4.1437 0.0744 YCCC 533.415848 3 0.3057 158 | 0/8
10 h-m-p 0.2534 8.0000 0.0898 +CCC 533.308128 2 0.8821 182 | 0/8
11 h-m-p 1.5640 8.0000 0.0506 CC 533.258498 1 1.2971 203 | 0/8
12 h-m-p 1.6000 8.0000 0.0158 YCC 533.243746 2 1.2844 225 | 0/8
13 h-m-p 0.7859 8.0000 0.0258 YC 533.241487 1 1.3021 245 | 0/8
14 h-m-p 1.6000 8.0000 0.0024 Y 533.241465 0 1.0914 264 | 0/8
15 h-m-p 1.6000 8.0000 0.0004 Y 533.241465 0 1.0919 283 | 0/8
16 h-m-p 1.6000 8.0000 0.0000 Y 533.241465 0 0.9397 302 | 0/8
17 h-m-p 1.6000 8.0000 0.0000 Y 533.241465 0 0.8311 321 | 0/8
18 h-m-p 1.5864 8.0000 0.0000 -C 533.241465 0 0.0992 341 | 0/8
19 h-m-p 0.1061 8.0000 0.0000 Y 533.241465 0 0.1061 360 | 0/8
20 h-m-p 0.1201 8.0000 0.0000 C 533.241465 0 0.0300 379 | 0/8
21 h-m-p 0.0286 8.0000 0.0000 -------------Y 533.241465 0 0.0000 411
Out..
lnL = -533.241465
412 lfun, 1236 eigenQcodon, 4120 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5); MP score: 48
initial w for M2:NSpselection reset.
0.089596 0.028252 0.077224 0.118318 0.322526 3.209082 1.079469 0.409056 0.257593 2.430889
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.603735
np = 10
lnL0 = -566.758852
Iterating by ming2
Initial: fx= 566.758852
x= 0.08960 0.02825 0.07722 0.11832 0.32253 3.20908 1.07947 0.40906 0.25759 2.43089
1 h-m-p 0.0000 0.0099 42.5025 +++++ 561.882577 m 0.0099 18 | 1/10
2 h-m-p 0.0117 0.0704 28.1593 YCCC 557.198232 3 0.0191 36 | 1/10
3 h-m-p 0.0030 0.0148 29.0030 YCYCCC 555.307975 5 0.0077 57 | 1/10
4 h-m-p 0.0119 0.0842 18.6593 YCCCC 552.988427 4 0.0245 77 | 0/10
5 h-m-p 0.0004 0.0021 534.5011 CCC 552.827062 2 0.0001 94 | 0/10
6 h-m-p 0.0238 0.3534 2.4132 +YYYC 552.286156 3 0.0900 111 | 0/10
7 h-m-p 0.0210 0.1079 10.3460 YCYCCC 549.684105 5 0.0565 132 | 0/10
8 h-m-p 0.0112 0.0562 25.3074 +YCYCCC 544.778243 5 0.0348 154 | 0/10
9 h-m-p 0.0229 0.1146 6.2662 +YYYYCCC 540.391656 6 0.0892 176 | 0/10
10 h-m-p 0.0626 0.3131 2.0003 +YCYCCC 537.134862 5 0.1863 198 | 0/10
11 h-m-p 0.2812 7.4021 1.3252 YCCCC 535.597907 4 0.5399 218 | 0/10
12 h-m-p 0.5092 2.5458 0.8284 CCCC 534.804078 3 0.5872 237 | 0/10
13 h-m-p 0.2892 1.4460 1.0116 CYCCC 534.087721 4 0.5186 267 | 0/10
14 h-m-p 1.2031 6.6907 0.4360 YCC 533.765083 2 0.8155 283 | 0/10
15 h-m-p 1.6000 8.0000 0.1363 CCC 533.600405 2 1.8748 310 | 0/10
16 h-m-p 1.1429 8.0000 0.2236 YCCC 533.402957 3 2.1265 338 | 0/10
17 h-m-p 1.6000 8.0000 0.1155 YC 533.386617 1 1.2485 362 | 0/10
18 h-m-p 1.2289 8.0000 0.1173 YCC 533.372021 2 2.1815 388 | 0/10
19 h-m-p 1.1147 8.0000 0.2296 +YC 533.338624 1 3.1317 413 | 0/10
20 h-m-p 1.0699 5.3496 0.5136 YCCC 533.275193 3 2.4057 441 | 0/10
21 h-m-p 0.4198 2.0991 0.6383 +YC 533.251306 1 1.3070 466 | 0/10
22 h-m-p 1.6000 8.0000 0.1092 YC 533.245300 1 0.9705 490 | 0/10
23 h-m-p 0.4303 2.1517 0.2255 ++ 533.242847 m 2.1517 513 | 1/10
24 h-m-p 1.5110 8.0000 0.2847 YCC 533.241476 2 1.0700 539 | 1/10
25 h-m-p 1.6000 8.0000 0.0037 YC 533.241465 1 0.8702 562 | 1/10
26 h-m-p 1.6000 8.0000 0.0005 C 533.241465 0 0.6172 584 | 1/10
27 h-m-p 1.3914 8.0000 0.0002 Y 533.241465 0 1.0837 606 | 1/10
28 h-m-p 1.6000 8.0000 0.0000 ---C 533.241465 0 0.0063 631
Out..
lnL = -533.241465
632 lfun, 2528 eigenQcodon, 9480 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -543.712824 S = -524.716058 -11.332571
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 64 patterns 0:05
did 20 / 64 patterns 0:05
did 30 / 64 patterns 0:05
did 40 / 64 patterns 0:05
did 50 / 64 patterns 0:05
did 60 / 64 patterns 0:05
did 64 / 64 patterns 0:05
Time used: 0:05
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5); MP score: 48
0.089596 0.028252 0.077224 0.118318 0.322526 3.209084 0.408838 0.998206 0.019504 0.042387 0.064126
ntime & nrate & np: 5 4 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 9.948194
np = 11
lnL0 = -534.396504
Iterating by ming2
Initial: fx= 534.396504
x= 0.08960 0.02825 0.07722 0.11832 0.32253 3.20908 0.40884 0.99821 0.01950 0.04239 0.06413
1 h-m-p 0.0000 0.0029 18.1925 ++++YCCC 534.097286 3 0.0019 25 | 0/11
2 h-m-p 0.0001 0.0004 24.6036 ++ 533.974298 m 0.0004 39 | 1/11
3 h-m-p 0.0007 0.0474 11.7590 +YCC 533.908811 2 0.0018 57 | 1/11
4 h-m-p 0.0015 0.0077 13.5560 ++ 533.353431 m 0.0077 71 | 2/11
5 h-m-p 0.0028 0.0412 33.3169 CCC 533.323762 2 0.0006 89 | 2/11
6 h-m-p 0.0134 0.0683 1.6124 YCC 533.317464 2 0.0027 106 | 2/11
7 h-m-p 0.0034 0.1422 1.2718 +YC 533.297683 1 0.0093 122 | 2/11
8 h-m-p 0.0060 0.1227 1.9732 YCCC 533.240676 3 0.0121 141 | 2/11
9 h-m-p 0.0548 5.9345 0.4349 ++CCCC 533.055520 3 0.9266 163 | 2/11
10 h-m-p 1.6000 8.0000 0.1251 YCC 533.014693 2 1.1252 189 | 2/11
11 h-m-p 1.6000 8.0000 0.0706 CYC 533.000910 2 1.7882 215 | 2/11
12 h-m-p 1.6000 8.0000 0.0653 CC 532.996933 1 1.3142 240 | 2/11
13 h-m-p 1.6000 8.0000 0.0097 CC 532.996701 1 1.2779 265 | 2/11
14 h-m-p 1.6000 8.0000 0.0022 Y 532.996686 0 1.2383 288 | 2/11
15 h-m-p 1.6000 8.0000 0.0008 Y 532.996686 0 1.0115 311 | 2/11
16 h-m-p 1.6000 8.0000 0.0001 Y 532.996686 0 1.0562 334 | 2/11
17 h-m-p 1.6000 8.0000 0.0000 Y 532.996686 0 0.9523 357 | 2/11
18 h-m-p 1.6000 8.0000 0.0000 ---------------Y 532.996686 0 0.0000 395
Out..
lnL = -532.996686
396 lfun, 1584 eigenQcodon, 5940 P(t)
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5); MP score: 48
0.089596 0.028252 0.077224 0.118318 0.322526 3.157134 0.996708 1.805788
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.007404
np = 8
lnL0 = -549.914886
Iterating by ming2
Initial: fx= 549.914886
x= 0.08960 0.02825 0.07722 0.11832 0.32253 3.15713 0.99671 1.80579
1 h-m-p 0.0000 0.0136 22.0332 ++++YCCC 549.485459 3 0.0019 22 | 0/8
2 h-m-p 0.0010 0.0050 37.3446 YCCCCC 548.753880 5 0.0022 42 | 0/8
3 h-m-p 0.0010 0.0129 80.4623 +
QuantileBeta(0.15, 0.00500, 2.28873) = 1.136393e-160 2000 rounds
YCCYCCC 542.396766 6 0.0092 65 | 0/8
4 h-m-p 0.0001 0.0003 841.7891 YCYCCC 540.796386 5 0.0002 85 | 0/8
5 h-m-p 0.0014 0.0071 19.6544 YYCC 540.684558 3 0.0010 100 | 0/8
6 h-m-p 0.0039 1.9667 6.4879 ++YYCCC 539.136683 4 0.0845 119 | 0/8
7 h-m-p 0.0040 0.0198 71.3647 +YCYCCC 535.679015 5 0.0114 139 | 0/8
8 h-m-p 0.5970 2.9851 0.3468 CYCCC 533.331080 4 1.0430 157 | 0/8
9 h-m-p 1.2184 6.0922 0.2461 YCC 533.257577 2 0.5130 179 | 0/8
10 h-m-p 0.6255 8.0000 0.2018 YCCC 533.208395 3 1.2488 203 | 0/8
11 h-m-p 1.6000 8.0000 0.0119 YCC 533.189727 2 2.5764 225 | 0/8
12 h-m-p 0.7905 8.0000 0.0388 YC 533.184963 1 1.7841 245 | 0/8
13 h-m-p 1.6000 8.0000 0.0305 ++ 533.169770 m 8.0000 264 | 0/8
14 h-m-p 0.0144 0.2115 16.9621 +YYYYYCYYCY 533.066851 10 0.1181 296 | 0/8
15 h-m-p 0.1775 0.8877 1.6553 CCCC 533.048840 3 0.2898 313 | 0/8
16 h-m-p 1.2673 8.0000 0.3785 -YC 533.043984 1 0.1523 326 | 0/8
17 h-m-p 1.4162 8.0000 0.0407 CC 533.018743 1 1.7940 347 | 0/8
18 h-m-p 0.5434 8.0000 0.1344 CC 533.017222 1 0.8158 368 | 0/8
19 h-m-p 1.6000 8.0000 0.0180 YC 533.017133 1 0.8483 388 | 0/8
20 h-m-p 1.6000 8.0000 0.0005 Y 533.017132 0 1.1363 407 | 0/8
21 h-m-p 1.6000 8.0000 0.0001 C 533.017132 0 1.3068 426 | 0/8
22 h-m-p 1.6000 8.0000 0.0000 Y 533.017132 0 1.0472 445 | 0/8
23 h-m-p 1.6000 8.0000 0.0000 Y 533.017132 0 2.6377 464 | 0/8
24 h-m-p 1.5261 8.0000 0.0000 ----Y 533.017132 0 0.0015 487
Out..
lnL = -533.017132
488 lfun, 5368 eigenQcodon, 24400 P(t)
Time used: 0:14
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5); MP score: 48
initial w for M8:NSbetaw>1 reset.
0.089596 0.028252 0.077224 0.118318 0.322526 3.157784 0.900000 0.709770 1.329016 2.821721
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.591705
np = 10
lnL0 = -556.274239
Iterating by ming2
Initial: fx= 556.274239
x= 0.08960 0.02825 0.07722 0.11832 0.32253 3.15778 0.90000 0.70977 1.32902 2.82172
1 h-m-p 0.0000 0.0013 85.0161 ++++ 549.083081 m 0.0013 17 | 1/10
2 h-m-p 0.0016 0.0078 32.5407 +YCYCCC 547.284980 5 0.0046 39 | 1/10
3 h-m-p 0.0012 0.0060 108.0753 +YYYYYYCYCC 537.970701 10 0.0050 65 | 1/10
4 h-m-p 0.0001 0.0003 314.6328 CYCCCC 537.583879 5 0.0001 87 | 1/10
5 h-m-p 0.0042 0.0243 8.3056 YCC 537.499060 2 0.0025 103 | 0/10
6 h-m-p 0.0005 0.0495 38.1864 YYCC 537.347068 3 0.0008 120 | 0/10
7 h-m-p 0.0006 0.0153 49.1988 ++CYC 535.729779 2 0.0101 138 | 0/10
8 h-m-p 0.0034 0.0172 4.8222 ++ 535.495694 m 0.0172 151 | 0/10
9 h-m-p 0.0000 0.0000 1.4167
h-m-p: 0.00000000e+00 0.00000000e+00 1.41665217e+00 535.495694
.. | 0/10
10 h-m-p 0.0000 0.0072 33.0225 +++YCCC 534.402701 3 0.0019 182 | 0/10
11 h-m-p 0.0002 0.0010 56.2651 ++ 533.636822 m 0.0010 195 | 0/10
12 h-m-p 0.0000 0.0000 30.6562
h-m-p: 0.00000000e+00 0.00000000e+00 3.06561999e+01 533.636822
.. | 0/10
13 h-m-p 0.0000 0.0030 25.5462 +++CCCC 533.378325 3 0.0008 227 | 0/10
14 h-m-p 0.0001 0.0004 22.3199 ++ 533.289721 m 0.0004 240 | 1/10
15 h-m-p 0.0004 0.0167 18.4010 +YCC 533.209271 2 0.0012 257 | 1/10
16 h-m-p 0.0032 0.0661 6.8963 CCC 533.157094 2 0.0026 274 | 1/10
17 h-m-p 0.0013 0.0161 14.0947 CCC 533.106104 2 0.0017 291 | 1/10
18 h-m-p 0.0068 0.0705 3.5336 CC 533.097578 1 0.0020 306 | 1/10
19 h-m-p 0.0077 0.2432 0.9046 CC 533.097015 1 0.0016 321 | 1/10
20 h-m-p 0.0160 8.0000 0.1035 +++YCC 533.066318 2 1.9223 349 | 1/10
21 h-m-p 1.6000 8.0000 0.0776 YCCC 533.054655 3 3.1332 376 | 1/10
22 h-m-p 1.0695 8.0000 0.2274 +YCYC 533.025437 3 3.0000 403 | 1/10
23 h-m-p 0.6997 3.4987 0.2018 YCCC 533.018986 3 0.4153 430 | 1/10
24 h-m-p 1.6000 8.0000 0.0459 YC 533.017496 1 0.9001 453 | 1/10
25 h-m-p 1.2317 8.0000 0.0335 YC 533.017449 1 0.5807 476 | 1/10
26 h-m-p 1.6000 8.0000 0.0049 Y 533.017443 0 0.8089 498 | 1/10
27 h-m-p 1.6000 8.0000 0.0002 Y 533.017443 0 1.0286 520 | 1/10
28 h-m-p 1.0300 8.0000 0.0002 ++ 533.017443 m 8.0000 542 | 1/10
29 h-m-p 0.2047 8.0000 0.0062 ++C 533.017442 0 3.2578 566 | 1/10
30 h-m-p 1.6000 8.0000 0.0123 ++ 533.017428 m 8.0000 588 | 1/10
31 h-m-p 0.0237 8.0000 4.1470 ------------C 533.017428 0 0.0000 622 | 1/10
32 h-m-p 0.0000 0.0147 102.7471 +++++ 533.017187 m 0.0147 638 | 2/10
33 h-m-p 1.2393 8.0000 0.0028 C 533.017184 0 1.0792 651 | 2/10
34 h-m-p 1.6000 8.0000 0.0003 Y 533.017184 0 0.9218 672 | 2/10
35 h-m-p 1.6000 8.0000 0.0000 Y 533.017184 0 0.8553 693 | 2/10
36 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/10
37 h-m-p 0.0160 8.0000 0.0001 --Y 533.017184 0 0.0003 751
Out..
lnL = -533.017184
752 lfun, 9024 eigenQcodon, 41360 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -544.628873 S = -524.781951 -12.958051
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 64 patterns 0:26
did 20 / 64 patterns 0:26
did 30 / 64 patterns 0:26
did 40 / 64 patterns 0:27
did 50 / 64 patterns 0:27
did 60 / 64 patterns 0:27
did 64 / 64 patterns 0:27
Time used: 0:27
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=87
D_melanogaster_CG42445-PA MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
D_simulans_CG42445-PA MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
D_yakuba_CG42445-PA MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
D_erecta_CG42445-PA MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
D_takahashii_CG42445-PA MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
**********:** *******:****************************
D_melanogaster_CG42445-PA DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
D_simulans_CG42445-PA DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
D_yakuba_CG42445-PA DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
D_erecta_CG42445-PA DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
D_takahashii_CG42445-PA DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
***************:*********************
>D_melanogaster_CG42445-PA ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTTGACAT TTTTAAGATCTACATCAAGTTTGCACTGATCACGCTGGTCATCTATTTCC TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG GACGCCCATCTGGTGGAAGGTGCCGAACTCAGGGAGGAATCCCCCGAGCG ACCTGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT TTTTCATCCTC >D_simulans_CG42445-PA ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTCCACATACTCGACAT TTTTAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG GACGCCCATCTGGTGGAAGGTGCCGAACTGAGGGAGGAATCTCCCGAGCG ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT TTTTCATCCTC >D_yakuba_CG42445-PA ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTCGACAT ATTCAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG GACGCCCATTTGGTGGAAGGTGCCGAACTGAGAGAGGAATCCCCCGAGCG ACCCGAATCGAATAGCACGCTAAGCAAGGTGTTTCGCTTTGTGGTAAACT TTTTCATCCTC >D_erecta_CG42445-PA ATGGATCTAATGGAGCTGCTGCATCAGCTGCTCCTCCACATACTCGACAT TTTTAAGATATACCTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC TGGCCGAGTGGTACATACTGCGATATGGAGCGGAGTTGGAGGCCGAACTG GATGCCCATCTGGTGGAAGGCGCCGAGCTGAGAGAGGAATCCCCCGATAG ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT TTTTCATCCTC >D_takahashii_CG42445-PA ATGGATCTAATGGAGCTGCTGCATCAGCTGTTTCTGCACACACTCGACAT CTTTAAGATCTACGTCAAGTTCGCCCTGATCACGCTGGTCATCTACTTCC TGGCCGAGTGGTATATCCTACGATATGGTGCCGAACTGGAGGCCGAACTG GATGCCCACCTGGTGGAGGGTGCTGAGCTGAGAGAGGAATCCCCCGAGCG ACCCGAATCGAACAGCACTCTCAGCAAGGTGTTTCGATTTGTGGTGAACT TTTTCATCCTC
>D_melanogaster_CG42445-PA MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL >D_simulans_CG42445-PA MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL >D_yakuba_CG42445-PA MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL >D_erecta_CG42445-PA MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL >D_takahashii_CG42445-PA MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
#NEXUS
[ID: 1841612285]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_CG42445-PA
D_simulans_CG42445-PA
D_yakuba_CG42445-PA
D_erecta_CG42445-PA
D_takahashii_CG42445-PA
;
end;
begin trees;
translate
1 D_melanogaster_CG42445-PA,
2 D_simulans_CG42445-PA,
3 D_yakuba_CG42445-PA,
4 D_erecta_CG42445-PA,
5 D_takahashii_CG42445-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.04302059,2:0.01218243,3:0.04651834,4:0.09589519,5:0.2747968);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.04302059,2:0.01218243,3:0.04651834,4:0.09589519,5:0.2747968);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -576.25 -585.74
2 -576.03 -586.24
--------------------------------------
TOTAL -576.13 -586.02
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.555976 0.023233 0.310248 0.868259 0.533075 1047.89 1238.33 1.000
r(A<->C){all} 0.115550 0.003544 0.010014 0.234065 0.107551 593.51 601.48 1.000
r(A<->G){all} 0.259161 0.008544 0.099931 0.450292 0.249983 455.91 542.72 1.002
r(A<->T){all} 0.064466 0.002396 0.000008 0.158003 0.052501 544.20 608.87 1.002
r(C<->G){all} 0.040478 0.000927 0.000058 0.100528 0.033985 614.27 694.18 1.000
r(C<->T){all} 0.479617 0.011005 0.283083 0.683535 0.475838 437.91 563.75 1.004
r(G<->T){all} 0.040728 0.000997 0.000167 0.101589 0.033846 741.75 810.07 1.000
pi(A){all} 0.219509 0.000564 0.173246 0.265629 0.219251 1147.74 1223.31 1.000
pi(C){all} 0.267827 0.000637 0.219691 0.317667 0.267379 1150.83 1211.95 1.002
pi(G){all} 0.258177 0.000702 0.208511 0.312157 0.257154 1174.73 1188.27 1.000
pi(T){all} 0.254486 0.000643 0.204514 0.304208 0.254007 911.52 1062.79 1.001
alpha{1,2} 0.069859 0.002063 0.000120 0.149023 0.066197 1288.24 1310.11 1.001
alpha{3} 1.615937 0.507611 0.509043 3.056982 1.474122 1501.00 1501.00 1.000
pinvar{all} 0.504882 0.010275 0.299282 0.679656 0.516941 1107.19 1167.07 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/143/CG42445-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 87
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 5 | Ser TCT 0 1 0 0 0 | Tyr TAT 2 1 1 1 2 | Cys TGT 0 0 0 0 0
TTC 4 4 4 3 3 | TCC 1 0 1 1 1 | TAC 2 3 3 3 2 | TGC 0 0 0 0 0
Leu TTA 0 0 0 0 0 | TCA 0 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 1 2 1 0 | TCG 1 1 1 1 1 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 0 1 0 0 | Pro CCT 1 0 0 0 0 | His CAT 2 2 2 2 1 | Arg CGT 0 0 0 0 0
CTC 2 3 2 5 3 | CCC 1 2 2 2 2 | CAC 1 1 1 1 2 | CGC 1 1 1 1 0
CTA 1 1 2 1 2 | CCA 0 0 0 0 0 | Gln CAA 0 0 0 0 0 | CGA 2 2 2 1 3
CTG 10 11 9 11 11 | CCG 0 0 0 0 0 | CAG 1 1 1 1 1 | CGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 0 1 0 | Thr ACT 0 0 0 0 1 | Asn AAT 1 1 1 1 0 | Ser AGT 0 0 0 0 0
ATC 5 4 4 3 6 | ACC 0 0 0 0 0 | AAC 1 1 1 1 2 | AGC 2 2 2 2 2
ATA 2 2 3 3 0 | ACA 0 0 0 0 1 | Lys AAA 0 0 0 0 0 | Arg AGA 0 0 1 2 1
Met ATG 2 2 2 2 2 | ACG 2 2 2 2 1 | AAG 3 3 3 3 3 | AGG 1 1 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 | Ala GCT 0 0 0 0 1 | Asp GAT 1 1 1 3 2 | Gly GGT 1 1 1 0 2
GTC 1 2 2 1 2 | GCC 4 4 4 4 5 | GAC 2 2 2 1 1 | GGC 0 0 0 1 0
GTA 0 0 1 0 0 | GCA 2 2 2 1 0 | Glu GAA 6 6 6 4 4 | GGA 1 1 1 1 0
GTG 4 4 3 4 4 | GCG 0 0 0 1 0 | GAG 5 5 5 6 7 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG42445-PA
position 1: T:0.18391 C:0.27586 A:0.22989 G:0.31034
position 2: T:0.44828 C:0.13793 A:0.31034 G:0.10345
position 3: T:0.17241 C:0.31034 A:0.16092 G:0.35632
Average T:0.26820 C:0.24138 A:0.23372 G:0.25670
#2: D_simulans_CG42445-PA
position 1: T:0.18391 C:0.27586 A:0.21839 G:0.32184
position 2: T:0.44828 C:0.13793 A:0.31034 G:0.10345
position 3: T:0.13793 C:0.33333 A:0.16092 G:0.36782
Average T:0.25670 C:0.24904 A:0.22989 G:0.26437
#3: D_yakuba_CG42445-PA
position 1: T:0.19540 C:0.26437 A:0.21839 G:0.32184
position 2: T:0.44828 C:0.13793 A:0.31034 G:0.10345
position 3: T:0.12644 C:0.33333 A:0.20690 G:0.33333
Average T:0.25670 C:0.24521 A:0.24521 G:0.25287
#4: D_erecta_CG42445-PA
position 1: T:0.17241 C:0.28736 A:0.22989 G:0.31034
position 2: T:0.44828 C:0.13793 A:0.31034 G:0.10345
position 3: T:0.13793 C:0.33333 A:0.14943 G:0.37931
Average T:0.25287 C:0.25287 A:0.22989 G:0.26437
#5: D_takahashii_CG42445-PA
position 1: T:0.17241 C:0.28736 A:0.21839 G:0.32184
position 2: T:0.43678 C:0.14943 A:0.31034 G:0.10345
position 3: T:0.16092 C:0.35632 A:0.12644 G:0.35632
Average T:0.25670 C:0.26437 A:0.21839 G:0.26054
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 21 | Ser S TCT 1 | Tyr Y TAT 7 | Cys C TGT 0
TTC 18 | TCC 4 | TAC 13 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 5 | TCG 5 | TAG 0 | Trp W TGG 5
------------------------------------------------------------------------------
Leu L CTT 3 | Pro P CCT 1 | His H CAT 9 | Arg R CGT 0
CTC 15 | CCC 9 | CAC 6 | CGC 4
CTA 7 | CCA 0 | Gln Q CAA 0 | CGA 10
CTG 52 | CCG 0 | CAG 5 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 3 | Thr T ACT 1 | Asn N AAT 4 | Ser S AGT 0
ATC 22 | ACC 0 | AAC 6 | AGC 10
ATA 10 | ACA 1 | Lys K AAA 0 | Arg R AGA 4
Met M ATG 10 | ACG 9 | AAG 15 | AGG 2
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 1 | Asp D GAT 8 | Gly G GGT 5
GTC 8 | GCC 21 | GAC 8 | GGC 1
GTA 1 | GCA 7 | Glu E GAA 26 | GGA 4
GTG 19 | GCG 1 | GAG 28 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18161 C:0.27816 A:0.22299 G:0.31724
position 2: T:0.44598 C:0.14023 A:0.31034 G:0.10345
position 3: T:0.14713 C:0.33333 A:0.16092 G:0.35862
Average T:0.25824 C:0.25057 A:0.23142 G:0.25977
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG42445-PA
D_simulans_CG42445-PA 0.0498 (0.0051 0.1017)
D_yakuba_CG42445-PA 0.0254 (0.0051 0.1994)-1.0000 (0.0000 0.1580)
D_erecta_CG42445-PA 0.0636 (0.0153 0.2409) 0.0975 (0.0153 0.1573) 0.0583 (0.0153 0.2627)
D_takahashii_CG42445-PA 0.0174 (0.0102 0.5882) 0.0104 (0.0051 0.4879) 0.0104 (0.0051 0.4907) 0.0422 (0.0206 0.4879)
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5); MP score: 48
lnL(ntime: 5 np: 7): -534.238400 +0.000000
6..1 6..2 6..3 6..4 6..5
0.080201 0.030562 0.081055 0.142432 0.358304 3.167372 0.039009
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.69255
(1: 0.080201, 2: 0.030562, 3: 0.081055, 4: 0.142432, 5: 0.358304);
(D_melanogaster_CG42445-PA: 0.080201, D_simulans_CG42445-PA: 0.030562, D_yakuba_CG42445-PA: 0.081055, D_erecta_CG42445-PA: 0.142432, D_takahashii_CG42445-PA: 0.358304);
Detailed output identifying parameters
kappa (ts/tv) = 3.16737
omega (dN/dS) = 0.03901
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.080 183.1 77.9 0.0390 0.0032 0.0820 0.6 6.4
6..2 0.031 183.1 77.9 0.0390 0.0012 0.0313 0.2 2.4
6..3 0.081 183.1 77.9 0.0390 0.0032 0.0829 0.6 6.5
6..4 0.142 183.1 77.9 0.0390 0.0057 0.1457 1.0 11.4
6..5 0.358 183.1 77.9 0.0390 0.0143 0.3665 2.6 28.6
tree length for dN: 0.0276
tree length for dS: 0.7084
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 48
lnL(ntime: 5 np: 8): -533.241465 +0.000000
6..1 6..2 6..3 6..4 6..5
0.078802 0.030638 0.080709 0.143639 0.364338 3.209082 0.974456 0.019848
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.69813
(1: 0.078802, 2: 0.030638, 3: 0.080709, 4: 0.143639, 5: 0.364338);
(D_melanogaster_CG42445-PA: 0.078802, D_simulans_CG42445-PA: 0.030638, D_yakuba_CG42445-PA: 0.080709, D_erecta_CG42445-PA: 0.143639, D_takahashii_CG42445-PA: 0.364338);
Detailed output identifying parameters
kappa (ts/tv) = 3.20908
dN/dS (w) for site classes (K=2)
p: 0.97446 0.02554
w: 0.01985 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.079 182.9 78.1 0.0449 0.0036 0.0795 0.7 6.2
6..2 0.031 182.9 78.1 0.0449 0.0014 0.0309 0.3 2.4
6..3 0.081 182.9 78.1 0.0449 0.0037 0.0814 0.7 6.4
6..4 0.144 182.9 78.1 0.0449 0.0065 0.1448 1.2 11.3
6..5 0.364 182.9 78.1 0.0449 0.0165 0.3674 3.0 28.7
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 48
lnL(ntime: 5 np: 10): -533.241465 +0.000000
6..1 6..2 6..3 6..4 6..5
0.078802 0.030638 0.080709 0.143639 0.364338 3.209084 0.974456 0.024515 0.019848 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.69813
(1: 0.078802, 2: 0.030638, 3: 0.080709, 4: 0.143639, 5: 0.364338);
(D_melanogaster_CG42445-PA: 0.078802, D_simulans_CG42445-PA: 0.030638, D_yakuba_CG42445-PA: 0.080709, D_erecta_CG42445-PA: 0.143639, D_takahashii_CG42445-PA: 0.364338);
Detailed output identifying parameters
kappa (ts/tv) = 3.20908
dN/dS (w) for site classes (K=3)
p: 0.97446 0.02451 0.00103
w: 0.01985 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.079 182.9 78.1 0.0449 0.0036 0.0795 0.7 6.2
6..2 0.031 182.9 78.1 0.0449 0.0014 0.0309 0.3 2.4
6..3 0.081 182.9 78.1 0.0449 0.0037 0.0814 0.7 6.4
6..4 0.144 182.9 78.1 0.0449 0.0065 0.1448 1.2 11.3
6..5 0.364 182.9 78.1 0.0449 0.0165 0.3674 3.0 28.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42445-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.222 0.144 0.113 0.096 0.085 0.077 0.071 0.067 0.064 0.061
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.018 0.972
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 48
lnL(ntime: 5 np: 11): -532.996686 +0.000000
6..1 6..2 6..3 6..4 6..5
0.079601 0.030413 0.080647 0.142849 0.361200 3.157134 0.380543 0.483581 0.000001 0.000001 0.291980
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.69471
(1: 0.079601, 2: 0.030413, 3: 0.080647, 4: 0.142849, 5: 0.361200);
(D_melanogaster_CG42445-PA: 0.079601, D_simulans_CG42445-PA: 0.030413, D_yakuba_CG42445-PA: 0.080647, D_erecta_CG42445-PA: 0.142849, D_takahashii_CG42445-PA: 0.361200);
Detailed output identifying parameters
kappa (ts/tv) = 3.15713
dN/dS (w) for site classes (K=3)
p: 0.38054 0.48358 0.13588
w: 0.00000 0.00000 0.29198
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.080 183.1 77.9 0.0397 0.0032 0.0813 0.6 6.3
6..2 0.030 183.1 77.9 0.0397 0.0012 0.0311 0.2 2.4
6..3 0.081 183.1 77.9 0.0397 0.0033 0.0824 0.6 6.4
6..4 0.143 183.1 77.9 0.0397 0.0058 0.1460 1.1 11.4
6..5 0.361 183.1 77.9 0.0397 0.0146 0.3691 2.7 28.7
Naive Empirical Bayes (NEB) analysis
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 48
lnL(ntime: 5 np: 8): -533.017132 +0.000000
6..1 6..2 6..3 6..4 6..5
0.079505 0.030402 0.080596 0.142851 0.361241 3.157784 0.053157 1.076852
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.69459
(1: 0.079505, 2: 0.030402, 3: 0.080596, 4: 0.142851, 5: 0.361241);
(D_melanogaster_CG42445-PA: 0.079505, D_simulans_CG42445-PA: 0.030402, D_yakuba_CG42445-PA: 0.080596, D_erecta_CG42445-PA: 0.142851, D_takahashii_CG42445-PA: 0.361241);
Detailed output identifying parameters
kappa (ts/tv) = 3.15778
Parameters in M7 (beta):
p = 0.05316 q = 1.07685
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.00027 0.00398 0.04201 0.34908
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.080 183.1 77.9 0.0395 0.0032 0.0813 0.6 6.3
6..2 0.030 183.1 77.9 0.0395 0.0012 0.0311 0.2 2.4
6..3 0.081 183.1 77.9 0.0395 0.0033 0.0824 0.6 6.4
6..4 0.143 183.1 77.9 0.0395 0.0058 0.1460 1.1 11.4
6..5 0.361 183.1 77.9 0.0395 0.0146 0.3692 2.7 28.8
Time used: 0:14
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 48
lnL(ntime: 5 np: 10): -533.017184 +0.000000
6..1 6..2 6..3 6..4 6..5
0.079505 0.030402 0.080596 0.142851 0.361242 3.157801 0.999990 0.053160 1.077059 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.69460
(1: 0.079505, 2: 0.030402, 3: 0.080596, 4: 0.142851, 5: 0.361242);
(D_melanogaster_CG42445-PA: 0.079505, D_simulans_CG42445-PA: 0.030402, D_yakuba_CG42445-PA: 0.080596, D_erecta_CG42445-PA: 0.142851, D_takahashii_CG42445-PA: 0.361242);
Detailed output identifying parameters
kappa (ts/tv) = 3.15780
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.05316 q = 1.07706
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.00027 0.00398 0.04201 0.34901 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.080 183.1 77.9 0.0395 0.0032 0.0813 0.6 6.3
6..2 0.030 183.1 77.9 0.0395 0.0012 0.0311 0.2 2.4
6..3 0.081 183.1 77.9 0.0395 0.0033 0.0824 0.6 6.4
6..4 0.143 183.1 77.9 0.0395 0.0058 0.1460 1.1 11.4
6..5 0.361 183.1 77.9 0.0395 0.0146 0.3692 2.7 28.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42445-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
p : 0.996 0.004 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.001 0.006 0.025 0.061 0.114 0.183 0.262 0.349
ws: 0.279 0.151 0.109 0.089 0.076 0.068 0.062 0.058 0.055 0.052
Time used: 0:27
Model 1: NearlyNeutral -533.241465 Model 2: PositiveSelection -533.241465 Model 0: one-ratio -534.2384 Model 3: discrete -532.996686 Model 7: beta -533.017132 Model 8: beta&w>1 -533.017184 Model 0 vs 1 1.9938700000000154 Model 2 vs 1 0.0 Model 8 vs 7 1.0400000019217259E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
