--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 02 15:26:19 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/143/CG42445-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -576.25          -585.74
2       -576.03          -586.24
--------------------------------------
TOTAL     -576.13          -586.02
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.555976    0.023233    0.310248    0.868259    0.533075   1047.89   1238.33    1.000
r(A<->C){all}   0.115550    0.003544    0.010014    0.234065    0.107551    593.51    601.48    1.000
r(A<->G){all}   0.259161    0.008544    0.099931    0.450292    0.249983    455.91    542.72    1.002
r(A<->T){all}   0.064466    0.002396    0.000008    0.158003    0.052501    544.20    608.87    1.002
r(C<->G){all}   0.040478    0.000927    0.000058    0.100528    0.033985    614.27    694.18    1.000
r(C<->T){all}   0.479617    0.011005    0.283083    0.683535    0.475838    437.91    563.75    1.004
r(G<->T){all}   0.040728    0.000997    0.000167    0.101589    0.033846    741.75    810.07    1.000
pi(A){all}      0.219509    0.000564    0.173246    0.265629    0.219251   1147.74   1223.31    1.000
pi(C){all}      0.267827    0.000637    0.219691    0.317667    0.267379   1150.83   1211.95    1.002
pi(G){all}      0.258177    0.000702    0.208511    0.312157    0.257154   1174.73   1188.27    1.000
pi(T){all}      0.254486    0.000643    0.204514    0.304208    0.254007    911.52   1062.79    1.001
alpha{1,2}      0.069859    0.002063    0.000120    0.149023    0.066197   1288.24   1310.11    1.001
alpha{3}        1.615937    0.507611    0.509043    3.056982    1.474122   1501.00   1501.00    1.000
pinvar{all}     0.504882    0.010275    0.299282    0.679656    0.516941   1107.19   1167.07    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-533.241465
Model 2: PositiveSelection	-533.241465
Model 0: one-ratio	-534.2384
Model 3: discrete	-532.996686
Model 7: beta	-533.017132
Model 8: beta&w>1	-533.017184


Model 0 vs 1	1.9938700000000154

Model 2 vs 1	0.0

Model 8 vs 7	1.0400000019217259E-4
>C1
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C2
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C3
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C4
MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
>C5
MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=87 

C1              MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
C2              MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
C3              MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
C4              MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
C5              MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
                **********:** *******:****************************

C1              DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
C2              DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
C3              DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
C4              DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
C5              DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
                ***************:*********************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1740]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [1740]--->[1740]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/143/CG42445-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.246 Mb, Max= 30.411 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C2
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C3
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C4
MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
>C5
MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL

FORMAT of file /tmp/tmp7931913228153696038aln Not Supported[FATAL:T-COFFEE]
>C1
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C2
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C3
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C4
MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
>C5
MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:87 S:100 BS:87
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 98.85 C1	 C2	 98.85
TOP	    1    0	 98.85 C2	 C1	 98.85
BOT	    0    2	 98.85 C1	 C3	 98.85
TOP	    2    0	 98.85 C3	 C1	 98.85
BOT	    0    3	 96.55 C1	 C4	 96.55
TOP	    3    0	 96.55 C4	 C1	 96.55
BOT	    0    4	 97.70 C1	 C5	 97.70
TOP	    4    0	 97.70 C5	 C1	 97.70
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 96.55 C2	 C4	 96.55
TOP	    3    1	 96.55 C4	 C2	 96.55
BOT	    1    4	 98.85 C2	 C5	 98.85
TOP	    4    1	 98.85 C5	 C2	 98.85
BOT	    2    3	 96.55 C3	 C4	 96.55
TOP	    3    2	 96.55 C4	 C3	 96.55
BOT	    2    4	 98.85 C3	 C5	 98.85
TOP	    4    2	 98.85 C5	 C3	 98.85
BOT	    3    4	 95.40 C4	 C5	 95.40
TOP	    4    3	 95.40 C5	 C4	 95.40
AVG	 0	 C1	  *	 97.99
AVG	 1	 C2	  *	 98.56
AVG	 2	 C3	  *	 98.56
AVG	 3	 C4	  *	 96.26
AVG	 4	 C5	  *	 97.70
TOT	 TOT	  *	 97.82
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTTGACAT
C2              ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTCCACATACTCGACAT
C3              ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTCGACAT
C4              ATGGATCTAATGGAGCTGCTGCATCAGCTGCTCCTCCACATACTCGACAT
C5              ATGGATCTAATGGAGCTGCTGCATCAGCTGTTTCTGCACACACTCGACAT
                ****************************** * ** **** *** *****

C1              TTTTAAGATCTACATCAAGTTTGCACTGATCACGCTGGTCATCTATTTCC
C2              TTTTAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
C3              ATTCAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
C4              TTTTAAGATATACCTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
C5              CTTTAAGATCTACGTCAAGTTCGCCCTGATCACGCTGGTCATCTACTTCC
                 ** *****.*** ******* **.******************** ****

C1              TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
C2              TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
C3              TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
C4              TGGCCGAGTGGTACATACTGCGATATGGAGCGGAGTTGGAGGCCGAACTG
C5              TGGCCGAGTGGTATATCCTACGATATGGTGCCGAACTGGAGGCCGAACTG
                ************* **.**.********:** **. **************

C1              GACGCCCATCTGGTGGAAGGTGCCGAACTCAGGGAGGAATCCCCCGAGCG
C2              GACGCCCATCTGGTGGAAGGTGCCGAACTGAGGGAGGAATCTCCCGAGCG
C3              GACGCCCATTTGGTGGAAGGTGCCGAACTGAGAGAGGAATCCCCCGAGCG
C4              GATGCCCATCTGGTGGAAGGCGCCGAGCTGAGAGAGGAATCCCCCGATAG
C5              GATGCCCACCTGGTGGAGGGTGCTGAGCTGAGAGAGGAATCCCCCGAGCG
                ** *****  *******.** ** **.** **.******** ***** .*

C1              ACCTGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
C2              ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
C3              ACCCGAATCGAATAGCACGCTAAGCAAGGTGTTTCGCTTTGTGGTAAACT
C4              ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
C5              ACCCGAATCGAACAGCACTCTCAGCAAGGTGTTTCGATTTGTGGTGAACT
                *** ******** ***** ** **************.** *****.****

C1              TTTTCATCCTC
C2              TTTTCATCCTC
C3              TTTTCATCCTC
C4              TTTTCATCCTC
C5              TTTTCATCCTC
                ***********



>C1
ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTTGACAT
TTTTAAGATCTACATCAAGTTTGCACTGATCACGCTGGTCATCTATTTCC
TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
GACGCCCATCTGGTGGAAGGTGCCGAACTCAGGGAGGAATCCCCCGAGCG
ACCTGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
TTTTCATCCTC
>C2
ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTCCACATACTCGACAT
TTTTAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
GACGCCCATCTGGTGGAAGGTGCCGAACTGAGGGAGGAATCTCCCGAGCG
ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
TTTTCATCCTC
>C3
ATGGATCTAATGGAGCTGCTGCATCAGCTGTTCCTTCACATACTCGACAT
ATTCAAGATCTACGTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
TGGCCGAGTGGTACATACTGCGATATGGAGCAGAATTGGAGGCCGAACTG
GACGCCCATTTGGTGGAAGGTGCCGAACTGAGAGAGGAATCCCCCGAGCG
ACCCGAATCGAATAGCACGCTAAGCAAGGTGTTTCGCTTTGTGGTAAACT
TTTTCATCCTC
>C4
ATGGATCTAATGGAGCTGCTGCATCAGCTGCTCCTCCACATACTCGACAT
TTTTAAGATATACCTCAAGTTTGCACTGATCACGCTGGTCATCTACTTCC
TGGCCGAGTGGTACATACTGCGATATGGAGCGGAGTTGGAGGCCGAACTG
GATGCCCATCTGGTGGAAGGCGCCGAGCTGAGAGAGGAATCCCCCGATAG
ACCCGAATCGAATAGCACGCTGAGCAAGGTGTTTCGCTTCGTGGTGAACT
TTTTCATCCTC
>C5
ATGGATCTAATGGAGCTGCTGCATCAGCTGTTTCTGCACACACTCGACAT
CTTTAAGATCTACGTCAAGTTCGCCCTGATCACGCTGGTCATCTACTTCC
TGGCCGAGTGGTATATCCTACGATATGGTGCCGAACTGGAGGCCGAACTG
GATGCCCACCTGGTGGAGGGTGCTGAGCTGAGAGAGGAATCCCCCGAGCG
ACCCGAATCGAACAGCACTCTCAGCAAGGTGTTTCGATTTGTGGTGAACT
TTTTCATCCTC
>C1
MDLMELLHQLFLHILDIFKIYIKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C2
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C3
MDLMELLHQLFLHILDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL
>C4
MDLMELLHQLLLHILDIFKIYLKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPDRPESNSTLSKVFRFVVNFFIL
>C5
MDLMELLHQLFLHTLDIFKIYVKFALITLVIYFLAEWYILRYGAELEAEL
DAHLVEGAELREESPERPESNSTLSKVFRFVVNFFIL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 261 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478100214
      Setting output file names to "/opt/ADOPS/143/CG42445-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 267458699
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1841612285
      Seed = 1298803410
      Swapseed = 1478100214
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 9 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 29 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -692.563345 -- -25.624409
         Chain 2 -- -692.563345 -- -25.624409
         Chain 3 -- -685.781767 -- -25.624409
         Chain 4 -- -687.669417 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -688.966535 -- -25.624409
         Chain 2 -- -684.280890 -- -25.624409
         Chain 3 -- -695.402452 -- -25.624409
         Chain 4 -- -693.291571 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-692.563] (-692.563) (-685.782) (-687.669) * [-688.967] (-684.281) (-695.402) (-693.292) 
        500 -- (-599.854) (-606.907) [-605.204] (-609.666) * [-601.768] (-601.951) (-603.228) (-599.133) -- 0:00:00
       1000 -- (-600.309) (-602.280) [-597.972] (-603.869) * (-604.113) (-605.356) [-597.537] (-600.868) -- 0:00:00
       1500 -- [-597.980] (-599.754) (-594.491) (-603.316) * (-591.786) (-599.231) [-595.358] (-601.884) -- 0:00:00
       2000 -- (-595.276) [-592.354] (-591.898) (-602.328) * (-594.859) [-589.486] (-597.263) (-598.872) -- 0:00:00
       2500 -- (-601.298) (-590.136) [-586.486] (-592.151) * (-590.846) (-590.692) (-595.633) [-592.580] -- 0:06:39
       3000 -- (-598.623) (-588.714) (-580.545) [-589.435] * (-594.940) (-593.923) [-589.579] (-595.565) -- 0:05:32
       3500 -- (-595.593) (-578.580) [-584.245] (-584.756) * (-588.966) (-588.859) (-586.392) [-588.981] -- 0:04:44
       4000 -- (-588.970) [-580.940] (-581.871) (-580.197) * [-580.807] (-596.547) (-589.565) (-589.761) -- 0:04:09
       4500 -- (-583.229) (-583.343) (-579.983) [-580.658] * (-580.433) (-590.654) [-587.005] (-590.776) -- 0:03:41
       5000 -- (-587.812) [-578.643] (-582.510) (-580.104) * (-587.514) [-585.012] (-588.567) (-587.216) -- 0:03:19

      Average standard deviation of split frequencies: 0.098209

       5500 -- (-582.522) [-580.280] (-584.720) (-578.795) * (-581.916) [-581.270] (-582.587) (-592.768) -- 0:03:00
       6000 -- [-580.233] (-576.864) (-581.567) (-579.783) * [-582.704] (-582.253) (-585.689) (-592.281) -- 0:02:45
       6500 -- (-578.199) (-576.531) (-585.271) [-578.701] * (-590.110) (-581.967) [-581.740] (-586.389) -- 0:02:32
       7000 -- (-583.635) (-581.265) [-579.353] (-580.269) * (-578.212) (-584.766) (-580.848) [-583.744] -- 0:02:21
       7500 -- (-585.462) (-583.011) [-577.662] (-578.246) * (-583.776) (-579.314) [-586.244] (-586.530) -- 0:02:12
       8000 -- (-587.323) [-579.354] (-589.396) (-573.962) * (-580.029) [-580.142] (-584.327) (-589.631) -- 0:02:04
       8500 -- [-580.542] (-581.077) (-586.587) (-576.787) * (-577.933) (-582.349) [-579.150] (-585.265) -- 0:01:56
       9000 -- (-587.169) [-578.262] (-584.618) (-578.132) * (-577.989) [-579.226] (-578.671) (-584.284) -- 0:01:50
       9500 -- (-584.249) (-581.318) (-582.489) [-576.448] * (-588.157) [-578.710] (-574.849) (-582.303) -- 0:03:28
      10000 -- (-592.840) (-588.246) [-579.509] (-577.553) * (-580.073) [-580.525] (-579.462) (-580.651) -- 0:03:18

      Average standard deviation of split frequencies: 0.066291

      10500 -- (-584.563) [-578.892] (-589.838) (-577.854) * (-584.505) (-578.496) (-577.874) [-576.664] -- 0:03:08
      11000 -- (-582.338) (-576.090) (-580.231) [-574.560] * (-578.450) [-578.375] (-580.491) (-579.682) -- 0:02:59
      11500 -- [-579.044] (-580.647) (-583.551) (-581.732) * (-576.669) (-578.180) [-575.901] (-580.588) -- 0:02:51
      12000 -- [-580.025] (-579.181) (-584.279) (-584.123) * (-583.556) (-582.299) (-576.566) [-584.040] -- 0:02:44
      12500 -- [-578.871] (-575.471) (-582.214) (-575.675) * (-583.098) (-583.689) (-583.721) [-575.222] -- 0:02:38
      13000 -- [-578.456] (-574.443) (-585.969) (-576.320) * (-576.813) [-581.235] (-579.678) (-581.130) -- 0:02:31
      13500 -- (-580.858) [-575.736] (-584.703) (-586.184) * (-581.048) [-576.773] (-577.046) (-578.423) -- 0:02:26
      14000 -- (-577.797) [-576.731] (-581.810) (-581.179) * (-578.312) (-580.747) (-584.869) [-574.310] -- 0:02:20
      14500 -- (-579.253) [-579.539] (-587.717) (-578.213) * [-581.053] (-581.137) (-577.390) (-582.138) -- 0:02:15
      15000 -- (-580.564) [-579.471] (-580.711) (-575.035) * [-577.128] (-585.184) (-577.079) (-580.361) -- 0:02:11

      Average standard deviation of split frequencies: 0.055652

      15500 -- [-576.549] (-579.540) (-581.758) (-581.061) * (-578.184) (-587.228) (-577.766) [-578.670] -- 0:02:07
      16000 -- [-581.395] (-576.957) (-579.305) (-575.570) * (-582.489) (-587.813) [-576.463] (-576.003) -- 0:02:03
      16500 -- (-579.681) (-578.458) [-584.238] (-578.373) * (-576.249) (-584.756) (-576.735) [-579.181] -- 0:01:59
      17000 -- (-577.910) (-575.911) (-576.864) [-581.717] * (-574.544) [-584.169] (-578.304) (-584.846) -- 0:02:53
      17500 -- (-579.322) (-580.244) (-590.584) [-579.466] * (-575.693) (-588.249) [-585.347] (-589.873) -- 0:02:48
      18000 -- (-582.732) (-576.675) (-582.538) [-576.285] * (-574.702) (-595.893) (-579.251) [-580.531] -- 0:02:43
      18500 -- (-579.936) [-578.558] (-584.156) (-579.038) * [-577.366] (-585.224) (-575.809) (-575.327) -- 0:02:39
      19000 -- (-581.232) (-576.654) [-577.988] (-576.613) * [-578.754] (-583.096) (-583.447) (-577.968) -- 0:02:34
      19500 -- (-580.900) [-581.293] (-582.518) (-575.930) * (-576.603) [-582.613] (-578.497) (-577.255) -- 0:02:30
      20000 -- (-580.518) (-577.697) [-583.218] (-577.472) * (-579.111) (-581.654) [-576.367] (-579.449) -- 0:02:27

      Average standard deviation of split frequencies: 0.059306

      20500 -- [-583.296] (-580.831) (-578.740) (-583.988) * [-579.233] (-580.763) (-579.524) (-580.747) -- 0:02:23
      21000 -- (-579.428) (-581.679) (-578.804) [-577.521] * (-581.436) [-583.931] (-575.986) (-577.704) -- 0:02:19
      21500 -- (-577.810) (-576.909) (-580.195) [-577.834] * (-579.592) (-583.621) (-579.635) [-574.674] -- 0:02:16
      22000 -- (-576.843) (-578.553) [-582.127] (-575.573) * (-579.272) (-577.516) (-577.584) [-585.256] -- 0:02:13
      22500 -- [-579.930] (-581.217) (-581.101) (-572.980) * [-581.208] (-580.980) (-578.333) (-580.091) -- 0:02:10
      23000 -- (-581.223) [-578.502] (-580.265) (-575.198) * (-583.336) [-581.529] (-583.386) (-577.296) -- 0:02:07
      23500 -- [-580.768] (-584.114) (-579.722) (-581.410) * (-580.292) (-578.000) [-580.945] (-577.488) -- 0:02:04
      24000 -- (-581.652) (-579.404) [-583.274] (-582.167) * (-581.793) (-583.487) (-579.473) [-574.221] -- 0:02:42
      24500 -- (-581.338) (-581.312) [-580.984] (-582.323) * [-578.948] (-581.487) (-585.311) (-581.063) -- 0:02:39
      25000 -- (-577.284) (-583.958) (-580.996) [-577.191] * (-577.212) (-582.444) (-580.741) [-579.917] -- 0:02:36

      Average standard deviation of split frequencies: 0.042306

      25500 -- (-577.747) (-583.440) (-581.696) [-583.718] * (-579.221) (-584.429) [-578.736] (-583.587) -- 0:02:32
      26000 -- (-577.486) [-574.044] (-578.497) (-577.030) * [-575.186] (-582.208) (-575.988) (-579.855) -- 0:02:29
      26500 -- (-576.932) [-579.959] (-579.034) (-580.470) * (-579.720) (-590.454) [-578.335] (-582.498) -- 0:02:26
      27000 -- (-580.074) (-579.045) (-582.319) [-579.231] * (-577.865) (-590.202) (-576.676) [-582.646] -- 0:02:24
      27500 -- (-581.583) (-579.835) [-580.186] (-578.297) * (-580.442) (-585.229) (-578.644) [-579.869] -- 0:02:21
      28000 -- (-581.413) [-579.983] (-578.922) (-578.438) * (-579.455) (-581.945) [-581.797] (-577.571) -- 0:02:18
      28500 -- [-579.980] (-580.922) (-584.093) (-581.673) * (-584.471) (-579.235) [-579.385] (-581.699) -- 0:02:16
      29000 -- (-583.725) (-579.903) (-574.659) [-579.610] * [-585.601] (-578.837) (-582.160) (-578.206) -- 0:02:13
      29500 -- [-585.336] (-576.854) (-575.091) (-578.159) * (-583.653) [-579.369] (-582.868) (-582.826) -- 0:02:11
      30000 -- (-584.049) [-577.483] (-577.908) (-583.993) * (-578.559) [-579.164] (-581.634) (-581.077) -- 0:02:09

      Average standard deviation of split frequencies: 0.049190

      30500 -- (-585.223) [-575.071] (-577.545) (-585.966) * [-577.287] (-581.358) (-580.289) (-579.622) -- 0:02:07
      31000 -- (-587.678) (-579.032) (-578.471) [-583.363] * (-582.714) (-588.485) [-586.550] (-578.242) -- 0:02:05
      31500 -- (-579.495) (-580.646) (-580.541) [-576.134] * [-579.280] (-579.764) (-579.748) (-579.913) -- 0:02:33
      32000 -- [-581.537] (-578.605) (-575.938) (-582.844) * (-587.177) (-579.327) (-585.034) [-579.637] -- 0:02:31
      32500 -- (-580.934) (-578.794) [-575.360] (-579.045) * [-582.105] (-576.456) (-580.997) (-577.275) -- 0:02:28
      33000 -- (-586.597) (-577.422) (-574.557) [-581.584] * [-577.696] (-584.929) (-576.615) (-580.746) -- 0:02:26
      33500 -- (-585.718) [-577.109] (-576.165) (-580.744) * (-577.207) (-577.984) (-576.940) [-577.613] -- 0:02:24
      34000 -- (-582.306) [-583.774] (-578.549) (-582.382) * (-579.145) (-579.365) (-576.704) [-581.441] -- 0:02:22
      34500 -- (-585.650) (-584.636) [-577.368] (-574.817) * (-580.837) [-576.132] (-580.649) (-579.464) -- 0:02:19
      35000 -- [-583.241] (-582.093) (-577.711) (-576.774) * (-577.661) (-576.875) (-578.259) [-584.578] -- 0:02:17

      Average standard deviation of split frequencies: 0.036374

      35500 -- (-586.535) [-577.342] (-582.268) (-582.112) * [-575.320] (-579.940) (-592.424) (-577.959) -- 0:02:15
      36000 -- (-584.376) (-577.023) (-579.653) [-581.566] * (-578.663) (-576.675) [-578.917] (-577.170) -- 0:02:13
      36500 -- (-585.022) [-580.271] (-580.287) (-588.989) * (-581.924) (-583.537) [-580.526] (-576.917) -- 0:02:11
      37000 -- [-579.341] (-579.135) (-578.342) (-587.208) * [-577.503] (-578.517) (-577.442) (-578.283) -- 0:02:10
      37500 -- [-578.465] (-578.383) (-581.283) (-585.260) * [-574.646] (-585.608) (-577.252) (-577.921) -- 0:02:08
      38000 -- (-577.336) (-576.942) (-578.221) [-582.219] * (-578.121) [-582.570] (-581.419) (-576.761) -- 0:02:06
      38500 -- (-577.720) (-584.112) [-580.753] (-580.916) * (-581.170) (-579.317) [-586.958] (-577.558) -- 0:02:04
      39000 -- (-576.550) [-583.757] (-584.828) (-581.456) * [-581.909] (-582.006) (-578.326) (-579.867) -- 0:02:27
      39500 -- [-575.005] (-586.987) (-582.485) (-581.658) * [-575.344] (-581.181) (-578.424) (-581.344) -- 0:02:25
      40000 -- (-579.420) [-581.768] (-580.743) (-577.603) * [-577.126] (-584.080) (-580.877) (-575.032) -- 0:02:24

      Average standard deviation of split frequencies: 0.041731

      40500 -- (-585.088) [-578.943] (-581.338) (-578.569) * (-579.833) (-580.059) (-579.722) [-577.183] -- 0:02:22
      41000 -- (-577.845) (-584.446) [-575.790] (-579.806) * (-578.100) (-586.142) [-578.915] (-579.047) -- 0:02:20
      41500 -- (-579.996) (-581.323) [-577.453] (-578.640) * [-579.794] (-581.695) (-583.237) (-580.908) -- 0:02:18
      42000 -- (-577.954) [-581.211] (-578.173) (-576.136) * (-581.167) [-581.917] (-582.760) (-579.096) -- 0:02:16
      42500 -- [-575.347] (-578.861) (-577.638) (-581.951) * (-577.548) (-584.808) (-588.399) [-575.691] -- 0:02:15
      43000 -- (-580.137) [-578.002] (-581.478) (-576.467) * [-576.372] (-582.108) (-584.173) (-576.176) -- 0:02:13
      43500 -- [-577.309] (-577.353) (-575.736) (-587.564) * (-575.991) (-576.569) [-575.092] (-578.697) -- 0:02:11
      44000 -- [-575.609] (-578.402) (-577.561) (-579.600) * (-574.480) (-577.311) (-587.060) [-577.310] -- 0:02:10
      44500 -- (-576.530) (-576.092) [-575.736] (-575.269) * [-583.998] (-573.028) (-575.101) (-578.540) -- 0:02:08
      45000 -- (-583.974) (-583.244) (-573.508) [-577.447] * (-583.510) (-573.881) (-585.569) [-584.757] -- 0:02:07

      Average standard deviation of split frequencies: 0.034843

      45500 -- (-576.655) (-578.098) [-578.543] (-577.008) * (-577.126) (-574.861) [-578.670] (-585.222) -- 0:02:05
      46000 -- (-576.804) (-580.182) (-576.758) [-578.780] * (-580.552) (-579.794) (-577.695) [-579.467] -- 0:02:04
      46500 -- (-579.433) (-574.682) [-583.157] (-577.219) * (-581.872) (-575.858) [-582.435] (-580.458) -- 0:02:23
      47000 -- (-579.839) [-574.856] (-582.004) (-582.448) * (-578.351) (-576.890) (-582.994) [-579.156] -- 0:02:21
      47500 -- (-581.355) [-577.567] (-578.403) (-578.869) * [-578.154] (-578.674) (-579.094) (-576.639) -- 0:02:20
      48000 -- [-579.727] (-577.304) (-583.268) (-580.703) * (-581.792) (-579.727) [-581.213] (-584.224) -- 0:02:18
      48500 -- [-579.216] (-585.734) (-578.198) (-584.925) * (-587.546) [-578.117] (-582.721) (-578.195) -- 0:02:17
      49000 -- (-578.631) (-578.468) [-583.769] (-579.169) * (-583.266) [-582.134] (-577.776) (-581.315) -- 0:02:15
      49500 -- (-581.693) (-579.927) [-581.709] (-585.354) * [-580.265] (-576.481) (-580.565) (-578.475) -- 0:02:14
      50000 -- (-584.279) (-579.858) [-580.805] (-577.920) * (-576.513) (-575.213) (-583.677) [-581.909] -- 0:02:13

      Average standard deviation of split frequencies: 0.039077

      50500 -- (-585.270) (-579.521) (-577.791) [-577.383] * (-577.500) (-579.639) (-582.528) [-580.680] -- 0:02:11
      51000 -- [-580.033] (-578.909) (-581.030) (-575.452) * [-575.514] (-578.138) (-583.280) (-574.839) -- 0:02:10
      51500 -- (-584.878) (-585.523) (-577.625) [-577.296] * [-577.407] (-575.715) (-578.150) (-586.327) -- 0:02:08
      52000 -- (-581.495) [-578.768] (-574.241) (-588.721) * [-576.086] (-577.954) (-576.277) (-577.332) -- 0:02:07
      52500 -- [-577.939] (-582.244) (-574.550) (-579.056) * (-580.991) (-583.010) (-576.615) [-579.621] -- 0:02:06
      53000 -- (-586.940) [-577.465] (-577.030) (-578.280) * (-578.535) (-581.632) [-576.718] (-589.471) -- 0:02:05
      53500 -- (-584.498) [-577.253] (-585.358) (-576.487) * (-581.089) [-582.747] (-578.472) (-577.418) -- 0:02:21
      54000 -- (-580.399) (-578.262) [-581.100] (-582.427) * [-578.459] (-577.553) (-580.647) (-577.434) -- 0:02:20
      54500 -- (-579.170) (-581.333) (-578.820) [-575.938] * (-577.873) (-578.346) [-578.572] (-576.523) -- 0:02:18
      55000 -- (-578.553) (-581.528) [-577.709] (-582.928) * (-580.135) (-579.725) (-584.398) [-576.065] -- 0:02:17

      Average standard deviation of split frequencies: 0.046766

      55500 -- [-582.077] (-581.197) (-582.999) (-578.045) * (-582.962) [-578.782] (-587.559) (-577.654) -- 0:02:16
      56000 -- [-578.667] (-579.055) (-581.778) (-583.979) * (-578.586) [-577.961] (-589.573) (-574.311) -- 0:02:14
      56500 -- (-581.779) (-583.152) (-576.876) [-581.876] * (-578.834) (-577.113) (-586.092) [-578.044] -- 0:02:13
      57000 -- (-575.990) [-577.779] (-579.613) (-579.905) * (-584.608) [-578.534] (-579.262) (-583.234) -- 0:02:12
      57500 -- [-577.495] (-579.164) (-579.765) (-578.267) * (-580.908) (-584.182) (-577.881) [-579.349] -- 0:02:11
      58000 -- (-583.165) (-581.519) [-578.465] (-576.860) * (-591.615) (-576.227) (-579.801) [-577.248] -- 0:02:09
      58500 -- (-579.920) (-586.493) (-574.800) [-580.074] * (-580.796) (-577.701) [-585.042] (-574.925) -- 0:02:08
      59000 -- (-580.876) (-585.983) (-578.742) [-577.845] * (-580.251) [-575.541] (-579.824) (-574.951) -- 0:02:07
      59500 -- (-582.750) [-587.026] (-578.770) (-579.691) * (-590.138) (-577.604) [-577.875] (-583.797) -- 0:02:06
      60000 -- (-582.489) [-582.233] (-581.407) (-583.400) * (-581.883) [-572.879] (-577.833) (-582.101) -- 0:02:05

      Average standard deviation of split frequencies: 0.039715

      60500 -- (-579.350) (-584.765) [-579.973] (-582.957) * (-584.781) [-577.048] (-577.758) (-576.302) -- 0:02:04
      61000 -- [-580.658] (-586.680) (-580.315) (-581.146) * (-583.637) [-575.721] (-588.521) (-577.053) -- 0:02:18
      61500 -- (-586.926) [-580.612] (-576.386) (-581.154) * (-587.581) (-578.193) (-576.235) [-580.829] -- 0:02:17
      62000 -- (-578.258) [-586.182] (-578.638) (-583.452) * (-589.432) [-580.081] (-575.648) (-575.597) -- 0:02:16
      62500 -- (-582.514) (-577.652) (-576.943) [-577.573] * (-583.845) [-577.792] (-575.964) (-581.318) -- 0:02:15
      63000 -- (-581.250) (-576.184) [-574.579] (-591.342) * (-581.567) (-581.779) (-585.321) [-579.103] -- 0:02:13
      63500 -- (-579.353) (-577.391) [-574.093] (-578.376) * (-580.307) (-579.446) [-583.650] (-582.423) -- 0:02:12
      64000 -- (-576.200) (-577.969) (-581.789) [-575.755] * (-589.834) (-578.380) [-582.395] (-578.844) -- 0:02:11
      64500 -- (-580.180) [-580.081] (-587.774) (-578.026) * (-580.254) (-583.564) [-577.163] (-579.945) -- 0:02:10
      65000 -- (-575.563) [-585.222] (-578.570) (-576.060) * (-581.503) (-589.386) (-580.512) [-578.231] -- 0:02:09

      Average standard deviation of split frequencies: 0.035712

      65500 -- (-577.133) (-579.570) (-579.166) [-577.577] * (-577.449) [-577.577] (-579.468) (-580.590) -- 0:02:08
      66000 -- (-578.508) (-577.246) (-580.523) [-575.699] * (-582.196) [-577.387] (-587.797) (-576.678) -- 0:02:07
      66500 -- (-587.614) [-578.984] (-578.719) (-581.021) * (-583.393) (-581.026) (-586.440) [-575.220] -- 0:02:06
      67000 -- (-589.070) [-584.171] (-583.790) (-575.062) * (-576.833) [-573.332] (-584.974) (-577.506) -- 0:02:05
      67500 -- (-582.790) (-580.006) (-586.540) [-575.322] * (-576.631) [-574.310] (-579.579) (-581.217) -- 0:02:04
      68000 -- [-581.983] (-583.946) (-584.069) (-574.899) * (-578.994) [-575.110] (-591.585) (-577.513) -- 0:02:17
      68500 -- (-591.283) [-578.544] (-581.469) (-576.739) * (-582.664) (-578.994) [-576.600] (-575.150) -- 0:02:15
      69000 -- (-578.869) (-578.253) (-577.591) [-575.201] * [-580.842] (-584.724) (-576.002) (-577.460) -- 0:02:14
      69500 -- (-578.503) (-579.080) (-577.751) [-575.636] * [-577.596] (-585.013) (-581.766) (-573.466) -- 0:02:13
      70000 -- (-585.454) [-579.491] (-576.405) (-576.021) * (-582.082) (-579.423) [-576.491] (-578.406) -- 0:02:12

      Average standard deviation of split frequencies: 0.032613

      70500 -- (-581.292) (-581.876) [-580.596] (-578.849) * (-580.163) (-580.866) (-582.989) [-577.157] -- 0:02:11
      71000 -- (-589.852) [-578.142] (-576.182) (-582.408) * (-580.647) (-585.057) (-581.320) [-579.156] -- 0:02:10
      71500 -- (-577.710) (-586.536) [-577.201] (-586.387) * (-580.436) [-577.403] (-583.674) (-582.805) -- 0:02:09
      72000 -- (-578.941) (-580.347) (-576.315) [-580.500] * (-578.699) (-588.983) (-584.175) [-579.977] -- 0:02:08
      72500 -- (-577.768) (-576.990) (-578.071) [-576.099] * (-585.808) [-579.078] (-581.908) (-586.480) -- 0:02:07
      73000 -- [-575.370] (-576.134) (-577.275) (-576.088) * (-581.352) (-578.605) (-588.203) [-576.297] -- 0:02:06
      73500 -- (-577.021) (-580.944) [-578.337] (-584.137) * (-579.873) (-586.523) [-580.777] (-579.000) -- 0:02:06
      74000 -- (-577.034) (-575.766) (-584.176) [-576.506] * (-586.395) (-575.854) (-580.383) [-579.061] -- 0:02:05
      74500 -- (-583.198) (-582.147) (-585.965) [-577.143] * (-584.797) [-575.850] (-578.455) (-579.651) -- 0:02:04
      75000 -- (-582.203) (-583.386) [-585.468] (-581.266) * (-590.968) (-580.275) (-580.605) [-578.927] -- 0:02:03

      Average standard deviation of split frequencies: 0.025586

      75500 -- (-581.881) (-580.067) (-582.649) [-576.210] * (-587.348) (-583.034) [-583.187] (-579.301) -- 0:02:14
      76000 -- (-587.035) (-580.686) [-579.076] (-574.874) * (-587.991) [-578.776] (-577.762) (-577.920) -- 0:02:13
      76500 -- (-583.909) (-577.771) (-580.605) [-580.546] * (-585.729) (-578.059) (-586.591) [-579.104] -- 0:02:12
      77000 -- (-574.502) [-575.733] (-577.158) (-577.409) * (-586.210) [-578.706] (-582.696) (-576.591) -- 0:02:11
      77500 -- (-579.362) (-578.591) (-577.264) [-579.060] * (-587.376) (-581.296) [-581.654] (-578.318) -- 0:02:10
      78000 -- (-581.168) (-583.870) (-574.952) [-584.485] * [-581.821] (-575.065) (-586.545) (-584.682) -- 0:02:10
      78500 -- (-581.103) (-577.472) [-578.068] (-582.146) * [-580.495] (-579.926) (-589.024) (-580.588) -- 0:02:09
      79000 -- (-581.222) (-584.981) (-578.270) [-586.464] * (-583.236) [-575.375] (-586.355) (-580.810) -- 0:02:08
      79500 -- (-577.822) (-577.099) [-575.430] (-578.512) * (-580.240) (-580.359) (-588.312) [-574.910] -- 0:02:07
      80000 -- [-576.595] (-575.999) (-577.384) (-579.045) * (-583.048) [-578.952] (-582.581) (-578.886) -- 0:02:06

      Average standard deviation of split frequencies: 0.024106

      80500 -- (-584.897) (-578.264) [-579.585] (-575.611) * (-582.825) (-584.623) [-578.788] (-578.759) -- 0:02:05
      81000 -- (-578.138) (-576.136) [-583.158] (-576.414) * (-586.316) (-586.613) [-576.077] (-583.065) -- 0:02:04
      81500 -- [-576.342] (-579.986) (-580.673) (-578.742) * [-581.411] (-579.975) (-577.705) (-575.582) -- 0:02:03
      82000 -- (-580.837) [-578.775] (-580.673) (-576.206) * [-582.067] (-583.346) (-579.415) (-579.149) -- 0:02:03
      82500 -- (-580.763) (-577.236) (-581.567) [-581.184] * [-578.241] (-588.141) (-577.207) (-579.967) -- 0:02:02
      83000 -- (-581.612) [-577.562] (-584.198) (-578.319) * (-581.789) [-581.383] (-583.619) (-581.764) -- 0:02:12
      83500 -- (-575.222) (-575.949) (-579.640) [-573.887] * (-581.716) [-584.087] (-577.110) (-574.408) -- 0:02:11
      84000 -- [-578.735] (-580.003) (-582.531) (-581.678) * [-585.510] (-584.398) (-577.793) (-575.769) -- 0:02:10
      84500 -- (-579.155) (-580.981) (-585.010) [-576.939] * (-578.821) (-577.679) [-580.833] (-582.270) -- 0:02:10
      85000 -- [-574.156] (-582.205) (-583.750) (-585.639) * (-579.436) (-577.805) [-580.004] (-576.717) -- 0:02:09

      Average standard deviation of split frequencies: 0.017815

      85500 -- (-579.119) [-582.754] (-582.302) (-580.537) * [-582.994] (-579.490) (-583.239) (-579.871) -- 0:02:08
      86000 -- (-580.298) [-579.205] (-578.414) (-578.741) * (-581.715) (-578.787) [-578.159] (-576.598) -- 0:02:07
      86500 -- [-580.449] (-584.873) (-582.780) (-580.789) * (-576.992) [-576.651] (-580.703) (-578.484) -- 0:02:06
      87000 -- (-582.698) [-581.152] (-579.707) (-577.239) * (-581.464) (-577.267) (-576.946) [-582.073] -- 0:02:05
      87500 -- (-582.266) (-580.874) [-583.812] (-580.370) * (-581.484) [-580.094] (-580.431) (-583.867) -- 0:02:05
      88000 -- (-580.262) (-579.105) (-580.666) [-578.046] * (-577.803) [-576.737] (-578.519) (-582.695) -- 0:02:04
      88500 -- [-581.155] (-580.947) (-584.571) (-582.272) * (-581.484) [-580.954] (-585.802) (-585.701) -- 0:02:03
      89000 -- (-580.956) (-581.811) [-582.501] (-585.335) * (-581.270) [-577.654] (-578.343) (-590.289) -- 0:02:02
      89500 -- (-579.511) [-581.914] (-580.947) (-579.725) * (-575.383) (-579.124) (-587.084) [-578.241] -- 0:02:02
      90000 -- (-579.262) (-576.100) (-586.505) [-577.531] * [-576.491] (-585.888) (-581.158) (-584.723) -- 0:02:01

      Average standard deviation of split frequencies: 0.016898

      90500 -- [-575.240] (-581.839) (-582.591) (-582.726) * [-578.836] (-583.608) (-583.408) (-582.151) -- 0:02:10
      91000 -- [-580.345] (-578.300) (-585.603) (-581.993) * (-576.901) (-579.051) (-580.483) [-579.457] -- 0:02:09
      91500 -- (-578.090) [-573.512] (-579.053) (-585.648) * [-574.686] (-577.670) (-581.514) (-579.634) -- 0:02:09
      92000 -- (-576.292) [-576.194] (-577.347) (-582.515) * [-583.236] (-581.459) (-575.095) (-578.208) -- 0:02:08
      92500 -- (-582.276) [-574.329] (-577.011) (-578.747) * (-579.028) [-577.349] (-581.399) (-579.513) -- 0:02:07
      93000 -- (-580.805) (-577.987) [-582.868] (-576.136) * (-583.233) [-576.912] (-578.622) (-582.631) -- 0:02:06
      93500 -- [-577.727] (-579.588) (-578.382) (-582.318) * [-584.326] (-579.242) (-576.207) (-584.857) -- 0:02:06
      94000 -- (-579.131) [-574.928] (-576.198) (-581.507) * (-583.342) (-576.122) (-582.121) [-580.924] -- 0:02:05
      94500 -- (-577.134) [-578.379] (-575.995) (-577.819) * (-583.186) (-576.561) [-579.848] (-582.521) -- 0:02:04
      95000 -- (-583.982) (-576.484) [-578.622] (-583.967) * [-576.518] (-577.843) (-578.493) (-578.050) -- 0:02:03

      Average standard deviation of split frequencies: 0.016836

      95500 -- (-580.985) [-575.941] (-583.763) (-587.225) * [-580.783] (-575.697) (-578.146) (-576.318) -- 0:02:03
      96000 -- (-577.704) [-574.553] (-595.646) (-579.226) * (-576.847) [-582.144] (-579.531) (-576.335) -- 0:02:02
      96500 -- [-578.903] (-574.587) (-576.469) (-582.236) * (-578.707) [-580.588] (-580.245) (-581.642) -- 0:02:01
      97000 -- (-577.600) (-584.748) (-583.115) [-579.937] * (-584.003) (-578.935) (-575.822) [-577.189] -- 0:02:01
      97500 -- (-575.573) [-575.943] (-582.780) (-588.254) * [-577.132] (-577.643) (-577.774) (-580.051) -- 0:02:09
      98000 -- (-576.681) [-577.575] (-580.910) (-577.531) * [-578.103] (-580.252) (-581.011) (-579.342) -- 0:02:08
      98500 -- [-578.835] (-577.135) (-581.049) (-582.801) * (-579.129) (-583.170) [-578.880] (-577.851) -- 0:02:08
      99000 -- (-590.105) (-578.797) (-575.501) [-583.672] * (-578.543) [-578.750] (-577.006) (-578.354) -- 0:02:07
      99500 -- [-581.107] (-582.779) (-581.112) (-581.029) * (-583.216) [-577.232] (-578.065) (-579.173) -- 0:02:06
      100000 -- [-576.082] (-578.675) (-584.016) (-583.358) * (-583.176) (-581.158) [-574.596] (-578.967) -- 0:02:05

      Average standard deviation of split frequencies: 0.019400

      100500 -- (-576.010) (-577.858) (-578.645) [-585.089] * (-583.923) (-579.300) (-576.899) [-581.224] -- 0:02:05
      101000 -- (-576.363) (-577.324) [-578.277] (-581.634) * (-583.623) (-579.595) [-584.744] (-581.330) -- 0:02:04
      101500 -- (-579.204) (-580.165) [-579.172] (-576.499) * (-589.700) [-579.366] (-580.829) (-586.315) -- 0:02:03
      102000 -- [-577.716] (-579.484) (-575.895) (-575.969) * (-586.818) (-579.621) [-577.604] (-586.619) -- 0:02:03
      102500 -- (-578.349) [-576.520] (-579.000) (-579.818) * (-583.855) [-576.491] (-585.791) (-583.840) -- 0:02:02
      103000 -- (-580.739) (-576.007) [-576.337] (-580.966) * (-581.453) [-584.387] (-577.554) (-581.723) -- 0:02:01
      103500 -- (-583.736) (-577.381) [-579.607] (-577.624) * [-580.868] (-583.001) (-575.446) (-581.297) -- 0:02:01
      104000 -- (-576.282) [-577.681] (-577.461) (-578.131) * [-581.180] (-579.288) (-578.351) (-581.387) -- 0:02:00
      104500 -- (-575.830) (-582.053) [-575.552] (-576.476) * (-579.708) (-581.801) (-583.012) [-580.735] -- 0:01:59
      105000 -- [-577.956] (-582.707) (-580.201) (-578.645) * [-583.798] (-580.103) (-582.440) (-585.944) -- 0:02:07

      Average standard deviation of split frequencies: 0.018345

      105500 -- (-581.011) [-573.239] (-586.650) (-580.225) * (-582.281) (-585.018) [-580.976] (-582.039) -- 0:02:07
      106000 -- (-576.085) [-574.312] (-586.250) (-587.139) * (-583.462) (-585.077) [-584.496] (-578.490) -- 0:02:06
      106500 -- [-576.130] (-577.971) (-582.773) (-578.948) * (-574.823) (-578.194) [-580.839] (-577.979) -- 0:02:05
      107000 -- [-575.298] (-576.559) (-581.402) (-578.661) * (-583.628) (-579.834) (-582.753) [-577.609] -- 0:02:05
      107500 -- (-581.449) [-577.518] (-581.390) (-588.935) * (-575.233) (-580.470) [-577.090] (-575.167) -- 0:02:04
      108000 -- (-581.769) [-576.869] (-585.849) (-588.644) * (-574.637) (-577.690) [-579.341] (-581.863) -- 0:02:03
      108500 -- (-577.384) (-578.967) [-576.961] (-579.536) * (-579.859) (-578.972) [-583.817] (-584.724) -- 0:02:03
      109000 -- (-575.383) (-576.611) (-577.912) [-572.490] * (-579.720) (-577.137) [-584.011] (-588.024) -- 0:02:02
      109500 -- (-576.873) (-582.070) [-580.052] (-577.390) * (-585.297) [-581.181] (-578.779) (-580.006) -- 0:02:01
      110000 -- [-582.038] (-583.629) (-581.928) (-580.265) * [-578.462] (-580.428) (-579.560) (-578.472) -- 0:02:01

      Average standard deviation of split frequencies: 0.015974

      110500 -- (-575.569) (-578.616) [-583.146] (-579.692) * (-583.136) [-577.159] (-576.802) (-578.557) -- 0:02:00
      111000 -- [-575.049] (-580.378) (-579.180) (-581.579) * (-578.283) [-575.494] (-577.506) (-577.333) -- 0:02:00
      111500 -- (-575.405) (-583.887) (-580.757) [-575.572] * (-580.218) (-585.434) (-576.835) [-574.402] -- 0:01:59
      112000 -- [-579.572] (-580.830) (-582.690) (-583.348) * (-581.373) (-577.821) (-577.526) [-578.240] -- 0:01:58
      112500 -- (-579.004) (-579.692) [-575.962] (-583.723) * (-588.611) (-584.915) (-576.830) [-576.682] -- 0:02:06
      113000 -- (-576.017) (-586.145) [-576.524] (-578.636) * (-580.792) [-577.050] (-581.063) (-583.442) -- 0:02:05
      113500 -- (-574.311) [-577.327] (-580.796) (-582.840) * [-580.870] (-581.230) (-582.050) (-589.600) -- 0:02:04
      114000 -- (-581.331) (-574.674) (-576.106) [-578.715] * (-580.622) (-580.465) (-578.789) [-583.481] -- 0:02:04
      114500 -- [-578.015] (-575.740) (-578.583) (-586.301) * (-582.247) (-582.091) [-578.372] (-588.748) -- 0:02:03
      115000 -- (-583.199) (-578.316) [-575.591] (-589.244) * (-579.817) (-582.630) (-577.692) [-580.687] -- 0:02:03

      Average standard deviation of split frequencies: 0.016763

      115500 -- (-578.885) [-573.823] (-578.425) (-584.822) * (-575.886) (-581.255) [-580.786] (-581.696) -- 0:02:02
      116000 -- (-584.524) (-574.570) [-581.417] (-582.469) * (-577.793) (-580.293) [-582.304] (-577.973) -- 0:02:01
      116500 -- (-584.038) [-578.972] (-578.598) (-587.103) * (-579.544) [-579.619] (-585.610) (-575.296) -- 0:02:01
      117000 -- (-579.690) [-582.523] (-580.444) (-582.108) * [-579.301] (-581.467) (-580.004) (-581.058) -- 0:02:00
      117500 -- (-582.164) [-583.134] (-578.154) (-581.269) * (-582.018) (-584.495) (-587.404) [-577.543] -- 0:02:00
      118000 -- [-577.370] (-575.480) (-581.658) (-576.812) * (-581.504) (-585.967) (-583.171) [-577.735] -- 0:01:59
      118500 -- [-575.383] (-580.081) (-579.313) (-588.022) * (-581.654) (-581.326) (-581.782) [-576.279] -- 0:01:59
      119000 -- (-577.758) [-577.315] (-581.278) (-582.733) * (-583.072) (-580.126) (-579.345) [-578.926] -- 0:01:58
      119500 -- [-590.381] (-577.357) (-580.452) (-576.697) * [-580.282] (-578.267) (-587.205) (-586.747) -- 0:02:05
      120000 -- (-589.067) (-575.979) (-580.097) [-581.706] * [-576.025] (-575.824) (-583.024) (-574.536) -- 0:02:04

      Average standard deviation of split frequencies: 0.018068

      120500 -- (-587.145) (-580.313) [-580.722] (-583.281) * (-576.926) [-574.687] (-585.891) (-577.365) -- 0:02:04
      121000 -- (-582.130) (-578.094) [-583.511] (-576.334) * (-581.197) (-582.606) (-578.132) [-572.963] -- 0:02:03
      121500 -- (-580.014) (-578.537) (-580.157) [-575.598] * (-587.221) (-579.572) (-588.895) [-575.227] -- 0:02:02
      122000 -- (-578.516) (-580.814) (-587.029) [-576.538] * (-574.406) (-586.348) (-574.148) [-581.619] -- 0:02:02
      122500 -- (-574.653) [-577.067] (-580.563) (-579.250) * [-579.415] (-582.189) (-575.265) (-578.498) -- 0:02:01
      123000 -- (-578.987) (-582.502) [-579.880] (-580.961) * (-582.614) (-585.886) (-577.088) [-575.944] -- 0:02:01
      123500 -- (-579.547) (-579.641) (-582.612) [-575.679] * (-577.430) (-590.221) [-576.244] (-579.933) -- 0:02:00
      124000 -- (-579.753) (-581.696) (-585.065) [-578.360] * (-585.525) (-590.987) [-581.093] (-582.527) -- 0:02:00
      124500 -- [-580.777] (-577.086) (-576.808) (-579.062) * (-575.926) (-586.715) [-579.312] (-579.153) -- 0:01:59
      125000 -- (-578.311) (-575.149) [-574.258] (-574.840) * (-580.052) (-586.224) [-576.949] (-574.315) -- 0:01:59

      Average standard deviation of split frequencies: 0.017304

      125500 -- (-575.744) [-576.702] (-577.076) (-577.680) * (-581.124) (-581.792) (-577.204) [-575.789] -- 0:01:58
      126000 -- (-581.526) (-577.588) [-573.418] (-577.940) * (-578.206) (-585.740) (-581.454) [-580.103] -- 0:01:57
      126500 -- [-575.577] (-582.321) (-577.441) (-579.233) * [-575.955] (-584.285) (-576.041) (-583.679) -- 0:01:57
      127000 -- (-581.051) [-581.302] (-585.137) (-586.300) * (-579.504) (-583.385) [-574.127] (-579.743) -- 0:02:03
      127500 -- (-580.362) (-576.568) (-575.289) [-578.656] * (-577.969) (-583.921) [-577.683] (-576.041) -- 0:02:03
      128000 -- [-574.874] (-578.746) (-576.437) (-577.842) * [-579.363] (-578.396) (-582.352) (-580.710) -- 0:02:02
      128500 -- (-579.196) (-576.297) (-578.895) [-576.120] * (-574.677) (-581.492) (-584.640) [-580.704] -- 0:02:02
      129000 -- (-581.704) [-580.611] (-577.218) (-582.392) * (-579.599) (-578.252) (-581.677) [-578.651] -- 0:02:01
      129500 -- (-576.380) (-579.263) (-577.705) [-576.023] * (-584.868) [-586.936] (-578.189) (-579.612) -- 0:02:00
      130000 -- [-577.539] (-578.389) (-579.735) (-575.923) * (-578.315) (-585.498) [-582.828] (-581.732) -- 0:02:00

      Average standard deviation of split frequencies: 0.015784

      130500 -- (-580.944) (-579.812) (-577.400) [-575.885] * (-578.936) (-585.183) (-576.193) [-580.488] -- 0:01:59
      131000 -- (-579.649) (-587.330) (-575.863) [-581.064] * [-575.059] (-579.596) (-580.168) (-579.471) -- 0:01:59
      131500 -- (-584.964) [-583.776] (-576.251) (-583.109) * [-574.181] (-584.204) (-589.110) (-589.589) -- 0:01:58
      132000 -- (-580.010) (-582.109) [-577.892] (-580.463) * (-575.344) (-589.486) (-583.427) [-579.412] -- 0:01:58
      132500 -- (-587.649) (-578.741) [-576.971] (-578.029) * (-580.602) [-584.021] (-579.858) (-577.468) -- 0:01:57
      133000 -- [-581.172] (-579.809) (-579.095) (-579.380) * (-581.548) [-584.181] (-585.407) (-577.035) -- 0:01:57
      133500 -- (-583.758) (-579.219) [-589.941] (-579.335) * (-579.273) (-589.558) [-577.023] (-580.890) -- 0:01:56
      134000 -- (-583.410) [-578.615] (-576.428) (-585.101) * (-580.000) (-592.876) (-585.576) [-578.245] -- 0:01:56
      134500 -- (-584.880) (-578.344) [-578.228] (-588.329) * [-574.613] (-580.346) (-576.611) (-580.934) -- 0:02:02
      135000 -- (-575.874) (-583.810) (-576.500) [-582.392] * [-580.565] (-580.995) (-575.342) (-580.479) -- 0:02:01

      Average standard deviation of split frequencies: 0.015165

      135500 -- [-574.742] (-581.907) (-577.906) (-585.803) * [-582.340] (-576.839) (-576.737) (-576.079) -- 0:02:01
      136000 -- (-578.650) [-577.612] (-583.453) (-588.817) * (-579.678) (-579.247) (-577.894) [-578.821] -- 0:02:00
      136500 -- (-579.085) (-580.832) [-578.336] (-584.402) * (-572.960) (-577.120) [-576.222] (-587.334) -- 0:02:00
      137000 -- (-577.604) (-576.060) (-585.559) [-577.994] * [-576.577] (-583.749) (-577.612) (-589.896) -- 0:01:59
      137500 -- (-579.154) [-579.824] (-586.520) (-587.599) * [-575.486] (-582.281) (-582.667) (-583.626) -- 0:01:59
      138000 -- [-574.006] (-577.709) (-578.169) (-580.865) * (-581.525) [-577.251] (-580.435) (-581.067) -- 0:01:58
      138500 -- (-584.061) (-574.940) [-579.635] (-580.534) * (-580.574) (-580.454) [-577.065] (-581.602) -- 0:01:58
      139000 -- (-582.468) [-577.573] (-583.405) (-589.030) * (-582.684) (-583.572) (-580.090) [-579.804] -- 0:01:57
      139500 -- (-579.393) (-578.081) (-581.041) [-582.731] * (-587.563) (-577.060) [-577.797] (-581.651) -- 0:01:57
      140000 -- (-579.473) (-584.241) [-581.997] (-585.459) * (-578.941) [-579.210] (-581.105) (-586.344) -- 0:01:56

      Average standard deviation of split frequencies: 0.015918

      140500 -- [-581.879] (-576.192) (-587.476) (-593.446) * (-580.348) [-582.866] (-584.018) (-583.624) -- 0:01:56
      141000 -- (-580.256) (-577.688) (-585.780) [-586.816] * (-574.483) (-584.774) (-584.105) [-575.801] -- 0:01:55
      141500 -- (-586.439) [-578.077] (-578.339) (-588.099) * (-576.459) (-582.148) [-580.320] (-581.293) -- 0:01:55
      142000 -- (-586.631) (-584.376) [-576.436] (-587.415) * [-573.652] (-580.331) (-579.066) (-580.603) -- 0:02:00
      142500 -- [-576.726] (-580.293) (-580.551) (-584.755) * (-580.656) [-577.705] (-578.673) (-579.468) -- 0:02:00
      143000 -- (-576.329) (-580.173) [-581.386] (-582.937) * (-579.388) (-585.115) [-580.141] (-578.594) -- 0:01:59
      143500 -- [-576.707] (-582.315) (-578.044) (-580.337) * (-581.239) (-581.608) (-581.266) [-584.260] -- 0:01:59
      144000 -- (-579.965) [-582.132] (-584.783) (-577.918) * (-579.368) (-580.033) (-588.069) [-587.239] -- 0:01:58
      144500 -- (-578.229) [-574.789] (-583.194) (-578.080) * [-576.739] (-581.476) (-577.063) (-583.983) -- 0:01:58
      145000 -- (-582.708) [-576.571] (-577.951) (-586.900) * [-574.617] (-578.065) (-576.327) (-583.425) -- 0:01:57

      Average standard deviation of split frequencies: 0.015337

      145500 -- (-579.774) (-584.230) [-577.707] (-585.559) * [-574.964] (-581.152) (-578.813) (-584.884) -- 0:01:57
      146000 -- [-581.859] (-578.168) (-583.903) (-584.362) * (-575.474) [-576.049] (-578.437) (-583.306) -- 0:01:56
      146500 -- (-581.519) (-582.678) (-585.557) [-585.690] * (-580.688) (-574.462) [-579.146] (-583.945) -- 0:01:56
      147000 -- [-575.004] (-574.676) (-578.680) (-587.476) * (-583.486) [-578.239] (-583.653) (-579.670) -- 0:01:56
      147500 -- (-575.655) (-580.566) [-574.096] (-589.028) * (-581.148) (-576.351) [-582.182] (-585.162) -- 0:01:55
      148000 -- (-581.973) [-579.064] (-582.043) (-592.727) * (-586.589) (-580.846) [-576.763] (-593.051) -- 0:01:55
      148500 -- (-579.664) [-575.484] (-582.342) (-585.418) * (-576.330) (-581.169) [-579.665] (-580.753) -- 0:01:54
      149000 -- [-575.641] (-576.968) (-577.608) (-587.885) * (-581.118) [-577.614] (-583.150) (-577.019) -- 0:01:59
      149500 -- (-578.257) [-580.826] (-580.075) (-582.298) * (-577.327) (-579.351) (-576.967) [-577.020] -- 0:01:59
      150000 -- [-581.314] (-583.771) (-579.463) (-590.200) * (-581.025) (-580.427) (-582.073) [-585.282] -- 0:01:58

      Average standard deviation of split frequencies: 0.015644

      150500 -- (-582.096) (-579.818) (-583.580) [-581.012] * (-585.091) (-584.545) [-581.209] (-574.844) -- 0:01:58
      151000 -- (-580.312) (-582.080) (-580.901) [-578.599] * (-580.446) (-582.107) (-575.574) [-576.617] -- 0:01:58
      151500 -- [-576.873] (-579.808) (-579.302) (-583.796) * (-577.966) (-580.289) (-580.928) [-576.867] -- 0:01:57
      152000 -- (-580.213) [-578.901] (-575.686) (-586.916) * (-581.537) [-580.236] (-579.917) (-579.171) -- 0:01:57
      152500 -- [-579.008] (-585.231) (-579.458) (-579.712) * (-583.450) (-578.602) [-578.561] (-575.393) -- 0:01:56
      153000 -- (-578.752) (-581.311) (-574.856) [-577.286] * [-580.679] (-578.186) (-579.311) (-577.521) -- 0:01:56
      153500 -- (-581.374) (-580.580) (-574.480) [-575.799] * [-577.827] (-576.587) (-578.114) (-575.139) -- 0:01:55
      154000 -- (-577.576) (-586.833) [-575.482] (-577.299) * (-578.289) (-578.667) (-577.284) [-578.794] -- 0:01:55
      154500 -- (-577.775) (-587.687) [-575.170] (-581.910) * (-580.927) (-581.693) (-580.813) [-572.265] -- 0:01:54
      155000 -- [-581.492] (-592.714) (-581.349) (-584.920) * (-582.453) (-581.179) [-574.527] (-578.820) -- 0:01:54

      Average standard deviation of split frequencies: 0.018131

      155500 -- (-580.657) (-592.658) (-583.829) [-583.613] * (-581.658) (-581.492) [-576.842] (-577.915) -- 0:01:54
      156000 -- (-580.927) (-593.457) [-580.287] (-579.340) * (-583.677) (-587.973) (-584.797) [-576.051] -- 0:01:53
      156500 -- (-580.644) (-585.787) (-585.985) [-580.373] * (-577.444) (-579.609) (-582.427) [-578.221] -- 0:01:58
      157000 -- [-576.887] (-579.666) (-586.040) (-575.920) * (-582.022) (-578.047) (-581.681) [-578.235] -- 0:01:58
      157500 -- (-578.800) (-580.695) [-589.948] (-578.886) * (-577.605) [-577.476] (-579.969) (-584.170) -- 0:01:57
      158000 -- (-585.424) (-583.406) (-584.174) [-576.863] * [-578.204] (-579.910) (-582.084) (-583.718) -- 0:01:57
      158500 -- [-579.954] (-576.356) (-594.637) (-574.837) * (-578.808) [-577.858] (-587.952) (-588.696) -- 0:01:56
      159000 -- [-580.377] (-580.399) (-585.878) (-579.008) * [-577.427] (-577.549) (-585.019) (-587.703) -- 0:01:56
      159500 -- (-580.196) (-579.939) (-583.240) [-580.875] * (-576.670) [-581.299] (-581.433) (-582.879) -- 0:01:55
      160000 -- (-579.622) (-580.165) (-580.032) [-578.140] * [-578.967] (-585.183) (-582.216) (-574.502) -- 0:01:55

      Average standard deviation of split frequencies: 0.016504

      160500 -- (-583.673) (-579.882) (-591.573) [-579.775] * (-577.795) (-581.896) (-575.907) [-576.560] -- 0:01:55
      161000 -- [-577.036] (-581.210) (-578.460) (-582.632) * [-577.186] (-587.410) (-579.313) (-580.032) -- 0:01:54
      161500 -- (-583.817) (-581.831) (-585.805) [-576.166] * (-582.405) [-577.961] (-580.370) (-575.270) -- 0:01:54
      162000 -- (-579.677) (-580.980) [-578.815] (-577.526) * (-583.833) (-576.201) (-580.820) [-580.353] -- 0:01:53
      162500 -- (-581.106) [-575.969] (-579.241) (-578.560) * [-573.047] (-578.687) (-577.795) (-582.703) -- 0:01:53
      163000 -- (-580.032) [-579.012] (-583.490) (-581.225) * [-576.753] (-579.430) (-579.989) (-579.029) -- 0:01:52
      163500 -- (-577.784) [-577.974] (-585.565) (-577.358) * (-575.075) [-576.799] (-579.322) (-573.362) -- 0:01:57
      164000 -- (-582.623) (-577.752) [-581.431] (-587.352) * (-585.548) (-578.603) (-579.737) [-578.212] -- 0:01:57
      164500 -- (-580.003) (-575.920) (-577.499) [-581.554] * (-578.360) (-574.865) (-580.789) [-577.926] -- 0:01:56
      165000 -- (-579.853) (-575.518) [-580.945] (-583.204) * [-581.564] (-579.249) (-582.723) (-576.768) -- 0:01:56

      Average standard deviation of split frequencies: 0.016329

      165500 -- (-580.815) [-576.578] (-578.975) (-581.867) * (-577.408) [-576.105] (-588.716) (-584.749) -- 0:01:55
      166000 -- (-583.545) (-575.833) (-583.772) [-579.954] * (-582.554) [-579.249] (-583.367) (-580.448) -- 0:01:55
      166500 -- [-577.616] (-580.235) (-575.286) (-586.088) * (-578.345) (-580.928) [-579.582] (-579.154) -- 0:01:55
      167000 -- (-577.836) [-578.909] (-582.757) (-586.650) * [-579.707] (-581.272) (-576.157) (-573.798) -- 0:01:54
      167500 -- (-576.860) (-580.660) (-577.183) [-587.651] * (-581.868) [-574.732] (-579.737) (-580.173) -- 0:01:54
      168000 -- (-581.973) (-584.329) [-581.054] (-584.063) * (-580.868) (-578.651) [-574.369] (-583.367) -- 0:01:53
      168500 -- (-579.144) (-581.608) [-579.236] (-585.048) * (-585.576) (-581.515) [-575.085] (-576.989) -- 0:01:53
      169000 -- [-580.888] (-578.502) (-578.469) (-580.307) * (-579.271) [-580.438] (-578.381) (-574.784) -- 0:01:53
      169500 -- (-579.121) (-582.202) (-581.573) [-577.685] * [-573.700] (-575.188) (-576.846) (-577.193) -- 0:01:52
      170000 -- (-578.568) [-576.902] (-578.821) (-592.007) * [-578.628] (-577.299) (-583.370) (-576.970) -- 0:01:52

      Average standard deviation of split frequencies: 0.015882

      170500 -- (-582.510) (-582.073) [-578.710] (-577.656) * (-583.092) [-585.280] (-573.142) (-577.010) -- 0:01:51
      171000 -- (-582.245) [-583.045] (-576.658) (-585.504) * (-576.143) [-578.509] (-574.267) (-583.760) -- 0:01:56
      171500 -- [-581.154] (-578.117) (-577.618) (-582.723) * (-581.069) [-579.544] (-575.749) (-583.144) -- 0:01:55
      172000 -- (-579.513) [-582.550] (-581.207) (-581.720) * (-584.228) [-576.307] (-575.798) (-579.659) -- 0:01:55
      172500 -- (-573.752) [-575.561] (-578.208) (-580.147) * (-586.532) (-579.309) [-575.228] (-581.658) -- 0:01:55
      173000 -- (-582.407) (-576.128) (-578.732) [-575.959] * (-587.790) [-577.384] (-576.021) (-581.748) -- 0:01:54
      173500 -- [-577.547] (-579.081) (-576.669) (-585.284) * [-579.668] (-581.298) (-578.331) (-581.909) -- 0:01:54
      174000 -- (-577.688) (-576.884) (-578.362) [-586.964] * (-579.943) (-576.012) (-574.246) [-583.343] -- 0:01:53
      174500 -- [-580.881] (-575.305) (-576.735) (-582.197) * (-581.114) [-576.999] (-579.361) (-584.016) -- 0:01:53
      175000 -- (-578.580) [-575.883] (-584.571) (-579.765) * (-581.636) (-578.731) (-581.337) [-579.113] -- 0:01:53

      Average standard deviation of split frequencies: 0.015401

      175500 -- (-582.331) (-577.874) [-579.858] (-580.921) * (-586.785) (-576.272) [-577.350] (-582.591) -- 0:01:52
      176000 -- (-578.515) (-580.072) (-578.052) [-576.261] * (-584.333) [-576.704] (-581.773) (-575.813) -- 0:01:52
      176500 -- [-583.302] (-579.319) (-586.063) (-579.175) * [-578.775] (-580.298) (-576.548) (-580.040) -- 0:01:51
      177000 -- (-585.244) (-577.385) (-579.569) [-580.095] * [-581.132] (-583.584) (-578.902) (-583.550) -- 0:01:51
      177500 -- (-577.834) (-574.343) (-578.010) [-579.726] * (-579.684) (-577.268) [-577.115] (-575.299) -- 0:01:51
      178000 -- (-580.735) [-576.637] (-582.448) (-578.700) * (-574.619) (-573.814) [-576.179] (-583.030) -- 0:01:50
      178500 -- [-577.647] (-584.007) (-580.181) (-579.235) * [-574.585] (-576.671) (-581.137) (-578.612) -- 0:01:55
      179000 -- [-581.715] (-577.908) (-580.892) (-579.309) * [-577.994] (-573.966) (-590.050) (-581.420) -- 0:01:54
      179500 -- (-587.692) (-581.133) (-578.354) [-582.291] * (-582.556) (-581.671) [-583.974] (-584.626) -- 0:01:54
      180000 -- (-586.117) [-575.200] (-581.985) (-580.517) * (-581.578) (-587.016) (-579.394) [-582.159] -- 0:01:53

      Average standard deviation of split frequencies: 0.016401

      180500 -- (-575.304) [-578.773] (-581.360) (-580.993) * (-585.598) (-583.271) [-579.486] (-579.092) -- 0:01:53
      181000 -- (-578.266) (-575.641) [-577.451] (-584.982) * [-578.459] (-582.548) (-574.012) (-581.030) -- 0:01:53
      181500 -- (-581.857) (-576.196) [-574.749] (-580.357) * (-589.670) (-580.099) [-577.168] (-581.827) -- 0:01:52
      182000 -- (-578.685) [-575.130] (-583.474) (-588.176) * (-593.962) (-581.135) [-576.232] (-578.152) -- 0:01:52
      182500 -- [-582.245] (-575.620) (-578.983) (-585.555) * [-584.487] (-579.985) (-577.670) (-583.625) -- 0:01:51
      183000 -- (-590.848) (-579.916) [-575.821] (-588.201) * (-581.419) (-576.431) [-577.317] (-581.640) -- 0:01:51
      183500 -- (-582.250) (-578.037) (-574.731) [-588.222] * (-583.132) [-580.343] (-575.732) (-578.475) -- 0:01:51
      184000 -- (-580.692) (-577.769) (-580.756) [-584.581] * (-582.066) (-577.550) (-575.050) [-578.997] -- 0:01:50
      184500 -- (-588.304) (-578.086) (-577.112) [-576.503] * (-584.127) (-580.792) (-578.920) [-578.453] -- 0:01:50
      185000 -- (-583.191) [-575.502] (-589.346) (-580.625) * (-583.123) (-578.572) [-577.375] (-581.613) -- 0:01:50

      Average standard deviation of split frequencies: 0.015523

      185500 -- (-590.078) (-585.658) (-580.090) [-581.313] * (-579.927) [-573.649] (-577.481) (-575.464) -- 0:01:54
      186000 -- (-586.398) (-583.477) (-580.896) [-581.852] * (-578.813) (-588.078) (-578.741) [-575.727] -- 0:01:53
      186500 -- [-580.500] (-587.518) (-579.941) (-581.079) * [-581.090] (-580.299) (-577.506) (-577.779) -- 0:01:53
      187000 -- (-577.406) [-576.708] (-574.942) (-578.556) * [-576.552] (-581.533) (-581.817) (-579.922) -- 0:01:53
      187500 -- (-579.575) [-578.703] (-577.890) (-581.066) * (-577.023) (-579.905) (-583.731) [-575.379] -- 0:01:52
      188000 -- (-576.585) (-583.586) [-578.479] (-582.878) * (-580.214) (-581.429) [-583.403] (-582.987) -- 0:01:52
      188500 -- [-577.985] (-587.114) (-578.175) (-583.675) * (-579.289) (-578.628) (-582.358) [-577.309] -- 0:01:51
      189000 -- (-578.035) [-581.858] (-581.171) (-583.612) * (-581.404) (-583.728) (-578.464) [-580.016] -- 0:01:51
      189500 -- [-574.952] (-587.945) (-580.560) (-575.836) * (-580.374) (-579.043) (-573.778) [-578.279] -- 0:01:51
      190000 -- (-582.492) (-589.311) [-573.913] (-577.036) * [-577.238] (-576.438) (-581.287) (-578.925) -- 0:01:50

      Average standard deviation of split frequencies: 0.015894

      190500 -- [-580.757] (-581.409) (-580.536) (-577.481) * (-590.210) (-581.284) (-579.647) [-577.949] -- 0:01:50
      191000 -- (-578.269) [-581.213] (-579.539) (-583.084) * (-580.845) (-582.383) (-576.930) [-577.332] -- 0:01:50
      191500 -- (-578.546) (-585.980) [-579.123] (-582.128) * [-583.493] (-576.352) (-580.060) (-575.428) -- 0:01:49
      192000 -- (-579.745) (-576.975) (-578.077) [-577.124] * [-575.379] (-578.849) (-583.340) (-585.324) -- 0:01:49
      192500 -- (-580.847) (-577.074) (-582.666) [-579.298] * [-578.839] (-577.485) (-580.148) (-582.215) -- 0:01:49
      193000 -- [-575.870] (-574.515) (-580.542) (-579.101) * [-585.091] (-581.199) (-586.814) (-594.525) -- 0:01:52
      193500 -- (-579.413) [-582.808] (-583.116) (-581.940) * (-577.169) (-586.141) (-586.447) [-588.433] -- 0:01:52
      194000 -- [-576.277] (-581.555) (-583.060) (-581.239) * [-579.956] (-579.210) (-580.147) (-586.837) -- 0:01:52
      194500 -- (-585.042) (-577.880) [-578.911] (-576.614) * (-584.220) [-577.577] (-580.677) (-579.552) -- 0:01:51
      195000 -- (-586.019) [-579.387] (-577.959) (-585.073) * [-585.647] (-573.732) (-575.369) (-580.978) -- 0:01:51

      Average standard deviation of split frequencies: 0.015032

      195500 -- (-583.995) (-579.144) [-578.128] (-585.027) * [-580.853] (-580.729) (-583.062) (-576.766) -- 0:01:51
      196000 -- (-582.607) (-579.548) (-576.913) [-576.780] * (-578.656) (-577.199) [-583.442] (-582.144) -- 0:01:50
      196500 -- (-576.787) (-594.832) [-574.112] (-581.679) * (-588.445) [-580.863] (-587.762) (-582.237) -- 0:01:50
      197000 -- (-581.430) (-590.091) (-579.078) [-579.097] * [-585.301] (-584.484) (-589.495) (-581.331) -- 0:01:50
      197500 -- (-583.677) (-579.419) (-576.040) [-575.427] * [-576.443] (-583.489) (-583.229) (-579.603) -- 0:01:49
      198000 -- (-584.771) (-590.488) [-582.121] (-577.800) * (-575.193) (-582.172) [-577.245] (-579.206) -- 0:01:49
      198500 -- (-577.981) (-578.025) [-580.326] (-579.557) * (-573.775) [-578.902] (-585.478) (-590.166) -- 0:01:49
      199000 -- (-576.003) [-576.567] (-581.743) (-578.396) * (-576.476) (-581.319) (-582.005) [-578.415] -- 0:01:48
      199500 -- (-574.839) [-583.984] (-579.336) (-574.394) * (-578.966) (-578.050) (-579.909) [-575.323] -- 0:01:48
      200000 -- (-581.232) (-581.068) (-581.271) [-576.149] * (-583.200) (-583.983) (-579.380) [-578.064] -- 0:01:48

      Average standard deviation of split frequencies: 0.018122

      200500 -- (-577.228) (-575.845) (-582.746) [-575.426] * (-576.700) (-578.466) (-581.238) [-579.276] -- 0:01:51
      201000 -- (-577.830) (-574.933) (-579.769) [-575.065] * [-579.094] (-576.635) (-581.896) (-577.307) -- 0:01:51
      201500 -- [-575.510] (-578.809) (-577.002) (-576.120) * (-591.169) (-577.647) (-578.497) [-581.286] -- 0:01:50
      202000 -- [-576.820] (-577.350) (-575.593) (-588.141) * (-581.196) (-581.948) (-579.695) [-581.273] -- 0:01:50
      202500 -- (-575.121) [-573.487] (-576.472) (-579.595) * [-582.350] (-573.772) (-578.694) (-580.109) -- 0:01:50
      203000 -- (-577.684) [-573.473] (-578.556) (-581.714) * [-582.331] (-579.467) (-575.035) (-581.991) -- 0:01:49
      203500 -- (-575.887) [-585.438] (-586.239) (-576.885) * (-580.723) (-580.918) (-580.439) [-576.755] -- 0:01:49
      204000 -- [-581.894] (-580.049) (-576.929) (-582.498) * [-579.386] (-576.376) (-576.989) (-578.767) -- 0:01:49
      204500 -- (-579.283) (-581.679) (-582.721) [-584.235] * (-579.512) [-577.699] (-577.557) (-578.730) -- 0:01:48
      205000 -- (-578.456) [-578.315] (-592.395) (-579.379) * (-582.039) (-578.200) [-577.859] (-584.336) -- 0:01:48

      Average standard deviation of split frequencies: 0.018307

      205500 -- (-575.311) [-580.325] (-582.784) (-579.557) * (-582.246) (-577.504) [-576.627] (-580.013) -- 0:01:48
      206000 -- (-584.104) [-577.691] (-575.953) (-588.919) * (-584.817) [-580.400] (-586.205) (-578.612) -- 0:01:47
      206500 -- (-579.785) (-577.135) (-579.735) [-576.260] * (-581.666) [-575.107] (-579.530) (-586.003) -- 0:01:47
      207000 -- (-581.101) (-579.192) (-579.940) [-582.235] * (-582.230) (-579.717) [-576.668] (-585.379) -- 0:01:47
      207500 -- (-580.672) (-579.116) [-579.425] (-580.891) * (-578.616) [-578.995] (-576.471) (-582.841) -- 0:01:50
      208000 -- [-579.209] (-583.427) (-581.787) (-577.825) * (-581.115) (-586.539) [-576.527] (-587.280) -- 0:01:50
      208500 -- (-577.835) (-578.305) [-575.199] (-577.176) * [-584.878] (-581.576) (-578.065) (-584.631) -- 0:01:50
      209000 -- (-577.583) [-577.026] (-584.539) (-577.201) * (-577.906) (-581.715) (-584.134) [-578.087] -- 0:01:49
      209500 -- (-576.447) (-576.687) (-578.051) [-579.008] * (-583.849) [-590.466] (-577.381) (-577.824) -- 0:01:49
      210000 -- (-579.767) (-585.743) [-579.244] (-580.912) * [-576.508] (-584.263) (-576.034) (-585.793) -- 0:01:49

      Average standard deviation of split frequencies: 0.018181

      210500 -- (-578.846) (-575.760) [-580.983] (-577.399) * (-578.725) (-579.174) [-583.046] (-578.296) -- 0:01:48
      211000 -- [-579.789] (-583.389) (-582.086) (-580.039) * (-573.829) [-580.960] (-582.649) (-578.232) -- 0:01:48
      211500 -- (-581.891) (-582.889) (-577.247) [-575.847] * (-584.220) (-583.031) (-582.585) [-579.811] -- 0:01:48
      212000 -- (-579.159) [-581.915] (-576.351) (-581.944) * [-578.803] (-581.945) (-577.049) (-577.629) -- 0:01:47
      212500 -- (-580.512) (-575.672) (-580.626) [-574.459] * (-578.008) (-581.568) [-575.237] (-579.648) -- 0:01:47
      213000 -- (-577.476) (-576.048) [-579.668] (-581.814) * [-574.972] (-578.863) (-579.445) (-579.806) -- 0:01:47
      213500 -- [-577.709] (-583.064) (-579.026) (-581.726) * (-578.567) (-579.902) [-575.573] (-578.529) -- 0:01:46
      214000 -- (-588.079) (-580.099) (-582.947) [-577.600] * (-576.184) (-577.400) [-575.641] (-578.814) -- 0:01:46
      214500 -- (-574.488) [-577.403] (-579.952) (-574.619) * [-576.557] (-577.431) (-576.791) (-579.872) -- 0:01:46
      215000 -- (-574.425) (-579.755) (-577.775) [-578.131] * (-585.336) [-578.349] (-578.972) (-582.454) -- 0:01:49

      Average standard deviation of split frequencies: 0.017148

      215500 -- (-582.686) (-580.277) (-578.645) [-586.738] * (-579.620) (-576.164) [-574.153] (-586.322) -- 0:01:49
      216000 -- [-577.048] (-578.999) (-576.292) (-586.192) * (-579.442) [-574.302] (-576.401) (-591.025) -- 0:01:48
      216500 -- (-577.967) (-578.790) (-578.212) [-577.380] * (-580.031) [-579.903] (-580.819) (-580.454) -- 0:01:48
      217000 -- (-575.204) (-577.117) [-574.018] (-576.978) * [-581.060] (-579.000) (-579.892) (-578.759) -- 0:01:48
      217500 -- (-576.792) (-576.484) [-574.992] (-579.363) * (-579.886) (-575.552) [-586.770] (-584.971) -- 0:01:47
      218000 -- (-574.711) (-578.396) (-578.428) [-579.513] * [-578.832] (-576.549) (-579.060) (-581.888) -- 0:01:47
      218500 -- (-578.865) (-576.445) [-576.893] (-582.665) * (-587.071) (-577.944) [-578.238] (-580.711) -- 0:01:47
      219000 -- (-574.864) [-581.209] (-586.489) (-574.658) * (-582.728) (-575.571) [-580.697] (-575.562) -- 0:01:46
      219500 -- (-578.761) [-582.036] (-578.366) (-579.557) * (-579.968) (-575.731) (-579.727) [-579.038] -- 0:01:46
      220000 -- (-574.990) [-583.325] (-581.380) (-579.785) * (-577.839) (-582.854) (-583.440) [-585.182] -- 0:01:46

      Average standard deviation of split frequencies: 0.019532

      220500 -- (-578.014) (-587.994) (-578.684) [-577.881] * (-580.326) (-587.032) [-579.668] (-579.105) -- 0:01:46
      221000 -- (-578.693) [-582.940] (-581.087) (-584.905) * (-578.541) (-577.571) (-585.785) [-577.381] -- 0:01:45
      221500 -- (-585.318) (-586.923) (-578.915) [-576.966] * (-584.084) (-585.734) [-580.622] (-584.453) -- 0:01:45
      222000 -- (-575.983) (-577.815) [-580.885] (-578.211) * [-577.193] (-582.972) (-578.441) (-583.612) -- 0:01:45
      222500 -- [-576.870] (-579.114) (-583.303) (-582.369) * (-579.271) [-578.926] (-579.450) (-581.899) -- 0:01:48
      223000 -- (-578.729) (-578.029) (-584.071) [-579.757] * (-586.291) (-577.692) [-578.429] (-579.824) -- 0:01:48
      223500 -- (-581.273) [-582.170] (-576.456) (-578.124) * (-582.978) (-581.054) [-577.403] (-584.705) -- 0:01:47
      224000 -- (-578.087) [-582.919] (-579.449) (-588.158) * (-585.764) (-578.211) [-579.322] (-585.747) -- 0:01:47
      224500 -- [-577.796] (-584.300) (-576.688) (-579.826) * (-583.369) [-577.172] (-580.880) (-585.862) -- 0:01:47
      225000 -- (-582.906) (-577.346) (-577.450) [-576.536] * (-581.444) (-578.440) [-582.004] (-588.096) -- 0:01:46

      Average standard deviation of split frequencies: 0.018177

      225500 -- (-576.796) (-579.063) [-581.716] (-576.380) * (-580.868) (-578.700) (-583.453) [-578.129] -- 0:01:46
      226000 -- [-578.978] (-582.218) (-582.736) (-573.054) * (-587.096) [-579.001] (-579.482) (-583.133) -- 0:01:46
      226500 -- (-578.282) [-579.631] (-578.817) (-575.043) * (-585.931) (-580.065) (-576.219) [-584.140] -- 0:01:45
      227000 -- [-575.691] (-579.574) (-579.569) (-574.556) * (-585.471) (-578.324) [-582.794] (-587.081) -- 0:01:45
      227500 -- (-582.639) (-580.106) [-582.449] (-578.614) * (-589.263) [-575.922] (-587.544) (-587.315) -- 0:01:45
      228000 -- (-587.433) (-579.031) [-577.142] (-580.368) * (-589.044) [-582.786] (-582.484) (-592.474) -- 0:01:44
      228500 -- (-579.527) [-578.407] (-574.110) (-574.792) * (-584.811) [-577.221] (-579.515) (-588.703) -- 0:01:44
      229000 -- (-581.116) [-578.162] (-578.489) (-580.189) * (-577.994) [-583.378] (-585.284) (-584.670) -- 0:01:44
      229500 -- [-582.221] (-578.272) (-582.475) (-581.006) * (-580.946) (-585.858) (-577.360) [-584.801] -- 0:01:47
      230000 -- (-581.107) (-576.649) [-579.919] (-578.359) * [-579.138] (-579.504) (-575.733) (-584.471) -- 0:01:47

      Average standard deviation of split frequencies: 0.015765

      230500 -- (-578.184) (-579.714) (-578.178) [-577.845] * (-585.984) (-579.570) [-576.956] (-581.877) -- 0:01:46
      231000 -- (-586.649) (-582.715) (-579.831) [-573.939] * (-579.287) [-577.526] (-581.241) (-593.194) -- 0:01:46
      231500 -- (-580.472) (-581.583) [-578.235] (-579.709) * [-574.627] (-577.971) (-581.556) (-590.852) -- 0:01:46
      232000 -- (-578.530) [-583.839] (-579.511) (-576.717) * (-578.225) [-574.913] (-577.403) (-590.630) -- 0:01:45
      232500 -- (-583.290) (-580.057) (-586.425) [-575.669] * (-575.181) [-574.688] (-579.208) (-584.984) -- 0:01:45
      233000 -- [-576.936] (-581.628) (-584.716) (-584.317) * (-575.207) (-575.199) (-579.608) [-582.020] -- 0:01:45
      233500 -- (-586.594) [-577.386] (-581.120) (-575.928) * (-576.707) [-576.160] (-580.566) (-581.549) -- 0:01:45
      234000 -- (-576.806) [-574.672] (-577.722) (-576.081) * [-580.612] (-576.764) (-583.918) (-585.720) -- 0:01:44
      234500 -- (-574.655) (-581.314) [-577.677] (-579.796) * [-573.256] (-579.667) (-583.461) (-589.071) -- 0:01:44
      235000 -- [-578.625] (-579.411) (-579.432) (-581.958) * (-582.050) [-576.750] (-586.809) (-589.384) -- 0:01:44

      Average standard deviation of split frequencies: 0.016551

      235500 -- (-576.917) (-578.684) [-581.311] (-587.365) * [-581.807] (-577.243) (-582.092) (-582.732) -- 0:01:43
      236000 -- (-583.369) (-583.262) (-579.766) [-578.128] * (-578.561) [-579.252] (-578.776) (-584.421) -- 0:01:43
      236500 -- [-579.556] (-585.741) (-578.999) (-581.299) * (-579.141) (-577.999) [-576.969] (-583.666) -- 0:01:43
      237000 -- (-578.891) (-577.787) [-578.720] (-583.675) * [-582.851] (-575.801) (-580.977) (-579.854) -- 0:01:46
      237500 -- (-575.037) (-578.359) (-581.868) [-578.607] * (-581.971) [-580.110] (-574.687) (-578.963) -- 0:01:45
      238000 -- (-578.180) (-580.271) [-576.784] (-581.087) * (-581.760) (-576.882) (-577.667) [-581.510] -- 0:01:45
      238500 -- [-580.542] (-575.644) (-578.705) (-579.797) * (-585.401) (-572.356) [-577.004] (-586.536) -- 0:01:45
      239000 -- (-584.054) [-577.568] (-580.251) (-578.297) * (-577.416) (-584.046) (-578.646) [-583.215] -- 0:01:45
      239500 -- (-583.853) [-575.641] (-582.222) (-585.784) * (-578.115) (-581.094) (-578.235) [-575.854] -- 0:01:44
      240000 -- (-574.415) [-576.076] (-575.964) (-585.786) * (-575.683) [-577.838] (-577.230) (-575.272) -- 0:01:44

      Average standard deviation of split frequencies: 0.019308

      240500 -- [-574.909] (-578.066) (-578.602) (-582.815) * (-589.103) (-578.010) (-576.030) [-577.187] -- 0:01:44
      241000 -- (-580.382) (-574.177) [-574.285] (-585.926) * (-579.827) [-581.491] (-585.016) (-576.813) -- 0:01:43
      241500 -- (-580.935) (-579.333) [-574.842] (-583.321) * (-582.005) (-575.761) [-578.909] (-582.851) -- 0:01:43
      242000 -- (-575.860) [-577.404] (-583.487) (-579.586) * (-577.914) (-575.928) [-578.095] (-581.158) -- 0:01:43
      242500 -- (-582.889) (-577.218) [-578.366] (-580.655) * (-572.774) (-585.013) [-575.585] (-580.459) -- 0:01:43
      243000 -- (-577.655) (-578.728) (-575.730) [-574.952] * (-579.186) [-579.241] (-574.917) (-575.044) -- 0:01:42
      243500 -- (-574.799) (-577.246) [-578.850] (-578.742) * (-575.584) (-583.104) (-580.411) [-577.893] -- 0:01:42
      244000 -- (-587.219) (-581.024) [-580.724] (-577.288) * (-580.610) (-583.113) (-581.034) [-578.212] -- 0:01:42
      244500 -- [-578.465] (-580.146) (-576.050) (-576.250) * (-581.220) [-577.735] (-579.156) (-579.579) -- 0:01:45
      245000 -- (-574.954) [-577.802] (-587.328) (-577.577) * (-581.452) [-577.299] (-582.708) (-578.250) -- 0:01:44

      Average standard deviation of split frequencies: 0.018615

      245500 -- (-578.172) [-577.613] (-578.992) (-581.328) * (-578.405) [-582.078] (-580.963) (-585.872) -- 0:01:44
      246000 -- [-580.445] (-581.729) (-578.648) (-580.299) * [-576.478] (-581.514) (-586.480) (-579.423) -- 0:01:44
      246500 -- [-582.767] (-580.121) (-577.302) (-580.388) * (-584.195) (-581.056) [-579.298] (-581.372) -- 0:01:43
      247000 -- (-589.033) (-575.616) (-579.069) [-577.284] * [-577.014] (-588.629) (-578.757) (-583.192) -- 0:01:43
      247500 -- [-586.987] (-580.803) (-580.260) (-581.868) * [-579.440] (-577.781) (-582.794) (-583.474) -- 0:01:43
      248000 -- (-582.860) (-584.076) [-573.593] (-580.735) * [-581.597] (-594.954) (-581.500) (-583.105) -- 0:01:43
      248500 -- (-583.143) (-577.491) (-578.063) [-577.997] * (-579.848) (-579.473) (-578.545) [-581.975] -- 0:01:42
      249000 -- (-581.084) (-577.239) [-576.870] (-583.509) * (-587.936) (-585.568) (-578.847) [-576.531] -- 0:01:42
      249500 -- (-578.383) [-575.484] (-584.204) (-584.235) * (-589.221) (-591.132) [-573.752] (-583.660) -- 0:01:42
      250000 -- (-579.393) (-577.172) (-581.233) [-576.522] * (-585.431) [-582.721] (-575.523) (-586.409) -- 0:01:42

      Average standard deviation of split frequencies: 0.017194

      250500 -- (-585.533) (-575.951) (-584.095) [-581.202] * (-581.325) [-581.347] (-574.847) (-577.003) -- 0:01:41
      251000 -- (-578.168) [-580.107] (-578.582) (-575.206) * [-582.338] (-584.646) (-584.684) (-580.476) -- 0:01:41
      251500 -- (-580.905) (-578.289) (-585.967) [-575.510] * (-585.258) (-580.089) (-576.519) [-578.627] -- 0:01:41
      252000 -- (-582.200) [-574.864] (-582.892) (-578.619) * [-583.896] (-587.317) (-579.435) (-580.160) -- 0:01:43
      252500 -- (-582.335) [-580.256] (-586.541) (-576.758) * (-579.499) (-584.866) (-577.878) [-579.971] -- 0:01:43
      253000 -- (-578.087) [-578.145] (-580.803) (-576.540) * (-590.432) (-578.837) [-578.913] (-577.631) -- 0:01:43
      253500 -- (-576.971) (-579.021) (-582.669) [-576.463] * (-583.691) (-577.225) (-579.080) [-580.481] -- 0:01:43
      254000 -- (-579.846) (-579.634) (-578.087) [-575.593] * (-585.506) [-576.546] (-575.887) (-577.003) -- 0:01:42
      254500 -- [-575.714] (-579.391) (-588.089) (-580.740) * (-590.027) [-575.330] (-580.601) (-582.737) -- 0:01:42
      255000 -- (-577.147) (-580.250) (-588.715) [-583.593] * (-587.005) (-577.255) (-584.170) [-585.887] -- 0:01:42

      Average standard deviation of split frequencies: 0.017099

      255500 -- (-580.148) (-585.389) (-582.109) [-574.662] * [-584.540] (-578.174) (-586.267) (-591.114) -- 0:01:41
      256000 -- (-580.733) (-578.067) (-585.697) [-573.814] * (-587.877) (-582.806) [-580.069] (-582.535) -- 0:01:41
      256500 -- (-586.069) [-578.302] (-584.777) (-583.529) * (-582.930) (-577.315) [-582.181] (-584.167) -- 0:01:41
      257000 -- (-583.900) (-577.840) (-580.665) [-577.075] * [-587.349] (-583.250) (-576.183) (-585.601) -- 0:01:41
      257500 -- (-575.516) [-578.388] (-584.133) (-584.061) * (-588.683) (-576.723) (-580.875) [-578.229] -- 0:01:40
      258000 -- (-578.867) (-581.290) (-579.587) [-579.707] * (-582.787) (-585.407) (-577.570) [-577.790] -- 0:01:40
      258500 -- (-585.341) (-577.631) (-577.915) [-578.631] * (-584.982) [-581.863] (-577.643) (-580.597) -- 0:01:40
      259000 -- (-586.377) (-576.283) [-580.093] (-574.312) * (-586.303) (-591.236) [-578.836] (-583.388) -- 0:01:40
      259500 -- (-581.603) (-580.654) (-581.120) [-580.337] * (-581.877) (-587.151) (-572.224) [-576.419] -- 0:01:42
      260000 -- (-584.999) [-584.205] (-581.784) (-581.382) * (-581.599) (-578.980) (-576.150) [-575.435] -- 0:01:42

      Average standard deviation of split frequencies: 0.017310

      260500 -- (-582.432) (-582.055) [-578.379] (-583.459) * [-580.057] (-581.272) (-576.538) (-582.929) -- 0:01:42
      261000 -- (-580.418) (-575.494) (-581.112) [-581.398] * (-580.200) (-580.366) (-575.153) [-583.513] -- 0:01:41
      261500 -- [-576.680] (-580.663) (-587.547) (-580.670) * (-580.972) (-582.487) (-586.875) [-579.566] -- 0:01:41
      262000 -- (-582.192) [-577.564] (-582.772) (-587.155) * (-576.183) (-577.272) (-576.762) [-576.949] -- 0:01:41
      262500 -- [-577.043] (-577.913) (-578.897) (-578.227) * [-574.020] (-580.141) (-579.421) (-581.664) -- 0:01:41
      263000 -- (-581.850) [-576.925] (-582.607) (-582.359) * (-575.012) [-580.769] (-584.671) (-576.936) -- 0:01:40
      263500 -- [-583.319] (-575.830) (-585.587) (-582.048) * [-580.722] (-585.288) (-578.582) (-582.175) -- 0:01:40
      264000 -- (-587.787) [-578.141] (-586.734) (-578.186) * [-574.435] (-577.589) (-576.927) (-582.376) -- 0:01:40
      264500 -- (-582.968) [-577.314] (-584.094) (-576.472) * [-575.065] (-581.132) (-580.417) (-580.760) -- 0:01:40
      265000 -- (-586.768) [-575.268] (-583.334) (-576.212) * (-581.801) (-581.028) (-580.544) [-576.829] -- 0:01:39

      Average standard deviation of split frequencies: 0.017722

      265500 -- (-577.825) (-579.063) [-586.883] (-579.234) * (-583.072) [-579.693] (-578.819) (-577.588) -- 0:01:39
      266000 -- (-583.216) (-581.413) (-581.305) [-579.252] * (-580.597) (-585.887) [-575.489] (-582.615) -- 0:01:39
      266500 -- (-578.787) (-583.744) [-581.167] (-577.438) * (-576.549) (-583.954) [-575.479] (-578.719) -- 0:01:41
      267000 -- (-577.599) (-573.658) (-581.940) [-578.189] * (-579.878) [-581.540] (-579.688) (-576.562) -- 0:01:41
      267500 -- (-577.265) (-581.553) [-583.772] (-579.950) * (-582.744) [-578.876] (-578.483) (-581.914) -- 0:01:41
      268000 -- (-578.649) (-582.012) [-578.488] (-577.175) * [-580.255] (-583.467) (-578.921) (-587.384) -- 0:01:41
      268500 -- (-573.354) (-586.217) [-579.536] (-579.928) * (-580.825) (-582.889) (-585.321) [-576.132] -- 0:01:40
      269000 -- (-578.125) (-580.500) [-574.786] (-579.405) * (-580.442) [-583.603] (-588.097) (-577.666) -- 0:01:40
      269500 -- [-574.513] (-582.936) (-573.887) (-579.109) * (-576.357) (-584.550) [-577.548] (-582.186) -- 0:01:40
      270000 -- (-580.916) (-580.151) (-576.212) [-580.946] * [-574.626] (-577.025) (-583.438) (-580.448) -- 0:01:40

      Average standard deviation of split frequencies: 0.016919

      270500 -- [-583.488] (-582.569) (-585.223) (-577.740) * (-577.179) [-580.104] (-584.545) (-579.444) -- 0:01:39
      271000 -- (-590.630) [-582.678] (-585.879) (-579.049) * (-586.182) [-579.536] (-582.057) (-576.739) -- 0:01:39
      271500 -- (-586.733) (-585.517) [-577.104] (-579.367) * [-577.749] (-579.361) (-582.628) (-581.704) -- 0:01:39
      272000 -- (-591.281) [-582.620] (-580.169) (-578.406) * [-574.857] (-577.543) (-584.680) (-578.968) -- 0:01:39
      272500 -- (-578.141) (-585.019) (-582.122) [-577.910] * (-577.741) [-578.312] (-581.317) (-581.217) -- 0:01:38
      273000 -- (-582.167) [-579.742] (-585.449) (-574.094) * (-580.223) (-580.293) (-578.720) [-580.768] -- 0:01:38
      273500 -- [-580.797] (-580.241) (-579.305) (-578.235) * (-585.463) (-576.550) [-577.461] (-578.961) -- 0:01:38
      274000 -- (-578.627) (-582.856) [-579.132] (-584.253) * [-576.259] (-581.751) (-581.140) (-581.721) -- 0:01:40
      274500 -- (-579.978) [-577.761] (-584.899) (-579.494) * (-578.470) (-587.893) [-579.218] (-576.226) -- 0:01:40
      275000 -- (-580.028) (-579.129) [-580.182] (-577.101) * (-581.094) (-580.881) (-580.292) [-585.009] -- 0:01:40

      Average standard deviation of split frequencies: 0.015860

      275500 -- (-578.456) [-581.329] (-580.176) (-580.391) * (-580.424) (-577.886) [-579.215] (-577.859) -- 0:01:39
      276000 -- (-579.299) [-572.342] (-579.268) (-580.753) * (-577.892) (-578.985) [-578.265] (-582.500) -- 0:01:39
      276500 -- (-580.328) (-578.991) [-583.814] (-580.606) * (-576.982) (-581.303) (-577.215) [-577.412] -- 0:01:39
      277000 -- (-578.106) (-579.532) (-580.148) [-579.582] * (-580.452) (-580.524) [-578.185] (-577.453) -- 0:01:39
      277500 -- (-577.288) [-575.060] (-582.553) (-577.215) * (-578.656) (-582.984) [-577.991] (-580.983) -- 0:01:38
      278000 -- (-580.277) (-578.760) [-574.170] (-577.958) * [-574.745] (-581.803) (-582.330) (-580.995) -- 0:01:38
      278500 -- (-575.582) (-585.856) [-579.143] (-577.544) * (-574.434) [-580.462] (-579.790) (-582.139) -- 0:01:38
      279000 -- (-583.047) (-580.037) [-578.749] (-580.267) * [-575.060] (-579.902) (-582.549) (-582.069) -- 0:01:38
      279500 -- [-578.747] (-585.183) (-580.157) (-578.960) * (-579.294) [-581.035] (-582.507) (-582.857) -- 0:01:37
      280000 -- [-580.558] (-580.935) (-578.438) (-580.010) * [-576.437] (-578.725) (-590.387) (-581.051) -- 0:01:37

      Average standard deviation of split frequencies: 0.016076

      280500 -- (-581.793) (-585.280) (-580.751) [-576.886] * (-577.477) (-577.001) [-578.646] (-577.949) -- 0:01:37
      281000 -- [-577.232] (-583.643) (-582.954) (-578.163) * (-576.028) [-577.940] (-584.763) (-581.436) -- 0:01:37
      281500 -- (-577.073) (-580.372) [-579.201] (-579.127) * (-584.528) [-577.460] (-578.576) (-578.383) -- 0:01:39
      282000 -- [-579.049] (-580.673) (-578.824) (-578.819) * (-577.750) (-581.201) (-587.379) [-582.522] -- 0:01:39
      282500 -- (-574.128) (-584.494) (-584.639) [-578.215] * (-579.251) (-574.158) [-581.929] (-581.203) -- 0:01:39
      283000 -- (-581.902) [-583.875] (-581.938) (-581.277) * [-576.488] (-577.988) (-584.433) (-578.840) -- 0:01:38
      283500 -- [-579.796] (-587.275) (-582.480) (-580.677) * [-575.655] (-578.075) (-582.014) (-577.868) -- 0:01:38
      284000 -- [-578.714] (-578.864) (-574.305) (-579.394) * (-581.356) [-577.862] (-583.042) (-583.734) -- 0:01:38
      284500 -- (-578.435) (-581.061) (-577.015) [-578.508] * (-579.405) (-582.405) [-579.188] (-579.249) -- 0:01:38
      285000 -- (-576.058) [-581.749] (-574.441) (-582.513) * (-576.518) (-578.887) (-587.151) [-578.841] -- 0:01:37

      Average standard deviation of split frequencies: 0.015305

      285500 -- [-582.025] (-579.812) (-576.827) (-588.911) * (-578.704) (-576.971) (-578.001) [-575.577] -- 0:01:37
      286000 -- [-576.841] (-580.879) (-581.946) (-580.400) * (-577.640) (-582.090) (-577.350) [-586.877] -- 0:01:37
      286500 -- (-578.150) (-583.997) (-574.538) [-578.093] * [-583.085] (-585.866) (-591.414) (-582.182) -- 0:01:37
      287000 -- [-579.450] (-582.118) (-573.381) (-581.164) * [-582.826] (-586.885) (-577.208) (-576.476) -- 0:01:36
      287500 -- (-581.788) (-580.249) [-575.119] (-584.569) * (-579.610) (-583.515) (-579.289) [-575.833] -- 0:01:36
      288000 -- [-582.439] (-575.818) (-578.304) (-576.638) * (-577.351) (-585.086) (-586.240) [-577.486] -- 0:01:36
      288500 -- (-587.642) (-580.003) (-579.640) [-579.309] * (-574.990) (-580.122) (-581.566) [-577.948] -- 0:01:38
      289000 -- (-579.850) [-579.281] (-585.617) (-581.454) * (-580.129) (-586.956) [-578.074] (-576.431) -- 0:01:38
      289500 -- (-574.211) (-580.887) [-581.694] (-574.471) * [-575.355] (-578.146) (-582.177) (-575.827) -- 0:01:38
      290000 -- (-577.577) (-582.087) [-586.002] (-581.330) * (-575.696) (-579.310) (-580.072) [-580.424] -- 0:01:37

      Average standard deviation of split frequencies: 0.016450

      290500 -- (-578.024) (-580.022) [-582.029] (-580.111) * (-578.519) [-581.701] (-576.974) (-581.477) -- 0:01:37
      291000 -- (-580.820) [-578.741] (-589.846) (-580.334) * (-588.422) (-577.776) [-580.787] (-580.746) -- 0:01:37
      291500 -- (-584.895) (-588.119) [-583.524] (-579.803) * (-579.921) [-577.691] (-580.979) (-583.484) -- 0:01:37
      292000 -- (-584.338) (-580.488) (-582.054) [-575.053] * [-576.013] (-586.849) (-581.424) (-583.582) -- 0:01:36
      292500 -- (-581.122) [-577.253] (-585.162) (-585.241) * [-578.003] (-582.568) (-576.847) (-582.067) -- 0:01:36
      293000 -- (-581.695) [-577.732] (-581.118) (-585.830) * (-579.395) (-583.012) [-578.229] (-582.332) -- 0:01:36
      293500 -- (-581.836) [-582.094] (-578.506) (-587.739) * (-576.873) (-580.292) (-581.778) [-584.820] -- 0:01:36
      294000 -- (-587.381) (-577.460) [-582.578] (-577.663) * (-578.563) (-580.482) [-582.378] (-581.660) -- 0:01:36
      294500 -- (-579.370) (-575.993) (-581.962) [-576.376] * (-580.094) (-583.971) (-578.348) [-576.595] -- 0:01:35
      295000 -- (-578.934) (-585.925) (-580.485) [-575.343] * (-582.459) [-577.629] (-579.639) (-580.290) -- 0:01:35

      Average standard deviation of split frequencies: 0.018428

      295500 -- (-581.133) (-579.711) [-580.172] (-579.758) * (-584.139) (-582.661) [-574.637] (-581.908) -- 0:01:35
      296000 -- (-579.379) [-580.554] (-586.615) (-586.065) * (-587.240) (-583.444) [-580.624] (-579.684) -- 0:01:37
      296500 -- (-583.900) (-579.644) (-576.275) [-582.285] * (-581.997) (-581.159) [-578.727] (-581.872) -- 0:01:37
      297000 -- (-580.562) (-577.212) (-577.840) [-580.494] * (-581.002) (-583.308) [-579.208] (-585.428) -- 0:01:37
      297500 -- (-579.180) [-574.237] (-580.417) (-584.795) * [-579.607] (-580.438) (-575.593) (-583.220) -- 0:01:36
      298000 -- (-578.309) (-572.401) [-576.872] (-579.708) * (-583.714) (-581.863) [-581.270] (-584.017) -- 0:01:36
      298500 -- [-576.952] (-577.943) (-576.608) (-576.820) * [-585.721] (-577.737) (-576.435) (-585.737) -- 0:01:36
      299000 -- [-576.970] (-576.619) (-580.652) (-579.220) * [-581.805] (-578.533) (-578.799) (-584.696) -- 0:01:36
      299500 -- (-581.696) [-580.347] (-577.678) (-580.209) * (-583.541) [-574.238] (-581.147) (-578.501) -- 0:01:35
      300000 -- (-582.715) [-579.254] (-582.527) (-584.124) * (-579.626) (-576.184) (-579.572) [-579.303] -- 0:01:35

      Average standard deviation of split frequencies: 0.016127

      300500 -- [-578.338] (-580.808) (-582.959) (-580.732) * (-578.132) (-595.096) (-578.798) [-579.432] -- 0:01:35
      301000 -- (-577.494) [-581.868] (-585.836) (-579.488) * (-586.866) (-575.573) [-581.762] (-580.585) -- 0:01:35
      301500 -- (-583.003) (-579.731) (-577.798) [-579.504] * (-580.849) (-579.512) [-576.850] (-574.001) -- 0:01:34
      302000 -- (-580.696) (-578.526) [-575.399] (-578.879) * (-584.854) [-580.266] (-578.930) (-580.217) -- 0:01:34
      302500 -- (-575.671) (-583.539) [-574.726] (-577.456) * (-587.290) (-578.134) (-581.518) [-578.119] -- 0:01:34
      303000 -- (-584.287) (-579.742) (-579.738) [-573.840] * (-582.612) [-574.392] (-577.849) (-580.280) -- 0:01:34
      303500 -- (-578.375) (-575.057) [-576.931] (-580.438) * (-586.365) (-574.655) [-575.559] (-580.790) -- 0:01:36
      304000 -- (-581.070) (-578.946) (-576.253) [-576.569] * (-582.467) [-577.679] (-578.019) (-583.135) -- 0:01:36
      304500 -- (-576.662) [-579.729] (-574.690) (-581.853) * (-582.104) (-583.886) (-577.621) [-579.511] -- 0:01:35
      305000 -- [-579.781] (-583.320) (-576.248) (-578.414) * (-584.880) (-577.183) (-578.640) [-581.264] -- 0:01:35

      Average standard deviation of split frequencies: 0.016726

      305500 -- (-577.459) (-579.117) (-580.391) [-579.138] * (-585.956) (-579.455) (-578.878) [-576.515] -- 0:01:35
      306000 -- [-572.915] (-584.738) (-583.260) (-583.546) * (-578.660) [-580.796] (-577.971) (-579.599) -- 0:01:35
      306500 -- [-577.311] (-588.228) (-585.024) (-575.295) * [-580.265] (-575.093) (-577.849) (-580.734) -- 0:01:35
      307000 -- [-577.028] (-589.748) (-577.662) (-578.999) * (-584.498) (-580.115) [-577.449] (-581.200) -- 0:01:34
      307500 -- (-577.605) (-578.965) [-577.360] (-577.057) * (-579.263) (-578.428) [-576.642] (-583.632) -- 0:01:34
      308000 -- [-577.567] (-584.152) (-582.997) (-579.271) * [-577.808] (-584.527) (-582.235) (-587.285) -- 0:01:34
      308500 -- (-582.385) (-582.870) (-575.202) [-582.618] * [-580.147] (-590.521) (-582.204) (-579.487) -- 0:01:34
      309000 -- (-582.625) (-578.758) [-574.195] (-584.443) * (-579.612) (-586.577) (-582.415) [-578.448] -- 0:01:33
      309500 -- (-580.611) (-583.068) (-581.474) [-575.834] * (-580.367) [-578.574] (-573.648) (-576.569) -- 0:01:33
      310000 -- (-577.282) [-578.956] (-581.852) (-575.537) * (-580.200) (-579.683) (-580.987) [-581.294] -- 0:01:33

      Average standard deviation of split frequencies: 0.014740

      310500 -- (-575.494) (-582.325) [-576.544] (-580.559) * (-581.768) (-578.067) [-576.428] (-581.967) -- 0:01:35
      311000 -- [-576.245] (-585.044) (-580.634) (-577.672) * [-577.385] (-583.312) (-577.280) (-578.841) -- 0:01:35
      311500 -- [-575.425] (-577.179) (-580.601) (-577.491) * (-581.165) (-583.171) [-577.661] (-581.645) -- 0:01:35
      312000 -- (-580.966) [-584.448] (-585.061) (-580.917) * [-581.007] (-581.027) (-585.000) (-576.173) -- 0:01:34
      312500 -- (-582.617) (-580.725) (-585.910) [-574.818] * (-583.643) (-586.522) [-577.705] (-578.775) -- 0:01:34
      313000 -- (-584.655) (-580.127) (-582.938) [-582.458] * (-582.026) [-576.183] (-580.130) (-582.322) -- 0:01:34
      313500 -- (-582.979) [-579.884] (-584.482) (-576.114) * (-581.956) (-576.353) [-574.422] (-583.596) -- 0:01:34
      314000 -- (-589.540) [-578.646] (-582.855) (-588.123) * (-575.664) [-576.067] (-579.402) (-580.038) -- 0:01:33
      314500 -- (-574.707) (-586.042) (-583.441) [-577.175] * (-588.862) (-578.879) [-575.594] (-577.302) -- 0:01:33
      315000 -- (-576.224) (-578.753) [-576.483] (-585.848) * (-583.854) (-583.189) [-583.197] (-587.504) -- 0:01:33

      Average standard deviation of split frequencies: 0.016197

      315500 -- (-582.035) (-580.681) (-584.360) [-580.345] * (-584.182) (-582.522) [-578.989] (-579.605) -- 0:01:33
      316000 -- (-578.987) (-581.208) (-576.485) [-582.349] * [-581.916] (-577.988) (-579.658) (-578.922) -- 0:01:33
      316500 -- [-576.198] (-582.383) (-575.423) (-582.794) * (-583.934) (-578.233) [-580.325] (-582.348) -- 0:01:32
      317000 -- (-578.661) (-576.923) [-576.208] (-587.403) * (-585.321) [-583.165] (-579.565) (-581.116) -- 0:01:32
      317500 -- [-583.605] (-580.665) (-580.865) (-576.413) * [-579.831] (-576.990) (-581.361) (-585.049) -- 0:01:32
      318000 -- [-580.777] (-581.619) (-580.615) (-577.789) * (-589.502) (-579.309) (-581.533) [-578.779] -- 0:01:34
      318500 -- (-579.326) [-576.814] (-579.152) (-581.612) * (-578.135) (-581.091) [-580.493] (-576.666) -- 0:01:34
      319000 -- (-577.353) (-590.233) [-579.654] (-577.643) * [-577.848] (-582.423) (-577.735) (-580.153) -- 0:01:33
      319500 -- [-579.449] (-580.683) (-586.486) (-580.487) * [-577.010] (-580.122) (-581.965) (-576.237) -- 0:01:33
      320000 -- (-577.808) [-579.861] (-584.331) (-579.661) * [-577.616] (-579.062) (-579.390) (-587.785) -- 0:01:33

      Average standard deviation of split frequencies: 0.017011

      320500 -- [-582.835] (-586.897) (-579.441) (-578.188) * [-575.275] (-577.255) (-589.601) (-587.220) -- 0:01:33
      321000 -- (-577.058) (-581.044) [-576.784] (-578.313) * (-584.898) [-578.899] (-580.011) (-581.235) -- 0:01:33
      321500 -- (-580.497) (-578.510) (-578.280) [-581.933] * (-580.588) [-578.543] (-578.092) (-583.195) -- 0:01:32
      322000 -- (-579.213) (-578.907) [-582.258] (-581.942) * [-581.941] (-580.989) (-575.543) (-584.879) -- 0:01:32
      322500 -- (-580.813) (-581.046) (-577.591) [-579.629] * (-581.465) [-578.085] (-576.857) (-582.250) -- 0:01:32
      323000 -- (-593.292) (-582.781) [-581.414] (-576.509) * (-584.803) [-576.839] (-577.597) (-586.619) -- 0:01:32
      323500 -- (-595.058) (-578.524) (-577.036) [-581.138] * (-581.516) [-580.939] (-578.824) (-587.481) -- 0:01:32
      324000 -- (-581.492) [-580.048] (-580.343) (-586.070) * (-578.845) (-577.910) (-581.463) [-582.547] -- 0:01:31
      324500 -- (-579.101) [-579.060] (-578.636) (-579.791) * [-575.815] (-578.043) (-583.221) (-581.819) -- 0:01:31
      325000 -- (-574.911) (-573.620) [-574.205] (-581.139) * (-576.128) (-583.170) (-583.194) [-577.987] -- 0:01:31

      Average standard deviation of split frequencies: 0.017765

      325500 -- [-575.865] (-576.140) (-575.206) (-581.170) * (-576.917) [-580.205] (-579.896) (-577.411) -- 0:01:33
      326000 -- (-577.377) [-576.309] (-578.177) (-582.209) * [-579.087] (-578.224) (-577.059) (-582.553) -- 0:01:33
      326500 -- (-580.206) (-579.891) [-577.726] (-573.901) * (-582.292) [-578.307] (-588.381) (-580.301) -- 0:01:32
      327000 -- (-582.900) [-574.471] (-583.556) (-577.502) * (-578.280) (-575.950) [-579.564] (-576.035) -- 0:01:32
      327500 -- (-580.780) [-582.956] (-574.949) (-578.798) * (-582.797) [-577.923] (-579.896) (-575.600) -- 0:01:32
      328000 -- (-576.523) [-579.556] (-575.885) (-578.564) * (-578.891) [-574.942] (-578.557) (-576.118) -- 0:01:32
      328500 -- (-580.501) (-586.310) (-578.687) [-578.305] * (-576.150) (-575.953) (-578.136) [-578.500] -- 0:01:31
      329000 -- (-578.354) (-580.390) (-578.398) [-580.135] * (-578.721) (-576.952) [-581.200] (-575.168) -- 0:01:31
      329500 -- (-577.181) [-576.161] (-579.635) (-576.089) * (-582.499) (-577.732) (-577.755) [-577.658] -- 0:01:31
      330000 -- (-584.545) (-579.730) (-580.605) [-574.791] * (-574.221) [-584.507] (-577.315) (-578.645) -- 0:01:31

      Average standard deviation of split frequencies: 0.016293

      330500 -- (-582.653) [-582.104] (-575.556) (-577.955) * (-575.929) (-579.209) (-582.289) [-580.235] -- 0:01:31
      331000 -- [-582.256] (-584.293) (-575.734) (-576.590) * [-575.559] (-579.378) (-580.541) (-579.121) -- 0:01:30
      331500 -- (-578.252) (-582.104) (-581.826) [-579.348] * (-579.210) (-583.573) (-579.940) [-578.736] -- 0:01:30
      332000 -- (-577.837) (-579.107) (-583.462) [-577.667] * (-581.860) (-588.946) [-575.632] (-575.359) -- 0:01:30
      332500 -- (-578.636) (-578.024) (-580.216) [-575.237] * (-576.902) (-576.441) [-579.948] (-579.854) -- 0:01:32
      333000 -- (-580.001) (-588.893) [-578.685] (-577.223) * [-577.002] (-581.674) (-586.110) (-574.517) -- 0:01:32
      333500 -- (-580.582) (-582.341) (-584.179) [-576.654] * [-577.959] (-583.924) (-585.112) (-577.627) -- 0:01:31
      334000 -- [-579.198] (-583.093) (-582.094) (-577.192) * [-578.185] (-586.906) (-582.343) (-579.309) -- 0:01:31
      334500 -- (-577.676) (-582.666) (-578.995) [-574.967] * (-584.992) (-578.892) (-577.938) [-579.831] -- 0:01:31
      335000 -- (-581.760) (-575.719) [-581.076] (-580.653) * [-577.461] (-591.731) (-580.091) (-581.578) -- 0:01:31

      Average standard deviation of split frequencies: 0.019041

      335500 -- (-575.524) [-576.759] (-578.707) (-578.140) * (-583.554) (-580.648) (-582.847) [-580.762] -- 0:01:31
      336000 -- (-575.757) (-578.491) [-578.903] (-577.195) * [-573.361] (-581.549) (-583.294) (-585.174) -- 0:01:30
      336500 -- (-585.755) (-574.583) (-583.175) [-581.712] * (-579.296) [-576.483] (-580.175) (-579.066) -- 0:01:30
      337000 -- (-577.943) [-578.856] (-576.570) (-580.176) * (-574.920) (-577.773) (-579.448) [-580.708] -- 0:01:30
      337500 -- (-582.186) (-576.692) [-581.169] (-577.790) * (-578.437) (-579.948) (-580.799) [-580.942] -- 0:01:30
      338000 -- [-578.943] (-583.797) (-580.266) (-579.876) * (-577.460) (-576.806) (-586.816) [-577.838] -- 0:01:30
      338500 -- (-575.215) [-583.488] (-579.360) (-580.116) * (-580.161) [-579.026] (-582.742) (-575.787) -- 0:01:29
      339000 -- (-586.140) (-582.460) (-579.675) [-577.403] * (-580.167) (-585.186) [-581.942] (-579.733) -- 0:01:29
      339500 -- [-574.831] (-579.334) (-577.046) (-575.926) * [-574.103] (-582.550) (-578.852) (-580.536) -- 0:01:29
      340000 -- [-578.998] (-582.021) (-581.709) (-583.338) * (-574.515) [-578.041] (-586.074) (-579.067) -- 0:01:31

      Average standard deviation of split frequencies: 0.019175

      340500 -- [-579.040] (-581.066) (-577.623) (-579.691) * (-582.267) [-577.532] (-576.391) (-575.929) -- 0:01:31
      341000 -- [-573.950] (-578.527) (-580.088) (-581.737) * [-575.841] (-585.488) (-578.545) (-579.896) -- 0:01:30
      341500 -- (-575.941) (-586.465) (-583.785) [-575.511] * (-575.594) (-581.741) [-580.026] (-580.851) -- 0:01:30
      342000 -- (-577.657) (-582.906) (-580.090) [-579.469] * (-576.669) [-580.710] (-583.612) (-577.481) -- 0:01:30
      342500 -- (-583.894) (-588.610) [-577.366] (-581.628) * (-577.970) [-584.001] (-577.580) (-575.841) -- 0:01:30
      343000 -- (-580.310) (-593.398) [-577.486] (-581.671) * (-574.456) (-582.722) (-576.522) [-581.065] -- 0:01:30
      343500 -- (-581.105) (-587.571) (-575.554) [-574.505] * [-588.857] (-583.666) (-580.329) (-582.350) -- 0:01:29
      344000 -- (-579.597) (-589.771) (-580.272) [-576.326] * (-582.384) (-584.855) (-584.469) [-579.638] -- 0:01:29
      344500 -- (-579.917) (-590.173) (-577.829) [-576.517] * [-577.845] (-589.060) (-576.772) (-582.010) -- 0:01:29
      345000 -- (-576.458) (-588.828) [-586.373] (-575.849) * (-580.036) (-589.394) (-577.955) [-578.220] -- 0:01:29

      Average standard deviation of split frequencies: 0.019853

      345500 -- [-581.353] (-589.769) (-583.438) (-577.081) * [-581.067] (-586.573) (-582.472) (-580.764) -- 0:01:29
      346000 -- (-580.956) [-580.134] (-580.972) (-577.156) * (-581.930) (-586.753) (-579.405) [-577.509] -- 0:01:28
      346500 -- (-586.497) (-579.859) (-579.054) [-572.765] * [-579.138] (-587.571) (-582.462) (-579.931) -- 0:01:28
      347000 -- (-578.564) (-583.678) [-577.153] (-574.974) * (-579.707) (-579.831) (-580.673) [-585.124] -- 0:01:30
      347500 -- (-582.631) (-582.898) (-579.972) [-574.948] * (-582.287) (-581.344) [-584.150] (-580.178) -- 0:01:30
      348000 -- (-584.813) [-583.678] (-576.703) (-577.047) * [-575.811] (-584.157) (-580.078) (-580.265) -- 0:01:29
      348500 -- (-588.461) (-580.462) [-576.525] (-576.792) * (-579.049) (-587.102) [-583.534] (-582.117) -- 0:01:29
      349000 -- (-587.334) (-581.593) (-577.302) [-575.590] * (-582.555) (-583.557) [-574.713] (-575.946) -- 0:01:29
      349500 -- (-594.667) (-583.153) (-584.166) [-579.858] * (-579.624) [-579.910] (-582.465) (-579.301) -- 0:01:29
      350000 -- [-575.083] (-579.383) (-585.155) (-582.579) * (-582.072) (-590.578) [-580.772] (-578.265) -- 0:01:29

      Average standard deviation of split frequencies: 0.017668

      350500 -- (-578.082) (-581.782) [-582.043] (-584.071) * (-580.771) (-579.764) [-578.705] (-575.724) -- 0:01:28
      351000 -- [-577.169] (-577.342) (-589.202) (-576.958) * (-578.540) (-578.636) [-576.004] (-573.758) -- 0:01:28
      351500 -- (-577.172) [-581.714] (-583.347) (-586.014) * [-585.597] (-580.162) (-577.036) (-576.484) -- 0:01:28
      352000 -- (-579.227) [-587.674] (-584.693) (-579.649) * (-577.043) [-580.507] (-579.764) (-576.353) -- 0:01:28
      352500 -- (-582.532) (-580.852) (-577.537) [-576.734] * (-575.779) (-577.010) [-576.687] (-580.479) -- 0:01:28
      353000 -- (-575.034) (-580.102) [-578.267] (-579.809) * [-575.396] (-577.074) (-583.400) (-580.110) -- 0:01:27
      353500 -- (-578.545) [-586.359] (-580.008) (-579.127) * (-585.812) (-580.569) [-579.971] (-578.936) -- 0:01:27
      354000 -- (-577.848) (-583.887) [-580.160] (-586.705) * [-578.204] (-577.280) (-580.270) (-577.791) -- 0:01:27
      354500 -- (-580.959) [-579.208] (-578.523) (-582.068) * (-574.741) (-578.124) (-581.446) [-578.800] -- 0:01:29
      355000 -- (-581.966) [-575.465] (-578.284) (-582.118) * (-577.184) [-579.535] (-575.819) (-581.805) -- 0:01:29

      Average standard deviation of split frequencies: 0.017782

      355500 -- (-574.790) (-579.625) [-585.580] (-583.961) * (-577.286) [-577.888] (-574.223) (-578.512) -- 0:01:28
      356000 -- [-578.231] (-575.311) (-575.733) (-577.724) * [-580.502] (-579.159) (-579.851) (-582.079) -- 0:01:28
      356500 -- (-581.684) [-577.055] (-577.609) (-581.782) * (-575.665) (-579.425) (-576.418) [-575.918] -- 0:01:28
      357000 -- (-576.695) (-577.907) [-577.384] (-580.352) * [-577.719] (-578.577) (-578.528) (-583.159) -- 0:01:28
      357500 -- (-579.765) (-577.707) [-581.303] (-579.130) * (-578.774) (-578.635) (-585.753) [-575.683] -- 0:01:28
      358000 -- (-577.661) [-578.696] (-583.672) (-580.382) * (-583.336) (-585.848) (-586.098) [-580.072] -- 0:01:27
      358500 -- (-577.267) (-573.016) (-576.281) [-578.092] * (-576.324) [-581.549] (-594.257) (-584.532) -- 0:01:27
      359000 -- (-579.278) [-578.772] (-579.174) (-580.884) * (-576.430) [-577.326] (-589.759) (-583.396) -- 0:01:27
      359500 -- [-575.977] (-577.692) (-576.929) (-577.833) * (-581.884) [-575.139] (-580.167) (-581.440) -- 0:01:27
      360000 -- (-573.314) (-577.869) (-579.296) [-579.786] * (-578.003) [-574.559] (-589.790) (-582.345) -- 0:01:27

      Average standard deviation of split frequencies: 0.019232

      360500 -- (-578.184) (-577.475) (-578.580) [-582.675] * [-581.670] (-581.944) (-585.608) (-575.837) -- 0:01:26
      361000 -- [-578.913] (-579.190) (-581.819) (-586.159) * (-584.542) [-580.431] (-587.384) (-581.090) -- 0:01:26
      361500 -- (-580.200) [-579.218] (-580.670) (-582.504) * (-578.186) (-578.982) (-590.359) [-575.955] -- 0:01:26
      362000 -- [-579.282] (-579.857) (-577.807) (-577.389) * [-576.254] (-585.129) (-594.000) (-578.524) -- 0:01:28
      362500 -- (-575.239) [-576.140] (-574.673) (-582.215) * (-575.066) (-584.384) (-590.512) [-579.165] -- 0:01:27
      363000 -- (-575.576) (-574.964) (-582.015) [-582.676] * [-576.801] (-575.502) (-587.412) (-578.161) -- 0:01:27
      363500 -- (-576.802) (-579.032) [-578.118] (-578.703) * (-577.110) (-576.831) (-585.225) [-581.089] -- 0:01:27
      364000 -- (-582.073) [-577.955] (-580.514) (-583.627) * (-576.799) [-577.383] (-584.662) (-582.884) -- 0:01:27
      364500 -- (-589.282) (-579.972) (-577.771) [-582.273] * [-578.988] (-576.154) (-581.220) (-577.632) -- 0:01:27
      365000 -- (-581.156) [-578.516] (-581.908) (-579.874) * [-577.681] (-583.416) (-587.308) (-584.611) -- 0:01:26

      Average standard deviation of split frequencies: 0.017296

      365500 -- [-582.493] (-579.564) (-585.737) (-582.410) * (-579.874) (-582.497) [-579.089] (-592.441) -- 0:01:26
      366000 -- (-581.241) [-577.488] (-580.835) (-582.907) * (-575.873) [-585.082] (-575.400) (-589.720) -- 0:01:26
      366500 -- (-576.553) (-583.171) [-579.974] (-577.072) * (-579.318) [-578.310] (-579.431) (-585.151) -- 0:01:26
      367000 -- [-579.681] (-583.745) (-579.004) (-577.794) * (-579.711) [-577.994] (-576.672) (-582.099) -- 0:01:26
      367500 -- (-575.959) [-581.868] (-577.338) (-578.418) * (-580.711) [-580.522] (-576.742) (-580.767) -- 0:01:26
      368000 -- (-585.518) [-577.265] (-573.348) (-578.946) * (-585.761) (-576.326) [-579.300] (-578.016) -- 0:01:25
      368500 -- (-580.334) (-578.574) (-576.241) [-576.551] * [-581.971] (-580.421) (-575.551) (-577.572) -- 0:01:25
      369000 -- (-588.220) (-584.454) [-578.798] (-581.322) * [-578.279] (-584.706) (-580.079) (-579.215) -- 0:01:27
      369500 -- (-577.385) (-584.021) (-580.245) [-576.577] * (-576.990) [-583.406] (-580.051) (-577.424) -- 0:01:27
      370000 -- (-579.696) [-580.600] (-578.408) (-576.828) * (-576.086) (-574.920) [-578.707] (-579.907) -- 0:01:26

      Average standard deviation of split frequencies: 0.016715

      370500 -- [-579.966] (-576.917) (-581.895) (-575.487) * (-580.429) [-579.307] (-582.573) (-577.965) -- 0:01:26
      371000 -- [-583.849] (-579.634) (-575.626) (-576.556) * [-580.198] (-579.173) (-583.064) (-581.600) -- 0:01:26
      371500 -- [-578.381] (-581.443) (-574.472) (-578.793) * [-579.232] (-578.013) (-581.425) (-591.662) -- 0:01:26
      372000 -- (-576.183) [-578.228] (-575.744) (-586.843) * (-582.171) (-575.359) [-579.790] (-585.879) -- 0:01:26
      372500 -- (-580.928) [-578.633] (-574.908) (-584.351) * (-580.552) [-579.099] (-579.750) (-580.327) -- 0:01:25
      373000 -- (-582.918) [-580.729] (-573.690) (-590.585) * (-582.801) (-576.617) [-576.450] (-578.358) -- 0:01:25
      373500 -- (-574.352) [-578.191] (-573.135) (-587.722) * [-578.309] (-576.457) (-579.370) (-577.200) -- 0:01:25
      374000 -- (-579.053) (-579.528) [-574.420] (-578.615) * (-577.277) (-579.789) [-581.638] (-588.828) -- 0:01:25
      374500 -- [-581.787] (-575.021) (-585.769) (-580.370) * (-592.435) (-585.089) (-583.977) [-580.399] -- 0:01:25
      375000 -- [-580.538] (-580.004) (-585.711) (-577.596) * (-578.138) (-581.483) [-576.947] (-575.293) -- 0:01:25

      Average standard deviation of split frequencies: 0.015940

      375500 -- [-577.838] (-580.272) (-586.597) (-583.220) * [-578.614] (-578.312) (-580.164) (-577.178) -- 0:01:24
      376000 -- (-582.468) [-578.224] (-576.378) (-582.240) * (-580.750) (-580.147) (-579.684) [-574.153] -- 0:01:24
      376500 -- (-576.693) [-581.830] (-573.940) (-584.673) * (-576.542) (-574.550) (-583.698) [-579.510] -- 0:01:26
      377000 -- (-578.550) (-583.962) [-576.634] (-583.028) * (-581.319) (-576.552) [-574.614] (-579.432) -- 0:01:25
      377500 -- (-585.587) [-580.728] (-576.382) (-578.875) * (-575.270) (-579.426) [-577.734] (-579.575) -- 0:01:25
      378000 -- [-576.796] (-578.649) (-590.647) (-580.827) * (-581.396) [-576.516] (-577.574) (-577.061) -- 0:01:25
      378500 -- [-575.201] (-578.825) (-581.592) (-575.638) * (-575.358) [-573.751] (-581.750) (-585.050) -- 0:01:25
      379000 -- [-578.772] (-584.416) (-578.450) (-579.873) * (-574.458) (-581.620) (-579.655) [-579.596] -- 0:01:25
      379500 -- (-575.156) [-575.472] (-582.412) (-578.716) * [-576.142] (-581.470) (-581.794) (-578.818) -- 0:01:25
      380000 -- (-577.173) (-578.899) [-578.542] (-574.837) * (-587.074) [-583.412] (-576.124) (-577.884) -- 0:01:24

      Average standard deviation of split frequencies: 0.015214

      380500 -- (-579.132) [-578.469] (-582.099) (-579.847) * (-583.516) (-578.798) [-578.546] (-577.248) -- 0:01:24
      381000 -- [-577.825] (-582.156) (-576.143) (-580.594) * (-591.559) (-578.030) [-585.208] (-578.798) -- 0:01:24
      381500 -- (-579.091) (-579.117) [-576.533] (-579.973) * (-579.871) [-577.494] (-582.243) (-580.860) -- 0:01:24
      382000 -- (-574.501) (-579.286) (-577.848) [-577.240] * [-576.095] (-575.370) (-583.209) (-583.595) -- 0:01:24
      382500 -- [-585.856] (-578.570) (-581.354) (-582.813) * (-583.443) [-576.091] (-578.988) (-583.288) -- 0:01:23
      383000 -- [-581.123] (-582.290) (-582.191) (-580.428) * [-576.934] (-579.796) (-576.260) (-581.314) -- 0:01:23
      383500 -- (-581.012) (-583.235) (-576.429) [-575.626] * (-578.416) (-577.822) [-577.093] (-576.989) -- 0:01:25
      384000 -- (-582.482) (-580.371) [-576.670] (-579.331) * [-577.714] (-580.064) (-576.954) (-589.969) -- 0:01:25
      384500 -- (-580.256) (-575.828) (-581.366) [-577.147] * [-579.137] (-574.134) (-579.078) (-584.337) -- 0:01:24
      385000 -- (-577.442) [-581.711] (-585.596) (-580.745) * (-584.268) (-575.135) [-578.618] (-577.409) -- 0:01:24

      Average standard deviation of split frequencies: 0.015004

      385500 -- (-578.130) [-578.181] (-577.956) (-577.993) * (-580.433) (-584.868) [-574.853] (-583.821) -- 0:01:24
      386000 -- (-580.577) (-579.873) (-587.079) [-573.801] * (-578.190) (-576.493) (-576.949) [-580.591] -- 0:01:24
      386500 -- (-577.987) (-581.986) (-589.961) [-577.688] * (-577.797) (-579.752) (-587.429) [-583.727] -- 0:01:24
      387000 -- (-580.098) [-577.354] (-575.666) (-576.779) * [-578.852] (-578.924) (-583.715) (-584.567) -- 0:01:23
      387500 -- (-575.024) (-583.558) [-580.110] (-575.803) * (-584.742) [-577.296] (-578.429) (-582.033) -- 0:01:23
      388000 -- (-576.586) [-579.214] (-581.286) (-582.565) * [-576.260] (-578.099) (-580.525) (-581.987) -- 0:01:23
      388500 -- (-578.714) (-590.141) [-582.510] (-575.351) * (-580.496) [-579.910] (-580.349) (-581.031) -- 0:01:23
      389000 -- (-575.946) (-583.600) (-579.622) [-574.678] * (-577.807) (-578.201) (-583.654) [-576.087] -- 0:01:23
      389500 -- (-580.446) (-582.299) [-576.263] (-582.609) * [-580.710] (-580.256) (-577.708) (-585.524) -- 0:01:23
      390000 -- (-578.848) [-579.070] (-580.261) (-584.282) * (-577.610) (-577.802) (-581.025) [-578.784] -- 0:01:22

      Average standard deviation of split frequencies: 0.013963

      390500 -- [-578.188] (-583.401) (-579.352) (-583.063) * (-576.968) [-582.905] (-581.157) (-583.019) -- 0:01:22
      391000 -- (-579.558) (-577.559) [-582.551] (-579.182) * (-577.383) (-580.779) [-580.077] (-578.798) -- 0:01:24
      391500 -- [-578.613] (-580.818) (-578.589) (-579.850) * [-580.387] (-584.484) (-584.893) (-580.261) -- 0:01:23
      392000 -- [-581.906] (-578.975) (-582.944) (-580.083) * (-578.870) (-579.027) (-586.073) [-573.792] -- 0:01:23
      392500 -- (-579.468) (-588.627) [-579.316] (-576.305) * (-580.072) (-581.196) (-581.149) [-578.309] -- 0:01:23
      393000 -- (-581.627) [-577.003] (-575.182) (-580.501) * (-580.161) [-576.697] (-582.219) (-579.969) -- 0:01:23
      393500 -- (-580.313) (-579.638) (-578.533) [-580.398] * (-583.340) (-586.015) (-588.017) [-574.968] -- 0:01:23
      394000 -- (-578.142) (-579.078) [-578.611] (-583.026) * (-585.139) (-583.976) [-582.902] (-578.477) -- 0:01:23
      394500 -- (-577.919) (-581.400) [-577.907] (-581.409) * (-584.120) [-585.057] (-581.963) (-581.850) -- 0:01:22
      395000 -- (-579.661) (-579.147) (-580.966) [-577.939] * [-578.873] (-575.885) (-581.015) (-578.477) -- 0:01:22

      Average standard deviation of split frequencies: 0.012925

      395500 -- (-584.204) [-580.705] (-582.859) (-581.133) * (-577.280) (-578.319) [-577.910] (-584.279) -- 0:01:22
      396000 -- (-581.692) [-578.302] (-582.603) (-582.899) * (-580.265) (-580.466) [-578.737] (-585.228) -- 0:01:22
      396500 -- [-580.686] (-581.984) (-583.155) (-579.994) * (-582.594) [-576.991] (-583.853) (-584.163) -- 0:01:22
      397000 -- (-576.471) [-577.528] (-580.263) (-579.996) * (-584.406) (-579.329) (-576.557) [-585.776] -- 0:01:22
      397500 -- (-581.923) [-578.964] (-581.242) (-581.175) * (-588.358) (-575.566) [-581.058] (-577.812) -- 0:01:21
      398000 -- (-581.761) [-584.213] (-589.992) (-573.793) * (-583.540) (-581.203) [-578.983] (-580.207) -- 0:01:21
      398500 -- [-578.525] (-581.983) (-585.684) (-578.344) * (-577.887) (-578.486) (-584.064) [-578.488] -- 0:01:23
      399000 -- [-575.459] (-582.812) (-582.037) (-579.318) * (-576.710) [-579.199] (-578.958) (-581.230) -- 0:01:22
      399500 -- (-579.714) (-585.527) [-583.552] (-580.786) * (-574.208) (-581.419) (-579.652) [-577.701] -- 0:01:22
      400000 -- (-583.516) [-576.833] (-580.849) (-574.233) * (-580.655) (-582.585) (-586.599) [-574.521] -- 0:01:22

      Average standard deviation of split frequencies: 0.011429

      400500 -- (-583.460) [-583.902] (-574.904) (-578.594) * (-583.995) (-578.293) (-577.987) [-583.763] -- 0:01:22
      401000 -- [-580.355] (-582.225) (-581.671) (-585.622) * (-580.244) (-576.716) (-574.230) [-579.598] -- 0:01:22
      401500 -- (-587.431) [-583.838] (-586.745) (-576.835) * (-577.539) (-579.014) (-581.090) [-578.429] -- 0:01:21
      402000 -- [-584.050] (-577.881) (-581.145) (-577.871) * (-581.215) [-581.272] (-582.050) (-581.486) -- 0:01:21
      402500 -- (-579.198) (-576.093) (-578.470) [-580.481] * (-578.396) [-583.628] (-589.047) (-575.916) -- 0:01:21
      403000 -- (-577.700) [-582.077] (-575.438) (-576.822) * (-577.503) (-584.832) (-591.888) [-580.585] -- 0:01:21
      403500 -- (-577.491) [-577.564] (-579.683) (-584.527) * (-578.577) [-587.092] (-585.585) (-576.497) -- 0:01:21
      404000 -- (-582.757) [-577.521] (-578.872) (-577.156) * (-582.607) (-585.700) (-588.950) [-578.059] -- 0:01:21
      404500 -- (-583.313) (-581.770) (-581.354) [-578.009] * [-577.028] (-583.901) (-583.538) (-581.081) -- 0:01:20
      405000 -- (-585.413) (-579.800) (-575.648) [-578.854] * [-576.392] (-581.472) (-592.270) (-580.609) -- 0:01:20

      Average standard deviation of split frequencies: 0.010284

      405500 -- [-579.763] (-584.701) (-575.139) (-581.375) * (-575.908) (-578.627) (-592.681) [-573.840] -- 0:01:22
      406000 -- [-578.522] (-579.351) (-575.931) (-584.354) * (-579.408) (-582.207) [-586.132] (-577.908) -- 0:01:21
      406500 -- (-576.591) (-578.259) (-585.647) [-576.927] * [-580.415] (-580.276) (-583.428) (-584.398) -- 0:01:21
      407000 -- (-580.558) (-573.980) (-583.054) [-580.077] * (-577.940) [-577.277] (-579.262) (-577.623) -- 0:01:21
      407500 -- [-581.022] (-580.736) (-580.997) (-578.896) * (-581.053) (-578.072) [-581.133] (-578.594) -- 0:01:21
      408000 -- (-578.730) (-583.418) [-578.239] (-580.569) * (-581.303) (-577.725) (-581.906) [-576.321] -- 0:01:21
      408500 -- (-581.170) (-581.733) (-581.589) [-573.653] * [-580.011] (-582.753) (-577.028) (-575.687) -- 0:01:21
      409000 -- (-576.029) (-579.512) (-579.787) [-578.734] * (-583.345) (-590.970) (-582.621) [-580.143] -- 0:01:20
      409500 -- [-577.464] (-583.481) (-576.164) (-584.845) * (-578.419) [-582.317] (-587.239) (-575.704) -- 0:01:20
      410000 -- (-578.623) (-581.821) [-578.927] (-576.689) * (-580.252) (-576.059) (-577.511) [-578.835] -- 0:01:20

      Average standard deviation of split frequencies: 0.009675

      410500 -- (-585.239) (-583.105) (-581.349) [-575.812] * (-583.050) (-577.934) [-585.787] (-579.788) -- 0:01:20
      411000 -- (-577.327) [-578.991] (-583.359) (-580.741) * [-584.529] (-581.719) (-576.775) (-583.560) -- 0:01:20
      411500 -- [-574.873] (-581.712) (-583.237) (-577.389) * (-579.820) (-579.291) (-580.545) [-574.079] -- 0:01:20
      412000 -- (-579.655) (-578.031) [-581.539] (-579.896) * [-577.745] (-578.620) (-580.402) (-578.264) -- 0:01:19
      412500 -- [-580.608] (-574.806) (-586.606) (-578.647) * (-574.385) (-579.584) [-574.627] (-577.133) -- 0:01:19
      413000 -- (-574.390) (-574.065) (-584.635) [-577.519] * [-576.577] (-584.376) (-575.832) (-577.607) -- 0:01:21
      413500 -- (-582.109) (-584.972) (-581.889) [-579.791] * (-587.375) (-577.904) (-580.801) [-574.858] -- 0:01:20
      414000 -- [-580.621] (-579.528) (-578.389) (-583.886) * (-577.610) (-577.789) [-581.662] (-579.319) -- 0:01:20
      414500 -- (-576.617) (-579.409) [-582.067] (-579.010) * (-578.218) (-579.784) (-584.917) [-575.548] -- 0:01:20
      415000 -- (-580.007) (-576.853) (-583.816) [-577.054] * (-574.825) [-574.951] (-577.064) (-579.180) -- 0:01:20

      Average standard deviation of split frequencies: 0.010199

      415500 -- (-583.556) (-577.935) (-577.064) [-575.933] * (-581.402) (-576.221) (-577.618) [-578.987] -- 0:01:20
      416000 -- (-587.738) (-576.469) (-575.961) [-575.435] * (-583.689) [-573.894] (-577.140) (-577.456) -- 0:01:20
      416500 -- [-577.527] (-580.199) (-575.525) (-582.648) * (-582.970) (-580.009) (-580.679) [-581.242] -- 0:01:19
      417000 -- (-575.028) (-581.860) [-580.382] (-578.317) * (-589.279) (-576.290) (-585.413) [-577.784] -- 0:01:19
      417500 -- (-572.593) (-580.459) [-579.909] (-588.005) * (-581.070) [-578.930] (-579.785) (-573.050) -- 0:01:19
      418000 -- (-585.146) (-578.897) (-580.632) [-579.085] * (-581.559) [-578.957] (-585.088) (-581.804) -- 0:01:19
      418500 -- (-581.064) (-582.592) (-578.655) [-574.169] * (-588.134) [-576.369] (-577.850) (-577.074) -- 0:01:19
      419000 -- (-584.323) (-575.705) (-578.090) [-573.989] * (-587.641) [-575.050] (-575.697) (-587.136) -- 0:01:19
      419500 -- (-580.289) (-578.222) [-578.238] (-575.329) * (-594.958) [-575.429] (-580.860) (-579.616) -- 0:01:18
      420000 -- (-589.692) (-577.778) (-573.728) [-578.537] * (-582.011) (-575.155) [-575.987] (-576.753) -- 0:01:18

      Average standard deviation of split frequencies: 0.008325

      420500 -- (-579.287) (-576.867) [-577.770] (-577.262) * (-581.140) (-583.308) (-577.319) [-579.622] -- 0:01:19
      421000 -- (-587.784) (-583.683) (-578.304) [-583.041] * (-580.455) (-578.865) [-574.697] (-579.233) -- 0:01:19
      421500 -- [-576.752] (-583.904) (-580.923) (-579.685) * (-580.899) [-579.365] (-581.731) (-583.804) -- 0:01:19
      422000 -- (-583.079) (-586.712) [-578.292] (-577.546) * (-580.648) (-581.929) [-583.134] (-581.493) -- 0:01:19
      422500 -- (-595.550) (-579.928) [-575.228] (-578.556) * (-581.063) [-579.337] (-589.469) (-582.722) -- 0:01:19
      423000 -- (-586.553) (-581.045) (-581.414) [-583.282] * [-580.004] (-573.414) (-576.203) (-575.703) -- 0:01:19
      423500 -- (-583.342) (-577.103) [-575.458] (-584.392) * (-579.924) (-578.507) [-582.029] (-578.465) -- 0:01:18
      424000 -- (-581.314) (-576.396) (-580.695) [-579.385] * (-580.269) [-581.381] (-580.143) (-579.205) -- 0:01:18
      424500 -- (-576.053) [-575.580] (-582.448) (-579.837) * (-582.771) (-580.676) (-577.120) [-578.139] -- 0:01:18
      425000 -- (-575.983) [-579.235] (-578.061) (-578.209) * (-579.267) (-582.701) (-579.846) [-578.414] -- 0:01:18

      Average standard deviation of split frequencies: 0.009643

      425500 -- (-584.078) (-582.144) [-578.978] (-580.816) * (-590.915) (-585.745) (-585.302) [-578.621] -- 0:01:18
      426000 -- (-584.147) (-577.108) (-578.183) [-579.345] * (-580.654) [-580.803] (-580.996) (-578.262) -- 0:01:18
      426500 -- (-581.990) (-583.083) [-584.317] (-577.148) * (-579.870) (-583.048) [-581.258] (-585.216) -- 0:01:17
      427000 -- (-588.562) (-576.581) (-577.758) [-574.990] * (-584.871) (-577.011) [-580.277] (-581.668) -- 0:01:17
      427500 -- (-584.001) (-591.323) (-578.966) [-573.923] * (-586.001) (-577.968) [-581.046] (-581.299) -- 0:01:19
      428000 -- (-585.995) (-577.634) (-581.751) [-580.765] * [-582.339] (-587.683) (-585.219) (-582.017) -- 0:01:18
      428500 -- (-583.066) (-582.713) (-576.423) [-575.856] * (-581.260) [-579.616] (-583.991) (-579.936) -- 0:01:18
      429000 -- (-580.016) (-576.133) [-582.304] (-575.149) * (-579.879) [-574.327] (-585.110) (-579.109) -- 0:01:18
      429500 -- [-585.408] (-581.045) (-588.485) (-583.022) * (-578.806) [-577.802] (-582.321) (-582.045) -- 0:01:18
      430000 -- (-581.765) (-580.693) [-577.593] (-576.134) * (-579.730) (-579.146) (-585.281) [-579.662] -- 0:01:18

      Average standard deviation of split frequencies: 0.010320

      430500 -- (-579.320) (-583.381) [-575.505] (-576.144) * [-579.671] (-584.780) (-580.827) (-578.397) -- 0:01:18
      431000 -- (-577.155) (-581.096) (-585.975) [-578.930] * (-581.559) [-578.317] (-583.304) (-580.038) -- 0:01:17
      431500 -- (-582.522) (-578.283) (-580.712) [-580.481] * (-584.253) (-580.258) (-581.372) [-585.274] -- 0:01:17
      432000 -- (-590.207) (-579.587) [-578.276] (-580.006) * [-583.964] (-585.378) (-582.111) (-584.114) -- 0:01:17
      432500 -- [-578.424] (-576.959) (-578.240) (-581.688) * [-582.207] (-583.383) (-585.255) (-582.383) -- 0:01:17
      433000 -- (-585.124) [-577.372] (-581.053) (-577.334) * (-588.031) (-576.981) [-579.125] (-577.358) -- 0:01:17
      433500 -- (-578.496) (-575.223) (-584.302) [-577.159] * (-579.729) [-577.754] (-579.136) (-578.362) -- 0:01:17
      434000 -- [-575.631] (-576.513) (-585.255) (-577.645) * (-578.999) [-580.698] (-578.526) (-586.529) -- 0:01:16
      434500 -- [-580.222] (-578.667) (-573.086) (-581.028) * [-575.015] (-575.010) (-581.252) (-576.730) -- 0:01:16
      435000 -- [-582.681] (-585.576) (-579.956) (-579.668) * [-579.840] (-576.613) (-583.822) (-575.899) -- 0:01:17

      Average standard deviation of split frequencies: 0.009422

      435500 -- (-580.013) [-576.205] (-585.383) (-579.608) * (-578.485) (-577.787) [-581.240] (-579.573) -- 0:01:17
      436000 -- [-575.787] (-579.687) (-583.375) (-581.337) * (-581.325) [-577.646] (-581.711) (-582.742) -- 0:01:17
      436500 -- (-573.777) (-582.882) [-583.318] (-579.591) * (-578.851) (-581.774) (-579.559) [-579.996] -- 0:01:17
      437000 -- (-579.295) (-583.306) (-582.372) [-577.072] * (-584.618) (-576.869) [-580.175] (-579.327) -- 0:01:17
      437500 -- (-580.274) (-574.987) (-577.444) [-578.209] * (-579.969) (-579.696) (-578.023) [-576.118] -- 0:01:17
      438000 -- (-577.819) (-576.360) (-576.634) [-577.639] * (-580.120) (-581.525) [-584.491] (-575.272) -- 0:01:16
      438500 -- (-574.857) (-578.793) [-587.558] (-578.181) * (-575.358) (-577.612) [-578.774] (-577.509) -- 0:01:16
      439000 -- (-575.379) (-577.414) [-579.741] (-576.482) * [-580.220] (-576.719) (-579.860) (-579.681) -- 0:01:16
      439500 -- (-575.478) (-579.894) [-579.052] (-579.580) * (-582.170) (-583.751) (-583.767) [-575.752] -- 0:01:16
      440000 -- (-577.957) (-577.584) (-587.326) [-577.728] * (-580.581) (-583.493) (-584.822) [-573.527] -- 0:01:16

      Average standard deviation of split frequencies: 0.009933

      440500 -- (-577.622) (-579.332) (-576.713) [-579.903] * (-585.389) (-574.771) [-577.715] (-575.471) -- 0:01:16
      441000 -- (-579.956) [-579.442] (-578.169) (-576.582) * (-588.104) (-581.631) [-574.797] (-574.462) -- 0:01:16
      441500 -- [-582.567] (-576.808) (-582.274) (-577.283) * (-578.765) [-575.965] (-577.291) (-578.584) -- 0:01:15
      442000 -- (-576.985) [-579.806] (-583.514) (-581.389) * [-576.532] (-576.705) (-578.472) (-590.497) -- 0:01:17
      442500 -- [-576.502] (-579.445) (-578.678) (-581.169) * [-580.646] (-578.829) (-582.461) (-580.790) -- 0:01:16
      443000 -- [-578.284] (-580.931) (-578.080) (-585.017) * (-585.112) [-575.264] (-582.303) (-580.150) -- 0:01:16
      443500 -- (-582.540) (-582.956) (-578.694) [-579.630] * (-578.413) (-574.765) (-586.733) [-575.506] -- 0:01:16
      444000 -- (-579.349) (-577.379) (-582.428) [-580.144] * [-577.190] (-577.807) (-576.851) (-578.323) -- 0:01:16
      444500 -- [-575.079] (-583.426) (-577.801) (-580.570) * (-580.825) (-579.385) [-579.421] (-581.740) -- 0:01:16
      445000 -- [-576.277] (-583.519) (-580.048) (-582.845) * (-579.897) (-581.194) (-578.970) [-573.600] -- 0:01:16

      Average standard deviation of split frequencies: 0.009664

      445500 -- (-580.785) (-582.564) [-578.280] (-585.055) * (-579.481) (-577.713) (-579.763) [-576.929] -- 0:01:15
      446000 -- (-580.342) [-574.921] (-578.801) (-578.916) * (-580.448) [-580.025] (-583.466) (-582.427) -- 0:01:15
      446500 -- [-576.622] (-576.969) (-578.877) (-582.808) * (-580.042) [-576.848] (-577.153) (-575.579) -- 0:01:15
      447000 -- (-578.031) (-583.295) [-578.419] (-589.598) * (-579.235) (-577.970) (-575.500) [-578.552] -- 0:01:15
      447500 -- (-576.360) (-578.824) [-584.307] (-582.668) * (-576.382) [-574.916] (-579.019) (-576.125) -- 0:01:15
      448000 -- (-577.472) (-582.450) (-575.312) [-579.871] * [-578.600] (-582.651) (-579.422) (-589.560) -- 0:01:15
      448500 -- [-583.001] (-577.242) (-574.563) (-578.488) * (-577.385) (-577.430) (-579.157) [-578.209] -- 0:01:15
      449000 -- [-580.874] (-581.162) (-575.628) (-584.791) * (-578.559) (-573.755) (-581.358) [-579.812] -- 0:01:14
      449500 -- (-587.281) [-578.110] (-580.104) (-576.718) * [-578.661] (-578.529) (-587.396) (-583.906) -- 0:01:15
      450000 -- [-586.607] (-579.349) (-579.892) (-579.643) * (-583.426) (-597.506) (-580.913) [-578.988] -- 0:01:15

      Average standard deviation of split frequencies: 0.009414

      450500 -- (-578.181) [-573.194] (-575.439) (-582.527) * (-580.850) (-576.797) [-577.528] (-580.795) -- 0:01:15
      451000 -- (-585.636) [-579.434] (-581.970) (-575.576) * [-580.393] (-578.010) (-580.157) (-582.242) -- 0:01:15
      451500 -- (-589.476) (-580.510) (-578.179) [-575.449] * [-579.014] (-581.227) (-580.705) (-583.070) -- 0:01:15
      452000 -- (-582.962) (-585.303) [-577.834] (-586.539) * (-576.415) (-581.628) [-575.566] (-580.642) -- 0:01:15
      452500 -- (-583.795) (-581.627) [-577.002] (-582.918) * (-576.892) (-581.092) (-574.528) [-580.488] -- 0:01:15
      453000 -- [-582.879] (-578.878) (-579.243) (-578.310) * (-586.915) (-584.086) (-584.052) [-577.544] -- 0:01:14
      453500 -- (-582.840) [-575.851] (-577.871) (-580.191) * (-579.699) (-583.096) (-584.907) [-575.653] -- 0:01:14
      454000 -- (-580.472) [-574.829] (-576.599) (-578.582) * (-586.150) (-577.417) (-584.595) [-578.823] -- 0:01:14
      454500 -- (-577.859) (-577.733) (-579.808) [-579.372] * (-578.097) (-590.472) (-579.050) [-574.186] -- 0:01:14
      455000 -- (-584.391) [-576.820] (-588.387) (-576.773) * (-585.962) [-578.949] (-587.621) (-577.358) -- 0:01:14

      Average standard deviation of split frequencies: 0.009304

      455500 -- (-585.124) (-581.393) [-575.273] (-576.681) * (-578.314) [-578.551] (-585.986) (-575.683) -- 0:01:14
      456000 -- [-582.853] (-587.068) (-579.320) (-579.894) * (-581.998) (-583.572) [-579.144] (-580.584) -- 0:01:13
      456500 -- [-583.878] (-581.139) (-578.802) (-578.416) * (-582.814) (-579.670) (-583.822) [-579.387] -- 0:01:13
      457000 -- (-581.981) (-582.362) [-578.148] (-582.347) * (-579.408) (-574.909) (-579.869) [-579.305] -- 0:01:14
      457500 -- (-581.893) (-580.750) [-575.054] (-577.532) * (-585.741) (-576.963) [-579.343] (-577.476) -- 0:01:14
      458000 -- (-585.215) [-578.574] (-580.608) (-576.709) * (-575.761) (-582.826) (-581.787) [-579.299] -- 0:01:14
      458500 -- (-581.648) (-576.052) [-578.588] (-583.131) * (-583.553) (-582.593) [-577.683] (-581.746) -- 0:01:14
      459000 -- (-586.131) (-581.526) [-580.112] (-578.985) * (-583.830) (-581.460) [-575.077] (-577.533) -- 0:01:14
      459500 -- [-578.107] (-579.189) (-581.152) (-582.151) * (-578.457) (-592.790) (-582.324) [-577.739] -- 0:01:14
      460000 -- (-581.179) [-579.783] (-579.204) (-583.596) * (-578.035) (-581.692) (-581.137) [-578.130] -- 0:01:13

      Average standard deviation of split frequencies: 0.009648

      460500 -- (-579.769) (-579.232) (-576.055) [-577.643] * (-588.409) (-577.504) (-579.713) [-577.498] -- 0:01:13
      461000 -- (-577.566) (-580.572) [-586.145] (-584.056) * [-580.222] (-582.718) (-578.536) (-580.644) -- 0:01:13
      461500 -- (-578.058) [-574.828] (-573.932) (-575.638) * (-578.548) (-585.714) [-579.334] (-578.380) -- 0:01:13
      462000 -- (-577.993) (-579.766) (-577.160) [-574.687] * (-577.318) (-579.962) [-593.374] (-579.460) -- 0:01:13
      462500 -- [-585.656] (-578.454) (-577.983) (-578.339) * (-577.257) (-577.733) [-575.456] (-576.593) -- 0:01:13
      463000 -- (-582.406) [-577.849] (-581.308) (-576.881) * (-578.375) [-580.057] (-580.804) (-584.267) -- 0:01:13
      463500 -- (-579.373) (-582.495) (-582.533) [-583.481] * (-581.135) (-588.309) (-576.292) [-581.565] -- 0:01:12
      464000 -- (-575.957) (-583.960) (-577.760) [-574.068] * (-578.585) (-582.191) (-581.490) [-578.399] -- 0:01:13
      464500 -- (-577.402) (-576.797) [-577.960] (-588.745) * [-580.543] (-583.457) (-581.528) (-581.291) -- 0:01:13
      465000 -- (-580.913) (-577.098) (-584.113) [-579.490] * [-582.933] (-583.472) (-579.623) (-578.523) -- 0:01:13

      Average standard deviation of split frequencies: 0.009682

      465500 -- (-575.701) (-576.282) [-587.618] (-577.896) * (-584.087) (-584.843) [-586.605] (-588.757) -- 0:01:13
      466000 -- (-577.941) [-578.983] (-584.089) (-583.659) * (-587.006) (-583.099) [-581.174] (-582.436) -- 0:01:13
      466500 -- (-581.703) [-577.627] (-586.027) (-577.925) * [-578.307] (-583.391) (-573.308) (-580.648) -- 0:01:13
      467000 -- (-577.885) (-579.801) (-586.251) [-577.829] * (-581.694) (-579.040) [-573.679] (-574.865) -- 0:01:13
      467500 -- (-585.523) (-586.350) (-580.596) [-580.289] * (-582.887) (-582.395) (-583.006) [-578.192] -- 0:01:12
      468000 -- (-584.139) (-585.598) [-574.877] (-583.163) * [-583.111] (-580.440) (-582.299) (-583.731) -- 0:01:12
      468500 -- (-578.138) (-581.273) (-577.118) [-580.574] * (-585.851) (-580.438) [-574.075] (-588.386) -- 0:01:12
      469000 -- (-581.647) (-588.512) [-578.290] (-580.661) * [-580.095] (-586.039) (-583.257) (-594.808) -- 0:01:12
      469500 -- (-584.280) (-577.609) (-583.613) [-580.027] * (-576.765) (-585.912) (-577.001) [-584.468] -- 0:01:12
      470000 -- (-586.305) (-586.090) (-586.570) [-582.114] * (-581.402) (-579.440) [-581.618] (-580.683) -- 0:01:12

      Average standard deviation of split frequencies: 0.009873

      470500 -- (-574.795) (-582.982) (-578.461) [-579.134] * [-579.179] (-582.589) (-575.518) (-590.334) -- 0:01:12
      471000 -- (-579.966) [-576.686] (-576.951) (-583.497) * [-576.088] (-579.909) (-579.038) (-581.153) -- 0:01:11
      471500 -- (-579.357) (-584.476) [-574.581] (-584.364) * (-575.478) (-579.412) [-575.146] (-582.785) -- 0:01:12
      472000 -- (-587.709) (-587.349) [-576.099] (-578.912) * (-583.370) (-577.040) [-583.504] (-588.527) -- 0:01:12
      472500 -- [-573.208] (-578.092) (-576.906) (-583.014) * [-578.586] (-577.100) (-577.386) (-582.564) -- 0:01:12
      473000 -- (-579.391) (-573.468) (-576.492) [-578.301] * [-578.246] (-579.379) (-584.190) (-587.456) -- 0:01:12
      473500 -- (-573.550) (-577.850) [-575.778] (-583.410) * (-588.621) (-578.294) (-582.535) [-579.375] -- 0:01:12
      474000 -- (-578.198) [-575.008] (-575.872) (-584.944) * [-582.161] (-583.057) (-578.662) (-580.795) -- 0:01:12
      474500 -- (-582.774) (-575.506) [-577.499] (-583.557) * (-581.896) [-585.466] (-578.452) (-583.061) -- 0:01:11
      475000 -- (-577.309) [-579.387] (-582.249) (-587.337) * (-581.045) [-576.071] (-579.980) (-586.063) -- 0:01:11

      Average standard deviation of split frequencies: 0.009479

      475500 -- (-575.276) [-577.510] (-580.236) (-584.113) * (-586.397) [-581.044] (-576.180) (-583.045) -- 0:01:11
      476000 -- (-577.396) (-583.264) [-575.034] (-585.122) * [-580.611] (-584.651) (-580.592) (-580.639) -- 0:01:11
      476500 -- [-579.956] (-577.703) (-586.327) (-583.497) * (-583.957) (-579.899) [-580.295] (-581.458) -- 0:01:11
      477000 -- [-581.546] (-582.970) (-580.212) (-577.679) * (-581.186) [-577.381] (-574.922) (-582.066) -- 0:01:11
      477500 -- (-582.594) (-577.214) (-583.779) [-578.047] * (-588.828) (-579.480) (-578.500) [-580.957] -- 0:01:11
      478000 -- [-580.957] (-581.728) (-583.739) (-576.593) * [-584.602] (-576.669) (-584.765) (-583.077) -- 0:01:10
      478500 -- [-581.659] (-580.471) (-578.185) (-576.160) * [-584.915] (-579.150) (-583.955) (-580.055) -- 0:01:10
      479000 -- [-577.589] (-585.290) (-580.306) (-577.246) * (-581.393) (-581.817) (-579.640) [-584.678] -- 0:01:11
      479500 -- (-583.908) (-584.319) [-582.290] (-578.716) * (-577.226) (-590.740) [-576.481] (-579.668) -- 0:01:11
      480000 -- (-577.465) (-576.384) [-584.425] (-581.485) * [-574.378] (-586.404) (-575.507) (-577.819) -- 0:01:11

      Average standard deviation of split frequencies: 0.011489

      480500 -- (-583.027) (-583.749) (-581.604) [-577.481] * (-582.354) (-585.774) [-578.635] (-587.258) -- 0:01:11
      481000 -- [-581.923] (-586.468) (-581.055) (-575.114) * (-581.018) [-579.959] (-578.305) (-580.947) -- 0:01:11
      481500 -- (-579.118) (-579.042) (-579.326) [-582.166] * [-578.908] (-574.150) (-579.157) (-575.145) -- 0:01:11
      482000 -- (-579.164) (-582.688) (-582.700) [-579.248] * (-584.219) (-583.385) (-583.445) [-574.612] -- 0:01:10
      482500 -- (-584.403) (-577.837) [-574.373] (-577.872) * (-585.151) (-580.598) (-574.253) [-577.699] -- 0:01:10
      483000 -- (-580.574) [-577.071] (-583.039) (-576.445) * [-579.223] (-578.790) (-577.829) (-575.835) -- 0:01:10
      483500 -- (-582.242) (-577.356) [-580.596] (-577.988) * (-576.775) (-581.544) [-575.896] (-577.790) -- 0:01:10
      484000 -- (-576.797) [-581.536] (-586.422) (-575.452) * (-577.703) (-585.232) [-578.159] (-589.974) -- 0:01:10
      484500 -- [-576.356] (-577.115) (-586.084) (-574.579) * [-578.536] (-582.527) (-578.187) (-579.004) -- 0:01:10
      485000 -- (-581.212) (-580.001) (-580.169) [-579.356] * [-578.753] (-587.067) (-579.094) (-580.061) -- 0:01:10

      Average standard deviation of split frequencies: 0.011501

      485500 -- (-581.593) (-585.772) [-582.467] (-574.408) * (-579.583) [-580.796] (-575.055) (-580.381) -- 0:01:09
      486000 -- (-577.869) (-581.674) (-579.036) [-582.331] * (-579.187) (-581.416) (-580.060) [-576.619] -- 0:01:09
      486500 -- (-575.942) [-582.689] (-583.086) (-585.331) * [-579.299] (-589.402) (-581.254) (-585.218) -- 0:01:10
      487000 -- [-581.209] (-576.824) (-578.621) (-572.829) * [-580.374] (-582.946) (-579.112) (-578.804) -- 0:01:10
      487500 -- (-578.717) (-576.633) [-580.736] (-575.605) * (-583.985) (-576.615) (-576.667) [-578.902] -- 0:01:10
      488000 -- (-578.901) [-575.474] (-582.599) (-583.851) * (-585.712) [-585.690] (-574.587) (-578.181) -- 0:01:10
      488500 -- (-581.533) (-585.569) (-579.509) [-581.299] * (-585.103) (-582.130) [-580.685] (-577.702) -- 0:01:10
      489000 -- (-581.315) [-579.145] (-579.324) (-577.978) * [-578.905] (-585.596) (-578.281) (-578.582) -- 0:01:10
      489500 -- [-577.735] (-580.753) (-577.391) (-576.652) * (-583.548) (-580.946) (-581.069) [-578.104] -- 0:01:09
      490000 -- [-581.157] (-573.631) (-576.639) (-580.638) * (-583.613) [-581.859] (-584.214) (-577.099) -- 0:01:09

      Average standard deviation of split frequencies: 0.010843

      490500 -- (-578.520) (-578.128) [-576.579] (-579.167) * (-582.506) (-578.110) [-577.349] (-575.408) -- 0:01:09
      491000 -- (-581.180) (-578.180) [-578.067] (-584.390) * (-580.071) (-580.632) (-577.627) [-578.146] -- 0:01:09
      491500 -- (-590.066) (-578.617) (-581.059) [-577.563] * (-584.158) [-582.662] (-577.241) (-576.924) -- 0:01:09
      492000 -- [-580.920] (-579.051) (-575.969) (-577.312) * (-579.783) (-578.819) [-581.327] (-578.960) -- 0:01:09
      492500 -- (-587.440) (-582.258) (-575.664) [-579.731] * (-579.930) [-575.800] (-581.716) (-578.625) -- 0:01:09
      493000 -- (-586.196) [-582.099] (-580.847) (-581.355) * (-581.492) (-580.856) (-577.040) [-581.354] -- 0:01:08
      493500 -- (-578.783) (-577.166) [-577.009] (-578.369) * (-580.371) (-577.114) [-576.818] (-583.223) -- 0:01:09
      494000 -- (-591.158) (-585.573) (-577.790) [-584.128] * [-577.217] (-585.642) (-588.806) (-580.954) -- 0:01:09
      494500 -- [-581.664] (-589.260) (-573.697) (-585.384) * [-572.508] (-575.215) (-581.260) (-580.563) -- 0:01:09
      495000 -- (-579.263) (-585.921) [-579.777] (-584.571) * (-574.230) (-576.129) (-583.341) [-582.999] -- 0:01:09

      Average standard deviation of split frequencies: 0.010726

      495500 -- (-581.887) (-576.415) [-576.084] (-579.924) * (-576.692) (-587.275) (-582.288) [-577.915] -- 0:01:09
      496000 -- (-580.772) (-579.277) [-574.218] (-580.990) * [-581.091] (-575.391) (-582.158) (-577.228) -- 0:01:09
      496500 -- (-581.519) (-576.291) [-575.962] (-578.513) * [-586.168] (-579.651) (-588.010) (-586.699) -- 0:01:08
      497000 -- [-580.066] (-581.557) (-581.712) (-584.177) * [-577.882] (-583.089) (-589.331) (-579.545) -- 0:01:08
      497500 -- (-584.716) [-577.395] (-582.448) (-573.956) * (-580.391) (-580.467) (-580.807) [-583.863] -- 0:01:08
      498000 -- (-590.128) [-579.869] (-581.868) (-574.830) * (-578.957) [-580.528] (-583.292) (-581.010) -- 0:01:08
      498500 -- (-579.042) (-571.727) [-577.568] (-578.799) * (-576.010) (-579.228) [-578.620] (-579.436) -- 0:01:08
      499000 -- (-578.437) (-578.130) [-580.103] (-584.138) * (-577.509) (-581.572) [-584.950] (-582.365) -- 0:01:08
      499500 -- [-581.141] (-583.560) (-578.492) (-574.721) * [-576.360] (-580.574) (-583.468) (-579.744) -- 0:01:08
      500000 -- [-577.022] (-584.860) (-581.490) (-577.554) * [-578.085] (-588.302) (-588.118) (-584.108) -- 0:01:08

      Average standard deviation of split frequencies: 0.011030

      500500 -- (-577.620) (-586.442) (-576.995) [-577.891] * (-577.057) [-573.937] (-589.864) (-583.470) -- 0:01:07
      501000 -- (-583.389) (-576.728) [-578.153] (-576.284) * (-582.645) (-576.644) [-581.618] (-583.666) -- 0:01:08
      501500 -- (-575.666) (-581.997) [-579.229] (-576.469) * (-579.624) [-576.367] (-585.341) (-579.938) -- 0:01:08
      502000 -- (-577.577) (-578.924) (-580.530) [-577.864] * (-576.126) [-582.014] (-588.852) (-580.774) -- 0:01:08
      502500 -- (-580.500) (-589.107) (-575.712) [-580.006] * [-575.344] (-579.810) (-578.256) (-583.648) -- 0:01:08
      503000 -- [-576.723] (-575.989) (-579.562) (-580.271) * (-571.920) [-579.458] (-586.313) (-582.510) -- 0:01:08
      503500 -- (-578.905) (-579.692) (-577.328) [-575.121] * (-580.621) (-586.307) [-581.115] (-592.007) -- 0:01:08
      504000 -- (-582.601) (-581.071) (-579.437) [-578.363] * [-578.977] (-581.691) (-578.372) (-591.866) -- 0:01:07
      504500 -- [-581.440] (-590.974) (-584.363) (-577.086) * [-575.893] (-580.932) (-580.618) (-584.780) -- 0:01:07
      505000 -- [-577.045] (-589.194) (-582.297) (-576.681) * (-576.541) (-579.493) (-581.734) [-579.541] -- 0:01:07

      Average standard deviation of split frequencies: 0.009849

      505500 -- (-576.535) (-595.286) [-584.080] (-582.250) * [-577.416] (-579.727) (-582.738) (-577.438) -- 0:01:07
      506000 -- (-575.700) (-591.800) (-574.860) [-576.773] * [-577.823] (-583.081) (-577.267) (-583.008) -- 0:01:07
      506500 -- (-584.281) (-585.516) (-581.832) [-573.050] * [-577.042] (-579.968) (-581.865) (-579.841) -- 0:01:07
      507000 -- (-586.268) [-586.282] (-581.098) (-574.779) * [-583.170] (-575.969) (-582.282) (-576.743) -- 0:01:07
      507500 -- (-578.806) (-579.501) [-578.795] (-577.275) * [-577.354] (-579.617) (-584.021) (-582.519) -- 0:01:06
      508000 -- (-577.419) [-575.376] (-579.979) (-576.505) * (-576.379) (-581.454) (-579.085) [-575.720] -- 0:01:06
      508500 -- [-579.967] (-575.112) (-575.053) (-578.964) * (-582.496) (-582.301) (-577.116) [-581.338] -- 0:01:07
      509000 -- (-583.342) (-580.376) (-578.339) [-586.146] * (-575.641) [-574.074] (-575.612) (-583.564) -- 0:01:07
      509500 -- [-575.841] (-573.398) (-574.890) (-579.039) * (-578.569) [-576.112] (-580.395) (-586.527) -- 0:01:07
      510000 -- (-582.810) [-578.151] (-577.231) (-577.896) * (-577.507) (-584.774) (-579.354) [-576.001] -- 0:01:07

      Average standard deviation of split frequencies: 0.009495

      510500 -- (-581.671) [-578.345] (-582.349) (-576.742) * [-577.924] (-580.062) (-575.844) (-578.028) -- 0:01:07
      511000 -- (-579.427) [-581.512] (-578.640) (-577.123) * (-573.777) (-580.872) [-576.791] (-578.915) -- 0:01:06
      511500 -- (-579.143) [-590.484] (-579.112) (-581.775) * [-575.633] (-578.954) (-575.945) (-579.711) -- 0:01:06
      512000 -- (-583.982) [-580.070] (-577.346) (-579.702) * (-576.424) [-577.664] (-581.133) (-584.523) -- 0:01:06
      512500 -- [-578.477] (-578.523) (-591.917) (-578.415) * [-575.917] (-576.911) (-578.899) (-588.620) -- 0:01:06
      513000 -- (-575.630) (-579.069) (-579.508) [-578.039] * [-576.639] (-577.979) (-579.325) (-586.842) -- 0:01:06
      513500 -- (-579.020) [-578.046] (-582.624) (-583.338) * (-579.250) (-582.668) (-584.416) [-579.565] -- 0:01:06
      514000 -- [-575.229] (-584.130) (-577.277) (-583.740) * (-580.675) (-577.628) [-577.890] (-582.019) -- 0:01:06
      514500 -- [-579.113] (-576.988) (-581.628) (-585.492) * (-580.081) (-578.975) (-577.442) [-575.752] -- 0:01:06
      515000 -- (-582.439) (-578.965) [-575.011] (-590.184) * [-578.500] (-583.847) (-575.623) (-577.198) -- 0:01:05

      Average standard deviation of split frequencies: 0.010180

      515500 -- (-576.827) [-575.019] (-574.107) (-577.537) * (-581.271) (-585.173) [-574.451] (-582.831) -- 0:01:06
      516000 -- (-582.937) (-580.785) [-577.453] (-580.823) * (-578.480) (-583.203) (-584.400) [-582.642] -- 0:01:06
      516500 -- (-583.250) [-577.669] (-576.333) (-583.370) * (-576.581) (-581.146) [-583.401] (-584.502) -- 0:01:06
      517000 -- (-582.251) (-574.823) [-577.563] (-583.804) * (-580.938) (-580.298) [-580.433] (-583.754) -- 0:01:06
      517500 -- [-575.307] (-577.411) (-581.222) (-578.785) * (-578.862) (-581.630) (-576.567) [-581.672] -- 0:01:06
      518000 -- [-578.598] (-581.332) (-584.278) (-579.462) * (-576.353) (-585.530) (-577.982) [-575.708] -- 0:01:06
      518500 -- (-576.610) [-577.533] (-574.597) (-579.993) * (-581.071) [-577.779] (-579.977) (-583.581) -- 0:01:05
      519000 -- [-581.396] (-580.043) (-576.366) (-579.182) * (-577.802) (-586.068) (-581.021) [-578.847] -- 0:01:05
      519500 -- (-575.918) (-582.037) [-581.356] (-581.176) * (-578.018) (-587.765) [-580.203] (-586.021) -- 0:01:05
      520000 -- [-574.637] (-576.684) (-584.299) (-585.327) * [-579.159] (-584.966) (-579.186) (-580.890) -- 0:01:05

      Average standard deviation of split frequencies: 0.009959

      520500 -- (-579.848) (-579.608) (-596.292) [-580.929] * [-579.254] (-582.405) (-584.798) (-583.787) -- 0:01:05
      521000 -- [-579.584] (-583.336) (-580.662) (-575.323) * (-579.896) (-580.035) (-584.655) [-576.315] -- 0:01:05
      521500 -- (-588.303) (-581.966) [-577.491] (-579.150) * (-579.594) (-582.117) [-580.077] (-575.837) -- 0:01:05
      522000 -- (-583.752) (-581.346) (-585.601) [-578.045] * (-584.198) (-586.886) (-580.964) [-581.179] -- 0:01:05
      522500 -- [-578.999] (-583.514) (-582.033) (-576.035) * (-582.601) (-576.799) (-585.510) [-576.951] -- 0:01:04
      523000 -- (-576.677) (-582.730) (-582.204) [-581.330] * (-576.814) [-583.569] (-587.874) (-577.354) -- 0:01:05
      523500 -- (-585.317) [-584.331] (-586.813) (-579.299) * (-579.151) (-578.610) (-587.904) [-576.527] -- 0:01:05
      524000 -- (-585.599) [-579.652] (-580.477) (-578.887) * [-576.971] (-576.998) (-583.271) (-579.092) -- 0:01:05
      524500 -- (-586.764) [-581.899] (-587.439) (-577.822) * (-577.113) [-577.286] (-579.241) (-580.538) -- 0:01:05
      525000 -- [-584.469] (-582.133) (-579.248) (-583.559) * (-581.985) [-582.329] (-582.066) (-582.065) -- 0:01:05

      Average standard deviation of split frequencies: 0.009346

      525500 -- (-577.080) (-577.622) [-579.633] (-579.895) * (-576.100) (-579.769) [-580.534] (-577.858) -- 0:01:05
      526000 -- (-579.820) (-579.288) (-587.312) [-579.339] * [-586.091] (-579.356) (-584.297) (-581.856) -- 0:01:04
      526500 -- (-579.166) [-575.954] (-576.750) (-582.402) * (-578.123) [-583.136] (-586.175) (-580.738) -- 0:01:04
      527000 -- (-580.902) [-574.524] (-582.964) (-583.948) * (-586.801) (-579.273) (-577.977) [-575.223] -- 0:01:04
      527500 -- (-579.457) (-574.811) (-578.517) [-577.687] * (-578.667) (-580.380) [-575.607] (-577.062) -- 0:01:04
      528000 -- (-586.428) (-578.382) [-580.636] (-577.105) * [-576.708] (-577.914) (-585.835) (-576.717) -- 0:01:04
      528500 -- (-585.936) (-577.299) (-579.126) [-577.683] * (-579.274) [-580.870] (-582.627) (-576.705) -- 0:01:04
      529000 -- (-578.434) (-584.935) [-580.649] (-579.122) * (-583.402) (-578.551) [-580.401] (-589.012) -- 0:01:04
      529500 -- (-578.783) (-578.429) (-585.068) [-576.634] * (-579.992) (-579.962) [-581.389] (-582.108) -- 0:01:03
      530000 -- [-582.245] (-582.444) (-580.625) (-582.642) * (-583.228) [-576.987] (-578.356) (-578.478) -- 0:01:04

      Average standard deviation of split frequencies: 0.008249

      530500 -- (-581.775) (-582.585) [-578.930] (-580.034) * (-590.437) (-577.256) [-584.471] (-579.358) -- 0:01:04
      531000 -- (-581.389) [-580.839] (-584.455) (-573.384) * (-585.406) [-577.045] (-577.542) (-580.065) -- 0:01:04
      531500 -- (-582.009) (-577.296) (-580.411) [-580.273] * (-579.393) [-580.760] (-579.269) (-582.538) -- 0:01:04
      532000 -- (-576.487) [-579.521] (-578.761) (-574.822) * (-582.908) (-584.443) (-584.244) [-579.616] -- 0:01:04
      532500 -- (-579.635) (-582.552) (-580.141) [-576.355] * (-581.896) (-577.199) (-581.795) [-582.464] -- 0:01:04
      533000 -- (-587.143) (-587.788) [-575.310] (-578.965) * [-583.663] (-575.873) (-586.537) (-580.631) -- 0:01:03
      533500 -- (-577.326) (-584.431) [-577.261] (-581.765) * (-581.394) [-581.033] (-580.880) (-581.601) -- 0:01:03
      534000 -- (-579.309) [-580.430] (-582.179) (-587.431) * (-581.080) (-577.786) (-580.282) [-584.000] -- 0:01:03
      534500 -- (-580.885) (-580.038) [-577.798] (-584.178) * [-587.141] (-580.346) (-575.282) (-579.231) -- 0:01:03
      535000 -- (-584.349) [-583.263] (-579.084) (-576.872) * (-583.486) [-573.284] (-579.377) (-584.658) -- 0:01:03

      Average standard deviation of split frequencies: 0.007538

      535500 -- (-588.703) (-579.227) (-581.597) [-583.318] * [-579.652] (-582.042) (-580.364) (-588.214) -- 0:01:03
      536000 -- (-579.433) (-577.899) (-579.132) [-581.808] * (-580.962) [-577.775] (-576.159) (-583.464) -- 0:01:03
      536500 -- (-577.319) (-579.523) (-585.022) [-577.902] * (-578.391) [-580.610] (-578.749) (-581.995) -- 0:01:03
      537000 -- (-586.084) (-583.463) (-582.935) [-582.805] * (-577.139) [-577.912] (-578.860) (-578.551) -- 0:01:02
      537500 -- (-579.338) (-583.849) (-582.904) [-583.076] * (-578.225) (-574.995) [-583.281] (-578.963) -- 0:01:03
      538000 -- (-577.209) (-579.644) (-584.791) [-579.597] * (-580.138) (-576.097) [-572.385] (-578.259) -- 0:01:03
      538500 -- (-583.270) (-577.437) [-577.195] (-582.031) * [-575.381] (-580.957) (-582.352) (-576.946) -- 0:01:03
      539000 -- [-575.880] (-581.460) (-582.136) (-580.904) * (-580.046) (-577.307) [-581.844] (-579.923) -- 0:01:03
      539500 -- (-576.328) (-578.903) [-579.770] (-580.155) * (-581.653) (-579.013) [-578.874] (-578.087) -- 0:01:03
      540000 -- [-582.065] (-585.245) (-576.314) (-575.448) * (-578.055) (-581.701) (-579.151) [-576.612] -- 0:01:03

      Average standard deviation of split frequencies: 0.007224

      540500 -- [-578.450] (-585.312) (-579.103) (-577.380) * (-583.465) [-578.619] (-589.856) (-580.784) -- 0:01:02
      541000 -- [-575.743] (-582.721) (-582.001) (-580.922) * [-587.504] (-577.441) (-582.907) (-581.310) -- 0:01:02
      541500 -- [-575.571] (-577.849) (-575.686) (-584.261) * (-584.140) [-578.949] (-578.459) (-580.883) -- 0:01:02
      542000 -- [-580.790] (-582.539) (-575.810) (-582.253) * (-587.961) (-580.363) [-582.454] (-581.244) -- 0:01:02
      542500 -- [-580.925] (-580.564) (-584.898) (-579.172) * (-583.963) (-578.680) [-578.410] (-581.224) -- 0:01:02
      543000 -- [-578.320] (-576.288) (-578.332) (-578.317) * (-581.875) (-583.487) (-582.212) [-577.893] -- 0:01:02
      543500 -- [-576.018] (-578.232) (-583.375) (-578.676) * (-578.755) (-579.584) (-580.508) [-581.239] -- 0:01:02
      544000 -- [-578.749] (-577.811) (-578.437) (-580.262) * (-581.811) [-579.497] (-575.412) (-584.144) -- 0:01:02
      544500 -- [-575.089] (-578.994) (-577.126) (-576.690) * (-585.636) [-576.148] (-578.895) (-585.288) -- 0:01:02
      545000 -- (-581.050) (-578.030) (-583.857) [-579.930] * [-577.185] (-580.655) (-578.241) (-580.990) -- 0:01:02

      Average standard deviation of split frequencies: 0.006660

      545500 -- [-577.260] (-579.247) (-581.276) (-578.007) * (-579.400) (-577.150) (-583.118) [-580.513] -- 0:01:02
      546000 -- (-576.666) (-576.862) [-578.823] (-589.600) * [-582.403] (-584.380) (-579.234) (-579.726) -- 0:01:02
      546500 -- (-579.951) (-580.511) (-583.169) [-580.392] * (-580.450) (-582.703) (-580.904) [-578.578] -- 0:01:02
      547000 -- (-586.571) (-580.126) (-579.453) [-583.198] * (-584.131) (-588.115) (-576.213) [-574.801] -- 0:01:02
      547500 -- (-581.527) [-576.241] (-577.559) (-582.623) * (-577.393) [-576.338] (-586.219) (-577.210) -- 0:01:01
      548000 -- (-579.710) (-579.253) [-580.603] (-582.169) * (-576.439) [-575.836] (-577.696) (-581.461) -- 0:01:01
      548500 -- (-583.675) (-581.194) [-580.598] (-576.700) * (-581.052) [-577.028] (-574.744) (-574.734) -- 0:01:01
      549000 -- [-578.928] (-580.007) (-585.177) (-579.377) * (-578.215) (-576.936) [-578.135] (-578.973) -- 0:01:01
      549500 -- (-582.854) (-586.297) [-583.495] (-575.229) * (-578.076) (-577.510) [-580.015] (-578.895) -- 0:01:01
      550000 -- (-583.533) (-580.796) (-581.413) [-578.095] * (-575.980) (-580.012) (-580.932) [-576.503] -- 0:01:01

      Average standard deviation of split frequencies: 0.006482

      550500 -- (-582.939) (-575.823) [-576.285] (-587.735) * (-580.453) [-577.395] (-593.441) (-578.553) -- 0:01:01
      551000 -- (-579.525) (-573.768) (-578.171) [-577.167] * [-574.750] (-579.890) (-584.296) (-582.819) -- 0:01:01
      551500 -- (-578.480) [-579.099] (-575.077) (-579.859) * (-572.288) [-580.109] (-588.025) (-575.980) -- 0:01:00
      552000 -- (-581.665) (-580.066) [-577.400] (-580.783) * [-575.485] (-584.082) (-577.363) (-576.472) -- 0:01:01
      552500 -- (-585.008) (-582.468) [-576.434] (-581.766) * (-576.894) (-579.051) [-583.239] (-581.343) -- 0:01:01
      553000 -- (-587.941) [-575.736] (-582.417) (-577.181) * [-575.699] (-578.548) (-581.773) (-575.816) -- 0:01:01
      553500 -- (-584.207) (-576.500) [-576.009] (-578.152) * (-577.238) [-575.223] (-579.665) (-575.716) -- 0:01:01
      554000 -- (-579.339) [-575.477] (-574.939) (-578.251) * (-584.240) (-585.175) [-580.045] (-579.594) -- 0:01:01
      554500 -- (-578.782) (-580.722) (-585.787) [-581.417] * (-577.292) (-584.036) (-580.007) [-577.336] -- 0:01:01
      555000 -- [-575.388] (-577.530) (-577.208) (-581.615) * [-576.695] (-584.281) (-581.664) (-580.633) -- 0:01:00

      Average standard deviation of split frequencies: 0.006662

      555500 -- [-577.605] (-577.181) (-583.053) (-580.959) * [-574.875] (-579.814) (-578.327) (-582.654) -- 0:01:00
      556000 -- (-576.270) (-583.598) [-582.119] (-583.654) * (-577.520) (-586.620) (-580.232) [-579.113] -- 0:01:00
      556500 -- (-579.543) [-584.268] (-579.730) (-583.512) * [-581.380] (-584.468) (-579.345) (-574.766) -- 0:01:00
      557000 -- (-575.199) [-584.384] (-576.656) (-584.324) * (-580.489) (-586.579) [-579.935] (-579.627) -- 0:01:00
      557500 -- (-578.164) (-584.227) (-583.201) [-580.395] * (-577.601) [-581.476] (-577.321) (-581.705) -- 0:01:00
      558000 -- (-583.339) (-585.910) (-574.390) [-581.259] * [-578.701] (-576.151) (-578.464) (-586.450) -- 0:01:00
      558500 -- (-575.112) (-576.905) [-577.767] (-578.882) * [-575.926] (-578.888) (-582.050) (-580.098) -- 0:01:00
      559000 -- (-581.965) (-582.082) [-577.842] (-579.582) * (-576.574) [-586.315] (-582.050) (-582.439) -- 0:00:59
      559500 -- (-579.141) (-580.336) [-582.260] (-580.339) * (-584.677) (-587.093) [-577.850] (-578.837) -- 0:01:00
      560000 -- (-581.329) (-581.771) (-587.043) [-580.427] * (-578.166) (-580.868) [-577.870] (-578.437) -- 0:01:00

      Average standard deviation of split frequencies: 0.006486

      560500 -- [-582.028] (-575.961) (-586.661) (-581.334) * (-577.841) (-587.832) (-575.245) [-576.794] -- 0:01:00
      561000 -- (-580.968) (-582.852) (-585.696) [-576.533] * [-578.714] (-588.968) (-578.477) (-584.919) -- 0:01:00
      561500 -- (-578.838) (-581.672) [-582.640] (-581.297) * [-577.447] (-584.913) (-584.228) (-583.035) -- 0:01:00
      562000 -- (-584.483) [-574.758] (-580.245) (-579.318) * (-584.416) (-583.020) [-579.850] (-577.087) -- 0:01:00
      562500 -- (-580.863) [-580.237] (-580.602) (-580.306) * [-580.228] (-582.700) (-578.187) (-578.624) -- 0:00:59
      563000 -- (-583.755) (-581.070) (-575.447) [-574.470] * (-579.231) (-578.027) [-577.968] (-576.488) -- 0:00:59
      563500 -- [-582.783] (-588.722) (-578.550) (-580.912) * (-574.779) (-580.023) (-576.752) [-585.239] -- 0:00:59
      564000 -- [-583.039] (-576.414) (-578.073) (-580.126) * (-575.738) [-585.245] (-574.137) (-577.460) -- 0:00:59
      564500 -- (-582.343) [-577.938] (-577.684) (-579.454) * (-576.830) [-580.993] (-579.385) (-582.900) -- 0:00:59
      565000 -- (-589.480) [-575.326] (-576.565) (-585.625) * (-583.073) (-575.642) (-577.483) [-579.936] -- 0:00:59

      Average standard deviation of split frequencies: 0.006187

      565500 -- (-586.641) [-580.416] (-575.659) (-577.712) * (-579.468) (-579.384) [-576.628] (-580.617) -- 0:00:59
      566000 -- (-583.438) [-580.205] (-576.316) (-576.387) * (-580.455) [-575.933] (-581.106) (-578.350) -- 0:00:59
      566500 -- (-576.527) (-574.993) (-577.867) [-582.091] * [-589.595] (-577.814) (-578.648) (-583.289) -- 0:00:59
      567000 -- [-575.509] (-582.887) (-595.714) (-576.412) * (-583.103) (-584.310) [-577.059] (-582.556) -- 0:00:59
      567500 -- (-577.292) [-577.757] (-577.413) (-584.334) * (-587.011) (-579.405) [-575.414] (-586.039) -- 0:00:59
      568000 -- (-585.230) (-576.875) [-576.730] (-580.242) * [-583.003] (-581.698) (-575.314) (-581.280) -- 0:00:59
      568500 -- [-583.849] (-578.240) (-577.755) (-581.956) * (-579.685) [-579.268] (-581.720) (-579.504) -- 0:00:59
      569000 -- (-587.717) (-580.455) [-579.136] (-586.351) * [-581.678] (-580.822) (-573.813) (-580.485) -- 0:00:59
      569500 -- (-583.216) (-577.913) (-585.235) [-580.887] * (-582.237) (-580.310) [-576.522] (-590.791) -- 0:00:58
      570000 -- (-576.923) (-579.100) (-576.329) [-582.485] * (-584.443) (-578.249) [-573.604] (-587.403) -- 0:00:58

      Average standard deviation of split frequencies: 0.005192

      570500 -- (-581.891) (-578.759) (-583.562) [-581.189] * [-576.631] (-581.085) (-580.261) (-583.708) -- 0:00:58
      571000 -- (-583.548) (-583.335) [-576.353] (-579.213) * (-580.509) [-574.839] (-582.459) (-582.130) -- 0:00:58
      571500 -- (-579.064) [-575.626] (-579.876) (-579.216) * [-582.645] (-584.713) (-577.316) (-589.788) -- 0:00:58
      572000 -- (-584.924) (-577.367) (-578.212) [-577.368] * [-576.758] (-579.061) (-580.469) (-580.621) -- 0:00:58
      572500 -- [-579.157] (-576.991) (-575.741) (-580.945) * (-582.838) (-581.879) (-580.805) [-577.066] -- 0:00:58
      573000 -- (-577.576) [-575.632] (-579.456) (-589.344) * [-578.812] (-588.197) (-580.798) (-577.913) -- 0:00:58
      573500 -- (-582.518) (-579.697) [-576.977] (-581.665) * (-580.548) [-577.860] (-579.160) (-578.592) -- 0:00:58
      574000 -- (-578.407) [-576.099] (-586.528) (-582.541) * (-581.670) (-578.724) (-583.646) [-578.536] -- 0:00:58
      574500 -- (-578.743) [-574.787] (-582.220) (-584.174) * [-583.559] (-576.803) (-587.276) (-576.719) -- 0:00:58
      575000 -- [-585.055] (-582.846) (-578.605) (-580.251) * (-581.501) (-578.071) (-579.425) [-575.622] -- 0:00:58

      Average standard deviation of split frequencies: 0.005963

      575500 -- [-585.165] (-580.030) (-584.316) (-585.319) * (-587.517) (-576.341) [-579.876] (-574.412) -- 0:00:58
      576000 -- (-586.601) (-589.285) [-580.407] (-587.238) * (-579.876) [-578.614] (-575.348) (-577.313) -- 0:00:58
      576500 -- (-587.273) (-579.911) (-577.109) [-584.668] * [-589.903] (-580.675) (-579.780) (-578.704) -- 0:00:58
      577000 -- (-583.328) (-585.125) [-581.101] (-579.902) * (-580.299) (-575.882) (-583.022) [-574.256] -- 0:00:57
      577500 -- (-579.831) (-580.043) (-578.425) [-576.610] * (-588.807) [-582.166] (-577.287) (-573.909) -- 0:00:57
      578000 -- (-577.745) (-578.981) [-585.797] (-579.133) * (-578.905) [-573.726] (-583.408) (-575.576) -- 0:00:57
      578500 -- (-587.114) (-584.025) (-582.572) [-577.144] * [-578.343] (-578.657) (-574.348) (-580.191) -- 0:00:57
      579000 -- [-578.799] (-576.087) (-576.595) (-577.571) * (-580.035) (-583.404) [-578.508] (-577.351) -- 0:00:57
      579500 -- (-582.432) (-576.669) (-581.496) [-575.747] * (-589.090) (-579.436) (-576.465) [-576.090] -- 0:00:57
      580000 -- (-575.633) (-574.068) (-575.434) [-576.043] * (-575.424) (-581.724) (-578.737) [-577.455] -- 0:00:57

      Average standard deviation of split frequencies: 0.006611

      580500 -- [-574.827] (-578.590) (-581.797) (-575.220) * (-578.676) (-578.780) [-580.042] (-581.338) -- 0:00:57
      581000 -- (-578.140) (-576.045) [-586.854] (-578.851) * (-582.753) (-577.096) [-579.124] (-578.964) -- 0:00:56
      581500 -- (-582.435) [-580.526] (-588.487) (-575.021) * (-583.049) (-576.984) (-577.688) [-576.911] -- 0:00:57
      582000 -- [-576.456] (-574.995) (-578.147) (-575.668) * (-579.536) (-580.756) [-576.385] (-576.293) -- 0:00:57
      582500 -- (-579.467) (-585.758) (-580.830) [-576.967] * (-580.435) (-595.150) (-575.477) [-577.843] -- 0:00:57
      583000 -- [-582.740] (-579.805) (-583.350) (-577.532) * [-577.787] (-576.718) (-577.210) (-582.694) -- 0:00:57
      583500 -- (-580.634) [-580.201] (-580.478) (-576.228) * [-577.715] (-579.396) (-578.648) (-582.304) -- 0:00:57
      584000 -- (-579.506) (-586.176) (-582.431) [-577.045] * (-579.752) (-586.366) [-574.337] (-580.119) -- 0:00:56
      584500 -- [-576.152] (-585.294) (-579.588) (-580.134) * [-582.529] (-579.511) (-583.031) (-579.921) -- 0:00:56
      585000 -- (-581.294) (-583.422) (-576.194) [-578.056] * [-578.107] (-579.861) (-578.171) (-583.376) -- 0:00:56

      Average standard deviation of split frequencies: 0.007125

      585500 -- [-580.052] (-587.322) (-577.441) (-574.476) * [-580.993] (-577.027) (-578.830) (-586.778) -- 0:00:56
      586000 -- (-579.537) [-579.252] (-580.878) (-574.727) * (-581.389) [-578.650] (-578.864) (-579.734) -- 0:00:56
      586500 -- (-584.484) (-581.128) (-587.640) [-575.626] * [-578.657] (-576.897) (-583.506) (-583.929) -- 0:00:56
      587000 -- (-580.727) (-581.502) (-580.859) [-581.598] * [-579.077] (-576.662) (-583.456) (-583.617) -- 0:00:56
      587500 -- (-580.063) [-577.552] (-574.662) (-580.314) * (-586.003) (-587.665) [-574.258] (-581.319) -- 0:00:56
      588000 -- [-580.884] (-577.940) (-576.456) (-580.319) * [-579.640] (-581.263) (-578.638) (-591.158) -- 0:00:56
      588500 -- [-581.890] (-583.369) (-579.795) (-576.819) * (-576.228) (-583.341) [-581.197] (-584.193) -- 0:00:56
      589000 -- (-578.885) (-582.393) [-576.442] (-581.071) * (-579.272) (-578.937) (-585.701) [-580.390] -- 0:00:56
      589500 -- [-582.544] (-584.772) (-577.568) (-576.054) * (-576.604) (-591.238) (-578.644) [-576.041] -- 0:00:56
      590000 -- (-582.449) (-581.992) (-581.316) [-578.655] * (-586.841) [-581.841] (-578.679) (-581.201) -- 0:00:56

      Average standard deviation of split frequencies: 0.006499

      590500 -- (-581.837) (-587.560) (-574.543) [-580.156] * (-584.036) (-588.976) (-585.581) [-583.318] -- 0:00:56
      591000 -- (-581.061) (-582.219) [-579.814] (-576.394) * (-579.680) (-583.683) [-577.112] (-580.560) -- 0:00:56
      591500 -- (-583.104) [-583.877] (-575.932) (-579.299) * (-581.791) (-582.765) [-581.184] (-579.300) -- 0:00:55
      592000 -- (-580.770) (-581.250) [-579.700] (-581.598) * (-579.316) (-577.512) [-574.886] (-580.546) -- 0:00:55
      592500 -- (-578.270) [-578.292] (-583.368) (-579.318) * (-574.592) (-584.706) [-575.438] (-579.557) -- 0:00:55
      593000 -- (-585.515) (-582.092) [-576.110] (-580.216) * (-577.344) (-581.417) [-576.141] (-573.357) -- 0:00:55
      593500 -- [-580.582] (-577.357) (-583.105) (-577.435) * (-575.592) (-581.525) (-575.507) [-578.074] -- 0:00:55
      594000 -- (-578.029) (-577.673) [-577.169] (-575.769) * (-584.341) (-579.926) [-579.835] (-582.537) -- 0:00:55
      594500 -- (-578.596) [-577.383] (-580.917) (-578.577) * (-579.434) (-582.083) [-576.251] (-579.378) -- 0:00:55
      595000 -- (-580.545) [-580.554] (-584.702) (-581.218) * (-584.517) (-580.998) (-583.400) [-583.629] -- 0:00:55

      Average standard deviation of split frequencies: 0.005650

      595500 -- (-581.706) (-581.473) [-583.879] (-581.122) * (-578.122) [-575.359] (-580.052) (-579.504) -- 0:00:55
      596000 -- (-574.846) (-582.237) (-586.248) [-579.255] * [-580.609] (-580.503) (-582.259) (-577.116) -- 0:00:55
      596500 -- (-578.792) (-582.937) (-584.689) [-577.101] * (-579.382) (-577.914) [-573.999] (-582.867) -- 0:00:55
      597000 -- (-583.863) (-585.546) [-583.462] (-587.044) * (-578.220) (-575.762) (-578.550) [-578.516] -- 0:00:55
      597500 -- [-576.226] (-582.351) (-581.496) (-577.156) * (-578.047) (-583.155) (-578.263) [-576.458] -- 0:00:55
      598000 -- (-577.237) (-581.746) [-582.998] (-577.234) * (-579.505) (-581.090) [-577.015] (-582.903) -- 0:00:55
      598500 -- (-575.985) (-574.360) [-581.652] (-577.868) * (-577.674) [-578.877] (-579.430) (-576.507) -- 0:00:55
      599000 -- (-578.303) (-582.606) [-580.674] (-579.258) * (-576.245) (-578.296) [-577.790] (-585.779) -- 0:00:54
      599500 -- (-579.874) (-578.463) [-574.915] (-575.996) * [-578.739] (-579.153) (-579.777) (-577.082) -- 0:00:54
      600000 -- (-578.888) [-575.653] (-583.449) (-579.792) * (-579.673) (-580.479) (-575.106) [-583.585] -- 0:00:54

      Average standard deviation of split frequencies: 0.005830

      600500 -- (-581.400) (-577.446) (-581.180) [-577.598] * [-579.144] (-582.812) (-577.074) (-578.985) -- 0:00:54
      601000 -- (-576.478) (-579.886) [-576.829] (-580.485) * (-577.257) (-579.270) [-576.291] (-576.060) -- 0:00:54
      601500 -- [-574.851] (-576.503) (-575.455) (-581.143) * (-583.666) [-582.230] (-581.088) (-579.327) -- 0:00:54
      602000 -- [-578.180] (-580.150) (-578.472) (-579.124) * (-584.386) (-578.626) (-581.937) [-579.118] -- 0:00:54
      602500 -- (-576.166) [-579.618] (-586.281) (-578.997) * (-579.559) [-575.444] (-581.605) (-580.181) -- 0:00:54
      603000 -- (-583.591) (-581.925) [-576.643] (-578.074) * (-577.826) (-581.606) (-575.889) [-577.868] -- 0:00:53
      603500 -- (-575.354) (-580.630) [-591.371] (-575.649) * (-577.397) (-581.324) [-582.224] (-578.822) -- 0:00:54
      604000 -- (-586.590) (-579.408) [-576.008] (-584.408) * (-577.152) [-582.494] (-578.745) (-579.156) -- 0:00:54
      604500 -- (-580.511) [-583.274] (-582.315) (-581.589) * (-579.544) (-583.593) (-582.372) [-577.648] -- 0:00:54
      605000 -- (-581.186) (-579.614) (-592.660) [-578.123] * (-580.738) (-579.503) [-578.032] (-577.316) -- 0:00:54

      Average standard deviation of split frequencies: 0.005890

      605500 -- (-579.502) (-582.075) [-579.821] (-578.888) * (-578.944) (-575.846) [-578.372] (-583.915) -- 0:00:54
      606000 -- (-582.257) (-573.945) [-576.831] (-581.795) * [-579.915] (-575.565) (-577.491) (-579.580) -- 0:00:53
      606500 -- (-582.979) (-575.146) (-582.988) [-576.067] * (-586.743) (-574.241) [-575.230] (-580.643) -- 0:00:53
      607000 -- [-587.303] (-578.542) (-575.379) (-578.682) * [-577.301] (-581.152) (-579.473) (-575.922) -- 0:00:53
      607500 -- (-582.578) [-572.912] (-579.646) (-579.403) * (-584.666) (-578.242) (-578.586) [-576.702] -- 0:00:53
      608000 -- (-586.808) [-574.872] (-577.648) (-583.721) * (-583.512) [-577.162] (-576.817) (-578.803) -- 0:00:53
      608500 -- (-576.971) (-577.497) [-575.579] (-578.074) * (-577.680) (-574.715) [-578.608] (-581.670) -- 0:00:53
      609000 -- (-581.101) [-578.369] (-581.719) (-580.201) * (-578.975) (-578.670) (-575.204) [-577.671] -- 0:00:53
      609500 -- (-579.863) [-575.556] (-579.477) (-576.618) * (-575.575) (-578.609) [-577.557] (-581.581) -- 0:00:53
      610000 -- (-574.156) (-577.738) [-577.980] (-579.954) * (-577.355) (-579.957) [-574.991] (-576.678) -- 0:00:53

      Average standard deviation of split frequencies: 0.005624

      610500 -- (-580.977) [-578.179] (-575.414) (-586.532) * (-580.779) (-580.019) (-579.015) [-573.377] -- 0:00:53
      611000 -- (-577.128) [-577.851] (-578.079) (-578.016) * (-579.224) (-582.901) (-576.154) [-578.850] -- 0:00:53
      611500 -- [-577.928] (-586.239) (-576.700) (-577.303) * (-578.852) (-590.644) [-577.410] (-585.184) -- 0:00:53
      612000 -- (-579.433) (-577.649) [-579.684] (-577.990) * (-578.966) [-581.305] (-580.843) (-578.663) -- 0:00:53
      612500 -- (-576.300) (-575.408) (-576.795) [-577.130] * (-576.975) (-580.193) [-574.744] (-578.018) -- 0:00:53
      613000 -- [-575.000] (-577.210) (-576.598) (-580.085) * [-575.478] (-580.226) (-580.160) (-585.930) -- 0:00:53
      613500 -- (-580.278) (-576.584) [-578.860] (-579.472) * (-577.555) (-579.603) (-576.598) [-581.216] -- 0:00:52
      614000 -- (-585.273) (-581.341) (-575.968) [-580.141] * (-588.177) (-584.523) [-578.178] (-582.513) -- 0:00:52
      614500 -- (-582.238) [-577.243] (-582.624) (-583.780) * (-584.418) (-584.474) [-578.540] (-580.622) -- 0:00:52
      615000 -- (-587.406) [-579.780] (-577.524) (-577.653) * (-579.517) [-583.200] (-578.638) (-579.000) -- 0:00:52

      Average standard deviation of split frequencies: 0.005248

      615500 -- (-581.916) (-580.002) (-581.669) [-576.386] * [-580.923] (-582.567) (-578.215) (-576.197) -- 0:00:52
      616000 -- (-574.940) [-577.809] (-581.100) (-584.284) * (-577.904) [-578.548] (-578.502) (-584.379) -- 0:00:52
      616500 -- (-582.645) [-578.568] (-581.828) (-577.126) * (-579.748) [-577.152] (-597.344) (-582.813) -- 0:00:52
      617000 -- [-582.234] (-584.677) (-580.207) (-579.250) * (-577.884) (-579.086) (-587.807) [-583.878] -- 0:00:52
      617500 -- (-580.594) (-585.035) [-579.381] (-578.461) * (-580.925) (-576.500) (-579.794) [-580.970] -- 0:00:52
      618000 -- [-575.732] (-585.738) (-579.254) (-580.527) * (-580.411) [-580.940] (-575.189) (-584.497) -- 0:00:52
      618500 -- [-581.011] (-584.252) (-584.585) (-576.285) * (-585.574) (-584.449) (-579.693) [-581.248] -- 0:00:52
      619000 -- (-575.688) (-576.017) (-578.655) [-578.656] * (-587.464) (-581.230) [-577.719] (-577.267) -- 0:00:52
      619500 -- (-578.633) (-583.775) (-579.571) [-580.844] * (-590.842) [-580.171] (-580.982) (-581.158) -- 0:00:52
      620000 -- (-576.112) [-579.937] (-576.713) (-573.539) * (-582.313) (-576.226) (-577.641) [-578.686] -- 0:00:52

      Average standard deviation of split frequencies: 0.004883

      620500 -- (-580.666) [-575.315] (-575.204) (-578.675) * [-579.718] (-573.846) (-581.767) (-583.727) -- 0:00:51
      621000 -- [-576.351] (-586.827) (-582.869) (-580.845) * (-575.345) [-582.295] (-583.626) (-576.556) -- 0:00:51
      621500 -- (-579.949) [-586.437] (-580.482) (-579.106) * (-576.390) (-577.716) [-586.702] (-582.025) -- 0:00:51
      622000 -- [-583.182] (-581.141) (-577.350) (-580.354) * (-578.034) (-584.694) [-586.500] (-579.237) -- 0:00:51
      622500 -- (-577.192) [-580.593] (-578.784) (-583.980) * (-582.649) (-578.067) (-575.457) [-576.373] -- 0:00:51
      623000 -- (-585.586) (-576.866) (-578.371) [-576.153] * (-576.980) [-580.375] (-574.849) (-573.869) -- 0:00:51
      623500 -- (-579.252) (-585.938) (-583.074) [-576.122] * (-585.616) (-582.140) (-577.422) [-575.894] -- 0:00:51
      624000 -- [-579.645] (-579.190) (-580.805) (-578.552) * [-577.510] (-583.257) (-581.596) (-578.442) -- 0:00:51
      624500 -- [-584.316] (-574.023) (-581.166) (-577.714) * (-580.588) [-579.721] (-580.333) (-578.731) -- 0:00:51
      625000 -- (-579.015) (-577.595) (-577.334) [-582.235] * [-580.070] (-580.753) (-586.396) (-583.233) -- 0:00:51

      Average standard deviation of split frequencies: 0.005164

      625500 -- (-586.247) [-575.305] (-584.502) (-581.085) * (-579.274) (-583.390) (-575.441) [-577.573] -- 0:00:51
      626000 -- (-584.119) (-580.388) [-582.424] (-581.866) * (-576.625) (-581.452) (-584.729) [-575.487] -- 0:00:51
      626500 -- (-582.924) [-574.615] (-579.767) (-581.021) * (-574.309) (-576.805) [-580.550] (-578.869) -- 0:00:51
      627000 -- (-581.331) (-581.037) [-579.659] (-577.517) * [-575.544] (-581.145) (-579.711) (-584.183) -- 0:00:51
      627500 -- (-581.211) [-578.255] (-577.602) (-577.488) * [-575.849] (-580.374) (-579.447) (-578.903) -- 0:00:51
      628000 -- (-588.736) (-581.992) (-580.714) [-575.355] * [-574.834] (-581.820) (-579.803) (-575.718) -- 0:00:50
      628500 -- (-588.010) [-575.912] (-585.954) (-583.837) * (-580.306) (-578.113) (-581.382) [-576.772] -- 0:00:50
      629000 -- (-582.169) (-583.418) (-586.813) [-582.701] * [-581.015] (-579.311) (-583.340) (-580.100) -- 0:00:50
      629500 -- [-582.643] (-582.717) (-581.145) (-577.292) * [-580.757] (-579.900) (-584.010) (-575.939) -- 0:00:50
      630000 -- (-583.455) [-581.337] (-579.467) (-581.569) * (-582.400) (-582.917) (-580.884) [-580.464] -- 0:00:50

      Average standard deviation of split frequencies: 0.004378

      630500 -- [-583.021] (-587.651) (-581.454) (-577.559) * (-582.557) [-576.729] (-573.970) (-575.274) -- 0:00:50
      631000 -- [-575.215] (-584.899) (-577.806) (-577.786) * (-577.259) [-579.691] (-582.188) (-578.396) -- 0:00:50
      631500 -- (-578.667) (-578.301) (-578.783) [-582.954] * [-571.929] (-577.734) (-585.073) (-579.690) -- 0:00:50
      632000 -- [-577.261] (-580.105) (-581.076) (-586.423) * (-581.611) (-584.474) [-578.832] (-573.777) -- 0:00:50
      632500 -- (-579.856) [-586.600] (-586.001) (-576.762) * (-579.456) (-580.942) [-577.226] (-578.449) -- 0:00:50
      633000 -- (-579.425) (-586.158) [-577.383] (-587.784) * (-577.262) (-575.115) (-581.011) [-576.041] -- 0:00:50
      633500 -- (-577.578) [-580.603] (-583.356) (-583.591) * [-578.272] (-582.916) (-579.999) (-576.588) -- 0:00:50
      634000 -- (-576.721) (-580.006) (-584.257) [-577.074] * [-577.243] (-585.476) (-579.340) (-576.530) -- 0:00:50
      634500 -- [-580.288] (-585.812) (-581.624) (-584.564) * [-578.856] (-577.250) (-577.378) (-579.785) -- 0:00:50
      635000 -- (-577.675) (-584.792) [-576.175] (-583.335) * [-580.051] (-576.817) (-582.171) (-579.117) -- 0:00:50

      Average standard deviation of split frequencies: 0.003918

      635500 -- [-576.838] (-579.701) (-578.514) (-579.071) * (-583.933) (-574.897) (-575.195) [-578.041] -- 0:00:49
      636000 -- (-577.974) [-576.790] (-575.226) (-588.154) * (-584.433) [-576.061] (-575.159) (-580.388) -- 0:00:49
      636500 -- (-584.458) (-577.909) [-577.785] (-579.789) * (-576.123) (-579.305) (-589.001) [-580.452] -- 0:00:49
      637000 -- (-577.109) (-580.890) [-577.439] (-579.783) * [-584.764] (-590.943) (-579.964) (-574.445) -- 0:00:49
      637500 -- [-583.445] (-579.533) (-582.232) (-583.502) * (-583.661) [-581.308] (-592.920) (-580.762) -- 0:00:49
      638000 -- [-585.028] (-579.284) (-581.987) (-578.920) * [-578.448] (-584.119) (-584.249) (-577.587) -- 0:00:49
      638500 -- (-580.409) [-579.173] (-588.748) (-577.058) * (-579.439) (-580.790) (-582.161) [-575.703] -- 0:00:49
      639000 -- (-590.465) (-578.455) (-585.731) [-575.258] * (-575.260) [-576.062] (-578.304) (-584.856) -- 0:00:49
      639500 -- (-578.495) (-582.057) (-575.893) [-578.566] * (-577.323) [-578.165] (-581.476) (-575.710) -- 0:00:49
      640000 -- (-576.815) (-574.849) (-577.395) [-578.780] * (-577.450) (-581.303) [-589.201] (-576.570) -- 0:00:49

      Average standard deviation of split frequencies: 0.004520

      640500 -- (-579.685) [-573.838] (-582.875) (-574.541) * (-583.282) [-575.949] (-579.200) (-574.933) -- 0:00:49
      641000 -- (-579.255) (-582.899) (-580.266) [-575.728] * (-581.450) (-577.686) [-580.069] (-576.241) -- 0:00:49
      641500 -- (-585.718) (-578.942) (-575.751) [-576.034] * (-580.422) (-578.092) [-577.248] (-580.102) -- 0:00:49
      642000 -- [-584.391] (-579.989) (-577.491) (-581.665) * (-583.836) (-578.270) [-576.599] (-578.132) -- 0:00:49
      642500 -- (-576.667) (-578.063) [-576.083] (-589.815) * (-584.145) [-576.931] (-587.979) (-579.339) -- 0:00:48
      643000 -- [-577.079] (-580.861) (-577.426) (-584.938) * (-575.817) [-581.556] (-584.286) (-581.832) -- 0:00:48
      643500 -- (-582.752) (-584.222) [-574.512] (-585.384) * [-576.219] (-572.840) (-584.463) (-579.380) -- 0:00:48
      644000 -- (-592.270) (-583.420) [-579.550] (-588.141) * (-582.642) (-585.780) (-582.246) [-578.916] -- 0:00:48
      644500 -- (-576.447) (-577.845) (-579.272) [-580.932] * [-582.100] (-577.474) (-577.540) (-588.728) -- 0:00:48
      645000 -- (-577.294) (-576.573) (-581.061) [-588.111] * (-581.043) [-580.700] (-579.281) (-578.556) -- 0:00:48

      Average standard deviation of split frequencies: 0.004587

      645500 -- [-583.540] (-579.235) (-577.205) (-587.324) * (-579.493) (-583.921) [-578.127] (-575.899) -- 0:00:48
      646000 -- (-578.632) (-577.167) [-575.627] (-581.253) * [-576.074] (-581.748) (-581.771) (-588.492) -- 0:00:48
      646500 -- (-577.403) (-575.799) (-578.142) [-578.453] * (-582.978) (-579.957) (-578.153) [-578.449] -- 0:00:48
      647000 -- [-578.254] (-576.796) (-588.407) (-580.047) * [-575.065] (-577.596) (-579.389) (-577.864) -- 0:00:48
      647500 -- [-583.226] (-576.181) (-582.658) (-577.326) * (-579.987) (-582.368) (-583.709) [-579.237] -- 0:00:48
      648000 -- [-576.699] (-585.006) (-587.290) (-582.892) * (-583.679) (-578.342) (-582.436) [-579.199] -- 0:00:48
      648500 -- [-579.062] (-582.783) (-577.511) (-579.019) * (-583.017) (-579.291) (-585.086) [-580.836] -- 0:00:48
      649000 -- (-579.056) [-577.871] (-587.767) (-579.630) * (-580.349) (-576.804) (-582.481) [-580.650] -- 0:00:48
      649500 -- [-579.781] (-575.744) (-582.355) (-578.761) * (-580.928) (-578.128) [-575.254] (-574.445) -- 0:00:48
      650000 -- (-578.202) [-574.110] (-582.925) (-580.984) * [-586.015] (-576.191) (-578.135) (-574.888) -- 0:00:47

      Average standard deviation of split frequencies: 0.004243

      650500 -- (-581.945) (-577.125) [-579.462] (-579.744) * (-578.957) [-579.765] (-574.922) (-578.037) -- 0:00:47
      651000 -- (-577.538) (-583.402) (-584.400) [-577.943] * [-578.629] (-580.673) (-587.842) (-578.222) -- 0:00:47
      651500 -- (-577.911) (-579.298) [-580.526] (-577.353) * (-585.543) [-581.751] (-576.524) (-575.852) -- 0:00:47
      652000 -- (-581.591) (-582.165) [-576.743] (-581.334) * (-577.797) (-584.711) (-579.926) [-580.373] -- 0:00:47
      652500 -- (-581.450) [-575.844] (-579.740) (-579.925) * (-579.367) (-589.527) (-580.416) [-579.964] -- 0:00:47
      653000 -- (-585.329) (-579.378) [-581.539] (-597.397) * (-575.984) (-582.625) (-582.877) [-576.235] -- 0:00:47
      653500 -- (-576.130) (-578.919) [-582.980] (-586.740) * (-581.852) (-580.017) [-581.328] (-581.910) -- 0:00:47
      654000 -- (-579.757) [-574.957] (-579.897) (-579.049) * (-578.570) (-578.980) (-587.171) [-576.154] -- 0:00:47
      654500 -- (-575.490) [-580.021] (-576.990) (-581.206) * (-581.082) (-581.197) [-577.319] (-580.266) -- 0:00:47
      655000 -- (-582.257) (-574.596) [-579.331] (-579.168) * [-580.025] (-577.871) (-583.981) (-575.424) -- 0:00:47

      Average standard deviation of split frequencies: 0.004414

      655500 -- [-574.394] (-579.299) (-579.550) (-579.843) * [-578.317] (-584.764) (-578.727) (-578.828) -- 0:00:47
      656000 -- (-574.570) [-575.785] (-576.016) (-582.133) * (-578.301) [-573.491] (-574.888) (-585.803) -- 0:00:47
      656500 -- [-573.934] (-576.193) (-580.605) (-581.203) * [-577.282] (-585.427) (-577.539) (-578.834) -- 0:00:47
      657000 -- (-583.446) (-574.992) [-579.933] (-584.931) * (-579.939) (-580.423) [-577.170] (-578.263) -- 0:00:46
      657500 -- (-581.554) [-577.757] (-579.034) (-583.340) * (-582.466) [-579.529] (-578.225) (-585.645) -- 0:00:46
      658000 -- (-586.945) [-575.824] (-579.775) (-579.646) * (-574.141) (-579.419) [-575.217] (-577.844) -- 0:00:46
      658500 -- (-583.550) [-573.470] (-580.100) (-575.399) * (-580.688) (-584.308) (-581.191) [-576.818] -- 0:00:46
      659000 -- (-575.588) [-578.869] (-579.679) (-580.551) * (-575.669) (-579.392) (-581.119) [-578.046] -- 0:00:46
      659500 -- (-579.464) [-577.225] (-582.670) (-583.166) * (-579.249) (-578.781) [-575.754] (-579.248) -- 0:00:46
      660000 -- (-579.836) (-578.486) (-575.118) [-581.859] * (-583.885) (-582.989) (-574.684) [-578.092] -- 0:00:46

      Average standard deviation of split frequencies: 0.003670

      660500 -- (-574.727) (-579.934) [-576.551] (-586.987) * [-575.814] (-576.591) (-577.972) (-580.560) -- 0:00:46
      661000 -- (-579.623) (-579.958) (-587.078) [-580.117] * [-579.146] (-579.170) (-582.442) (-578.366) -- 0:00:46
      661500 -- [-577.977] (-581.534) (-581.605) (-576.201) * [-574.878] (-580.979) (-581.078) (-584.679) -- 0:00:46
      662000 -- [-578.381] (-578.606) (-586.350) (-583.377) * (-575.198) [-582.419] (-575.794) (-577.355) -- 0:00:46
      662500 -- (-580.291) (-583.607) (-581.114) [-581.840] * (-576.762) [-575.757] (-577.634) (-574.889) -- 0:00:46
      663000 -- (-583.547) [-575.886] (-583.856) (-581.637) * (-584.257) (-581.089) (-579.778) [-583.329] -- 0:00:46
      663500 -- (-585.478) (-578.324) [-579.875] (-578.329) * (-582.307) [-579.352] (-577.029) (-578.499) -- 0:00:46
      664000 -- (-579.802) (-584.391) (-578.615) [-580.344] * [-583.404] (-581.380) (-574.035) (-581.991) -- 0:00:46
      664500 -- [-576.033] (-576.963) (-579.403) (-582.049) * (-583.705) (-582.853) (-578.008) [-579.049] -- 0:00:45
      665000 -- [-575.545] (-578.997) (-578.719) (-577.797) * (-584.121) (-583.898) (-579.559) [-582.932] -- 0:00:45

      Average standard deviation of split frequencies: 0.003337

      665500 -- (-577.188) [-573.476] (-581.483) (-578.322) * (-586.937) [-584.080] (-578.101) (-582.348) -- 0:00:45
      666000 -- (-580.389) [-579.031] (-578.644) (-585.176) * (-587.858) [-579.097] (-587.350) (-581.138) -- 0:00:45
      666500 -- (-581.369) [-579.980] (-578.435) (-588.543) * (-575.542) (-576.832) [-580.482] (-576.053) -- 0:00:45
      667000 -- [-578.200] (-587.531) (-577.203) (-578.204) * (-579.840) (-576.242) [-574.193] (-580.802) -- 0:00:45
      667500 -- (-583.658) (-583.598) [-580.072] (-585.742) * (-580.635) (-582.125) (-583.298) [-578.735] -- 0:00:45
      668000 -- (-583.582) [-581.680] (-576.873) (-579.738) * (-581.254) (-577.336) [-575.902] (-584.332) -- 0:00:45
      668500 -- [-584.724] (-581.717) (-583.436) (-585.257) * (-582.219) (-589.140) [-583.822] (-581.585) -- 0:00:45
      669000 -- (-580.299) (-586.726) (-581.400) [-578.564] * (-576.461) (-580.107) [-576.972] (-577.833) -- 0:00:45
      669500 -- (-576.587) (-577.737) (-578.647) [-574.885] * [-577.183] (-582.093) (-575.563) (-576.000) -- 0:00:45
      670000 -- (-590.374) (-577.420) (-579.969) [-579.456] * (-580.991) [-583.386] (-580.742) (-578.555) -- 0:00:45

      Average standard deviation of split frequencies: 0.002912

      670500 -- (-579.602) (-576.753) (-580.262) [-586.775] * (-579.508) (-579.796) (-582.645) [-578.386] -- 0:00:45
      671000 -- [-572.660] (-576.092) (-585.058) (-580.416) * (-577.534) (-582.918) [-579.510] (-578.420) -- 0:00:45
      671500 -- (-579.175) [-577.013] (-579.380) (-584.163) * (-577.051) (-577.981) [-577.860] (-581.945) -- 0:00:45
      672000 -- (-577.168) [-585.746] (-583.337) (-582.862) * (-583.347) (-585.216) [-573.545] (-586.453) -- 0:00:44
      672500 -- (-581.833) [-580.506] (-579.596) (-585.365) * (-583.070) (-584.487) (-577.465) [-582.421] -- 0:00:44
      673000 -- [-575.973] (-578.012) (-578.289) (-575.966) * (-578.844) [-578.977] (-576.906) (-582.649) -- 0:00:44
      673500 -- (-582.937) [-578.086] (-580.501) (-578.843) * (-584.134) (-574.742) (-579.552) [-579.109] -- 0:00:44
      674000 -- (-579.799) (-578.251) [-579.760] (-587.849) * [-578.923] (-578.030) (-577.335) (-578.775) -- 0:00:44
      674500 -- (-577.245) (-577.567) (-576.099) [-575.579] * (-578.460) (-575.343) [-576.035] (-578.064) -- 0:00:44
      675000 -- [-577.222] (-580.798) (-580.551) (-576.873) * [-577.719] (-574.041) (-578.406) (-578.946) -- 0:00:44

      Average standard deviation of split frequencies: 0.003387

      675500 -- (-578.351) (-578.485) [-574.829] (-581.882) * (-580.282) (-581.996) [-578.795] (-585.595) -- 0:00:44
      676000 -- (-580.308) [-576.215] (-580.235) (-576.191) * [-577.770] (-577.209) (-580.682) (-585.050) -- 0:00:44
      676500 -- (-575.984) (-577.221) [-582.156] (-575.358) * (-574.816) [-572.734] (-574.729) (-591.734) -- 0:00:44
      677000 -- (-577.408) (-580.327) (-576.830) [-581.742] * (-577.101) (-576.355) (-576.345) [-585.240] -- 0:00:44
      677500 -- (-578.673) [-575.598] (-574.226) (-579.512) * (-575.806) (-576.156) (-580.328) [-582.746] -- 0:00:44
      678000 -- [-582.129] (-578.882) (-577.666) (-577.998) * [-576.103] (-577.884) (-578.953) (-578.598) -- 0:00:44
      678500 -- (-576.951) [-580.607] (-580.353) (-583.557) * (-576.375) (-582.184) (-576.775) [-579.862] -- 0:00:44
      679000 -- (-576.497) (-576.653) [-579.864] (-584.692) * (-576.630) [-579.464] (-578.688) (-577.160) -- 0:00:43
      679500 -- [-581.021] (-583.225) (-579.135) (-580.558) * [-577.036] (-587.018) (-575.593) (-580.430) -- 0:00:43
      680000 -- (-577.216) (-575.477) [-577.470] (-579.980) * (-581.137) (-583.608) (-582.743) [-577.904] -- 0:00:43

      Average standard deviation of split frequencies: 0.003364

      680500 -- (-581.187) (-579.250) [-577.867] (-581.870) * (-580.512) (-588.563) [-581.641] (-579.396) -- 0:00:43
      681000 -- (-582.281) (-579.961) (-577.941) [-572.614] * (-581.997) (-581.948) [-581.192] (-581.273) -- 0:00:43
      681500 -- (-577.278) (-584.871) (-578.873) [-577.158] * (-577.974) [-576.501] (-578.914) (-578.016) -- 0:00:43
      682000 -- [-578.338] (-587.112) (-580.036) (-583.270) * (-580.338) [-586.479] (-577.566) (-577.090) -- 0:00:43
      682500 -- (-579.278) (-574.650) [-580.018] (-576.772) * (-584.740) (-578.796) [-578.370] (-581.077) -- 0:00:43
      683000 -- (-584.868) (-580.311) [-578.694] (-578.952) * (-576.675) [-582.446] (-574.381) (-577.986) -- 0:00:43
      683500 -- [-582.715] (-582.499) (-584.499) (-576.455) * [-574.931] (-581.671) (-577.435) (-579.212) -- 0:00:43
      684000 -- (-587.665) (-575.473) [-580.040] (-581.499) * [-578.782] (-587.402) (-583.549) (-579.459) -- 0:00:43
      684500 -- (-579.508) [-585.013] (-576.065) (-579.689) * (-575.273) (-578.154) (-579.168) [-582.505] -- 0:00:43
      685000 -- [-580.609] (-583.606) (-584.122) (-583.100) * [-578.483] (-591.419) (-585.195) (-584.269) -- 0:00:43

      Average standard deviation of split frequencies: 0.003829

      685500 -- [-579.578] (-582.124) (-583.387) (-577.590) * (-584.898) (-581.193) (-584.122) [-578.333] -- 0:00:43
      686000 -- [-579.678] (-579.037) (-579.737) (-579.584) * (-579.949) (-580.356) (-582.430) [-581.538] -- 0:00:43
      686500 -- [-580.705] (-582.342) (-581.741) (-578.517) * [-582.060] (-581.107) (-579.607) (-589.095) -- 0:00:42
      687000 -- [-579.308] (-584.227) (-581.475) (-584.245) * (-586.403) [-578.486] (-579.431) (-587.477) -- 0:00:42
      687500 -- [-573.777] (-581.023) (-583.930) (-580.823) * (-577.086) [-575.094] (-576.783) (-585.091) -- 0:00:42
      688000 -- (-572.826) [-576.507] (-580.287) (-574.588) * [-575.946] (-578.527) (-578.588) (-581.109) -- 0:00:42
      688500 -- (-579.832) (-580.719) (-582.306) [-576.614] * (-582.881) (-581.724) (-578.389) [-574.190] -- 0:00:42
      689000 -- [-576.316] (-581.310) (-585.433) (-586.475) * (-579.195) (-581.307) (-584.553) [-580.580] -- 0:00:42
      689500 -- (-580.381) (-578.394) (-581.128) [-574.312] * (-576.300) (-580.542) (-579.967) [-576.467] -- 0:00:42
      690000 -- (-583.889) (-573.786) (-577.772) [-576.244] * (-585.007) (-582.162) [-581.938] (-579.228) -- 0:00:42

      Average standard deviation of split frequencies: 0.003998

      690500 -- (-575.512) (-582.495) [-576.095] (-575.497) * [-577.125] (-581.223) (-575.180) (-572.792) -- 0:00:42
      691000 -- (-577.620) (-583.597) (-580.724) [-576.209] * (-583.548) [-574.575] (-577.478) (-575.847) -- 0:00:42
      691500 -- [-580.629] (-576.716) (-580.879) (-583.230) * (-579.627) (-577.022) [-575.748] (-574.146) -- 0:00:42
      692000 -- [-575.020] (-582.411) (-579.342) (-584.148) * [-576.349] (-577.874) (-580.994) (-579.899) -- 0:00:42
      692500 -- (-580.007) (-580.797) [-580.109] (-582.030) * (-575.138) (-584.765) [-581.833] (-586.920) -- 0:00:42
      693000 -- [-584.115] (-584.592) (-578.711) (-581.793) * (-577.562) [-576.916] (-580.303) (-589.703) -- 0:00:42
      693500 -- [-581.924] (-590.480) (-584.809) (-581.224) * [-581.069] (-582.142) (-584.470) (-577.923) -- 0:00:41
      694000 -- (-572.792) (-581.072) [-582.011] (-582.963) * (-584.036) [-575.325] (-578.718) (-580.326) -- 0:00:41
      694500 -- (-579.123) [-575.090] (-582.564) (-595.292) * (-586.376) [-577.232] (-582.590) (-584.798) -- 0:00:41
      695000 -- (-580.123) [-578.331] (-580.976) (-582.256) * (-578.937) (-578.733) [-574.622] (-582.479) -- 0:00:41

      Average standard deviation of split frequencies: 0.003290

      695500 -- (-575.610) (-586.894) (-578.845) [-582.280] * [-578.681] (-576.881) (-579.724) (-580.596) -- 0:00:41
      696000 -- (-579.702) (-580.873) [-580.824] (-575.858) * (-577.499) (-582.364) [-577.150] (-585.576) -- 0:00:41
      696500 -- (-579.087) [-578.056] (-577.831) (-581.842) * (-578.492) (-573.824) [-579.596] (-577.301) -- 0:00:41
      697000 -- (-584.638) (-573.990) [-586.029] (-576.361) * [-581.524] (-576.944) (-577.333) (-574.935) -- 0:00:41
      697500 -- [-579.112] (-576.657) (-584.910) (-580.313) * [-579.656] (-579.178) (-582.417) (-578.549) -- 0:00:41
      698000 -- (-574.849) (-578.001) [-582.226] (-577.986) * (-584.367) (-585.472) (-578.951) [-572.361] -- 0:00:41
      698500 -- (-576.700) (-581.129) [-581.842] (-575.415) * (-584.008) [-578.414] (-584.039) (-577.111) -- 0:00:41
      699000 -- (-582.054) [-577.994] (-578.209) (-584.695) * [-582.939] (-576.531) (-584.832) (-583.728) -- 0:00:41
      699500 -- (-578.764) [-575.844] (-576.874) (-578.339) * (-584.718) [-578.089] (-586.025) (-578.474) -- 0:00:41
      700000 -- [-577.395] (-575.722) (-577.435) (-578.246) * (-581.872) [-575.780] (-579.041) (-581.103) -- 0:00:41

      Average standard deviation of split frequencies: 0.003556

      700500 -- [-575.879] (-578.366) (-580.385) (-579.095) * (-581.748) (-579.063) (-576.536) [-575.331] -- 0:00:41
      701000 -- (-579.676) [-577.872] (-576.945) (-577.343) * [-576.655] (-581.119) (-579.998) (-576.010) -- 0:00:40
      701500 -- [-578.317] (-586.035) (-578.134) (-578.184) * (-581.845) (-585.049) [-579.546] (-572.565) -- 0:00:40
      702000 -- (-580.470) (-580.014) [-577.370] (-580.043) * (-584.915) [-583.273] (-578.224) (-587.405) -- 0:00:40
      702500 -- [-590.977] (-581.208) (-581.586) (-583.772) * (-579.265) (-578.473) (-578.803) [-575.613] -- 0:00:40
      703000 -- (-590.409) [-584.156] (-583.128) (-587.777) * (-577.844) [-577.567] (-580.044) (-579.273) -- 0:00:40
      703500 -- (-576.609) (-586.084) [-577.814] (-578.527) * (-579.327) (-582.362) (-579.930) [-579.943] -- 0:00:40
      704000 -- (-576.334) (-577.052) (-580.716) [-584.788] * [-577.457] (-577.056) (-578.576) (-581.810) -- 0:00:40
      704500 -- (-580.351) (-579.246) [-580.589] (-589.493) * [-576.550] (-576.496) (-577.324) (-575.767) -- 0:00:40
      705000 -- [-574.877] (-581.872) (-579.149) (-589.303) * (-582.876) (-580.805) (-574.951) [-581.775] -- 0:00:40

      Average standard deviation of split frequencies: 0.003529

      705500 -- (-575.850) [-576.401] (-584.463) (-593.999) * (-583.044) [-576.165] (-576.842) (-582.534) -- 0:00:40
      706000 -- (-580.259) (-586.195) [-576.238] (-581.833) * (-585.501) [-578.577] (-578.614) (-576.463) -- 0:00:40
      706500 -- [-580.589] (-582.306) (-578.853) (-576.274) * (-582.545) (-581.140) (-580.463) [-579.701] -- 0:00:40
      707000 -- (-577.770) (-578.338) (-580.631) [-575.089] * [-575.849] (-577.339) (-583.095) (-579.961) -- 0:00:40
      707500 -- (-579.210) (-583.327) (-582.238) [-577.674] * (-577.856) (-577.164) [-576.531] (-576.380) -- 0:00:40
      708000 -- (-585.876) (-583.033) [-578.552] (-580.880) * [-578.350] (-583.078) (-577.655) (-578.369) -- 0:00:40
      708500 -- (-580.240) [-575.919] (-583.096) (-585.839) * [-577.928] (-582.117) (-584.105) (-577.157) -- 0:00:39
      709000 -- (-580.139) (-581.958) [-583.726] (-585.074) * [-581.489] (-583.416) (-585.263) (-577.775) -- 0:00:39
      709500 -- (-577.543) (-584.512) (-575.477) [-581.050] * (-578.442) [-580.846] (-588.894) (-581.878) -- 0:00:39
      710000 -- (-582.702) (-581.216) (-581.174) [-585.172] * (-576.556) (-576.753) (-587.358) [-580.709] -- 0:00:39

      Average standard deviation of split frequencies: 0.003506

      710500 -- (-576.648) [-578.379] (-578.336) (-583.914) * [-575.067] (-580.750) (-579.229) (-580.503) -- 0:00:39
      711000 -- (-578.750) [-579.185] (-575.533) (-590.486) * [-577.399] (-580.748) (-584.010) (-581.189) -- 0:00:39
      711500 -- (-576.286) (-580.527) [-575.575] (-587.990) * (-579.452) (-578.458) (-579.031) [-580.219] -- 0:00:39
      712000 -- (-578.802) (-580.292) (-573.327) [-578.331] * (-576.417) (-586.164) [-577.713] (-575.869) -- 0:00:39
      712500 -- [-582.975] (-583.728) (-574.181) (-575.492) * (-578.262) (-578.122) (-583.124) [-587.921] -- 0:00:39
      713000 -- (-579.056) (-580.638) (-583.666) [-574.888] * (-579.838) (-583.622) [-574.810] (-584.581) -- 0:00:39
      713500 -- (-580.725) [-583.838] (-577.128) (-578.793) * (-586.545) (-577.730) (-580.209) [-576.448] -- 0:00:39
      714000 -- (-581.871) (-581.205) (-579.720) [-578.814] * [-578.951] (-578.900) (-580.310) (-580.980) -- 0:00:39
      714500 -- [-577.129] (-579.874) (-580.366) (-580.809) * (-587.613) [-577.394] (-583.366) (-589.324) -- 0:00:39
      715000 -- (-578.829) (-580.538) (-587.502) [-581.106] * (-578.481) (-581.207) [-578.398] (-583.025) -- 0:00:39

      Average standard deviation of split frequencies: 0.004232

      715500 -- [-578.487] (-578.531) (-589.727) (-584.501) * [-578.135] (-581.759) (-584.401) (-577.439) -- 0:00:38
      716000 -- [-581.075] (-578.844) (-584.421) (-578.366) * (-591.532) [-582.746] (-576.894) (-592.289) -- 0:00:38
      716500 -- [-578.644] (-577.765) (-580.149) (-580.936) * (-579.899) (-580.711) (-581.479) [-586.115] -- 0:00:38
      717000 -- (-577.930) [-575.119] (-592.663) (-585.625) * (-578.828) [-576.558] (-580.640) (-584.035) -- 0:00:38
      717500 -- (-581.179) [-578.805] (-589.627) (-580.895) * [-578.207] (-583.666) (-579.906) (-581.764) -- 0:00:38
      718000 -- [-579.720] (-581.561) (-586.960) (-579.550) * [-581.189] (-589.709) (-578.006) (-582.771) -- 0:00:38
      718500 -- (-591.371) (-578.375) [-586.802] (-580.826) * [-578.820] (-578.743) (-577.542) (-585.921) -- 0:00:38
      719000 -- (-577.151) [-578.540] (-585.048) (-579.819) * (-580.085) [-578.339] (-581.558) (-580.328) -- 0:00:38
      719500 -- (-578.813) (-578.564) (-582.692) [-578.390] * (-580.926) (-579.403) [-577.744] (-584.617) -- 0:00:38
      720000 -- (-580.283) [-579.258] (-580.592) (-578.207) * (-586.190) [-577.585] (-583.110) (-578.218) -- 0:00:38

      Average standard deviation of split frequencies: 0.004112

      720500 -- (-580.044) (-581.070) [-574.421] (-581.944) * (-579.934) (-584.506) (-579.604) [-580.169] -- 0:00:38
      721000 -- (-580.614) (-584.805) (-578.491) [-583.266] * (-579.854) (-585.655) (-580.750) [-576.214] -- 0:00:38
      721500 -- (-579.660) [-583.688] (-578.337) (-585.122) * (-576.658) (-583.882) [-579.186] (-582.145) -- 0:00:38
      722000 -- (-582.048) (-578.946) (-579.493) [-576.056] * (-575.653) (-579.313) [-579.299] (-581.627) -- 0:00:38
      722500 -- (-581.426) (-575.154) [-586.616] (-582.411) * (-580.888) (-581.140) (-578.288) [-579.700] -- 0:00:38
      723000 -- [-584.051] (-578.214) (-582.557) (-577.664) * (-586.659) (-576.763) [-581.997] (-579.349) -- 0:00:37
      723500 -- [-578.749] (-580.174) (-583.592) (-578.145) * (-574.491) [-578.188] (-580.782) (-577.136) -- 0:00:37
      724000 -- (-579.884) (-586.348) [-577.902] (-580.108) * (-578.331) [-581.373] (-581.341) (-576.868) -- 0:00:37
      724500 -- [-578.742] (-576.219) (-578.077) (-587.208) * (-575.179) (-585.652) [-573.995] (-574.375) -- 0:00:37
      725000 -- [-580.293] (-578.816) (-581.834) (-575.287) * [-579.818] (-583.966) (-579.068) (-575.314) -- 0:00:37

      Average standard deviation of split frequencies: 0.004360

      725500 -- [-584.242] (-579.175) (-588.962) (-577.846) * (-578.106) (-576.951) (-578.795) [-576.244] -- 0:00:37
      726000 -- (-574.793) (-577.813) [-584.207] (-585.864) * [-579.736] (-575.471) (-575.998) (-573.158) -- 0:00:37
      726500 -- [-574.309] (-577.910) (-581.932) (-576.216) * [-576.062] (-579.175) (-574.780) (-582.232) -- 0:00:37
      727000 -- (-578.632) (-579.092) (-576.121) [-578.457] * (-577.316) [-574.826] (-572.810) (-580.774) -- 0:00:37
      727500 -- (-580.536) [-576.881] (-574.616) (-580.494) * (-579.444) (-577.409) [-575.105] (-583.078) -- 0:00:37
      728000 -- (-580.237) (-577.971) (-581.413) [-580.604] * (-583.467) [-578.187] (-586.196) (-576.469) -- 0:00:37
      728500 -- (-582.649) (-577.219) (-577.563) [-576.519] * [-589.975] (-577.733) (-579.696) (-580.443) -- 0:00:37
      729000 -- (-582.078) (-575.934) [-577.544] (-578.254) * [-577.503] (-581.394) (-586.644) (-577.149) -- 0:00:37
      729500 -- (-587.564) (-582.117) [-575.588] (-584.060) * (-581.871) (-577.106) (-581.142) [-577.764] -- 0:00:37
      730000 -- (-588.674) (-577.961) [-580.215] (-585.966) * (-576.531) (-574.175) (-576.920) [-579.762] -- 0:00:36

      Average standard deviation of split frequencies: 0.005069

      730500 -- (-581.525) (-581.346) [-581.202] (-581.025) * (-582.561) [-577.451] (-588.169) (-581.966) -- 0:00:36
      731000 -- (-585.550) (-576.472) (-579.255) [-576.351] * (-584.962) (-582.973) (-576.604) [-582.867] -- 0:00:36
      731500 -- (-589.929) [-579.025] (-580.548) (-587.345) * (-581.901) [-579.488] (-578.959) (-585.278) -- 0:00:36
      732000 -- (-578.791) (-578.848) (-580.373) [-581.886] * [-581.157] (-579.536) (-581.053) (-577.474) -- 0:00:36
      732500 -- [-579.864] (-583.260) (-578.128) (-577.719) * [-585.858] (-581.800) (-578.856) (-576.477) -- 0:00:36
      733000 -- [-575.679] (-583.742) (-579.382) (-577.243) * (-578.203) [-578.778] (-578.361) (-578.167) -- 0:00:36
      733500 -- [-582.297] (-585.011) (-582.660) (-578.213) * (-579.444) (-579.531) [-576.460] (-578.902) -- 0:00:36
      734000 -- (-580.275) (-582.610) [-576.338] (-576.053) * [-575.176] (-580.494) (-577.173) (-584.927) -- 0:00:36
      734500 -- (-583.023) [-577.723] (-584.300) (-579.743) * (-574.831) (-589.404) [-576.163] (-583.267) -- 0:00:36
      735000 -- [-581.441] (-583.641) (-575.873) (-584.704) * [-580.915] (-588.542) (-575.713) (-576.720) -- 0:00:36

      Average standard deviation of split frequencies: 0.004941

      735500 -- (-580.198) (-577.455) [-583.650] (-580.014) * (-580.809) (-586.790) [-576.505] (-582.472) -- 0:00:36
      736000 -- (-579.348) (-575.203) [-574.098] (-578.856) * (-582.508) (-585.785) [-574.484] (-576.122) -- 0:00:36
      736500 -- (-581.853) (-575.777) [-578.350] (-587.255) * (-589.152) (-585.349) (-582.480) [-580.656] -- 0:00:36
      737000 -- (-586.765) (-578.442) (-579.412) [-578.208] * (-578.316) (-589.605) (-574.000) [-578.562] -- 0:00:36
      737500 -- (-579.014) [-582.206] (-577.544) (-574.492) * [-576.170] (-588.307) (-577.891) (-580.720) -- 0:00:35
      738000 -- (-590.491) (-581.473) (-576.360) [-575.298] * [-576.291] (-598.285) (-579.035) (-579.910) -- 0:00:35
      738500 -- (-580.978) (-575.521) [-573.575] (-581.511) * (-580.695) (-587.902) [-577.884] (-586.316) -- 0:00:35
      739000 -- (-577.575) (-576.747) (-579.681) [-579.141] * (-581.632) (-586.625) (-578.554) [-585.165] -- 0:00:35
      739500 -- (-577.462) (-578.396) [-580.784] (-579.307) * (-576.293) (-593.856) [-584.633] (-580.025) -- 0:00:35
      740000 -- [-574.443] (-574.200) (-578.331) (-574.849) * (-580.552) (-590.486) [-582.074] (-578.283) -- 0:00:35

      Average standard deviation of split frequencies: 0.004001

      740500 -- (-578.836) (-579.282) [-578.336] (-577.934) * (-589.115) (-595.258) [-576.666] (-583.450) -- 0:00:35
      741000 -- (-578.998) [-576.073] (-578.306) (-578.236) * [-576.644] (-594.079) (-580.767) (-578.171) -- 0:00:35
      741500 -- (-577.202) (-577.196) (-582.618) [-582.876] * (-579.516) (-585.039) [-578.313] (-573.910) -- 0:00:35
      742000 -- (-581.572) (-578.255) (-575.352) [-574.845] * [-579.040] (-585.533) (-580.019) (-580.305) -- 0:00:35
      742500 -- [-580.849] (-576.267) (-581.929) (-577.394) * (-581.627) (-578.912) [-581.710] (-580.929) -- 0:00:35
      743000 -- (-578.028) (-578.176) [-574.872] (-580.581) * (-578.233) (-587.576) (-588.784) [-581.360] -- 0:00:35
      743500 -- (-580.103) (-580.909) [-582.207] (-574.955) * [-577.697] (-584.429) (-580.648) (-584.358) -- 0:00:35
      744000 -- (-574.987) (-581.540) [-578.286] (-577.440) * [-577.394] (-578.255) (-578.083) (-579.730) -- 0:00:35
      744500 -- (-583.821) (-583.057) (-581.796) [-576.798] * [-576.137] (-578.925) (-573.327) (-573.493) -- 0:00:35
      745000 -- [-576.465] (-577.209) (-583.604) (-578.540) * (-575.629) (-582.360) (-582.272) [-579.509] -- 0:00:34

      Average standard deviation of split frequencies: 0.003701

      745500 -- [-580.883] (-577.810) (-581.324) (-579.976) * (-575.969) (-577.823) [-578.698] (-582.033) -- 0:00:34
      746000 -- (-576.743) [-583.409] (-587.182) (-581.944) * [-584.318] (-583.822) (-580.143) (-580.386) -- 0:00:34
      746500 -- (-576.498) (-577.563) [-578.603] (-578.099) * (-576.882) (-582.813) (-585.330) [-574.492] -- 0:00:34
      747000 -- (-575.147) (-577.368) (-578.829) [-579.836] * [-577.532] (-577.404) (-585.508) (-575.519) -- 0:00:34
      747500 -- (-578.105) [-577.657] (-580.280) (-575.163) * [-575.616] (-581.534) (-581.677) (-579.738) -- 0:00:34
      748000 -- (-576.163) (-578.939) [-578.886] (-575.475) * [-573.964] (-581.704) (-580.363) (-577.816) -- 0:00:34
      748500 -- (-576.876) (-586.201) [-576.390] (-577.426) * (-572.578) (-583.728) [-574.576] (-581.684) -- 0:00:34
      749000 -- (-581.536) (-582.218) [-578.305] (-583.510) * [-576.183] (-575.887) (-575.343) (-575.995) -- 0:00:34
      749500 -- [-581.445] (-580.416) (-579.715) (-580.114) * (-583.378) (-583.569) (-576.037) [-577.383] -- 0:00:34
      750000 -- (-576.135) [-576.691] (-580.026) (-580.561) * [-578.742] (-585.082) (-582.799) (-575.560) -- 0:00:34

      Average standard deviation of split frequencies: 0.003858

      750500 -- (-582.635) (-587.241) [-575.513] (-574.349) * (-584.354) [-578.340] (-577.491) (-575.421) -- 0:00:34
      751000 -- (-574.360) [-578.833] (-581.093) (-576.374) * (-578.841) (-582.967) (-583.678) [-578.857] -- 0:00:34
      751500 -- (-574.751) [-581.096] (-574.640) (-583.211) * (-583.429) (-576.890) [-578.673] (-574.516) -- 0:00:34
      752000 -- (-575.696) [-576.999] (-581.131) (-578.150) * (-583.269) (-581.380) (-577.577) [-576.989] -- 0:00:33
      752500 -- [-584.068] (-579.880) (-575.793) (-581.834) * (-580.116) [-578.025] (-584.339) (-577.310) -- 0:00:33
      753000 -- (-577.707) (-584.324) [-576.316] (-580.201) * [-575.018] (-577.305) (-582.548) (-577.695) -- 0:00:33
      753500 -- (-582.695) (-580.459) (-585.207) [-576.608] * (-584.965) (-581.937) (-580.570) [-577.054] -- 0:00:33
      754000 -- (-576.040) (-579.605) (-580.302) [-578.615] * (-584.489) (-581.292) [-582.600] (-577.425) -- 0:00:33
      754500 -- (-583.138) (-580.633) [-583.482] (-581.987) * (-581.465) (-578.874) (-584.251) [-577.856] -- 0:00:33
      755000 -- (-578.732) (-576.343) (-588.374) [-580.389] * [-580.292] (-585.416) (-585.340) (-582.506) -- 0:00:33

      Average standard deviation of split frequencies: 0.004721

      755500 -- (-584.695) (-588.667) (-578.958) [-576.610] * (-578.153) (-580.233) (-582.438) [-582.805] -- 0:00:33
      756000 -- (-577.403) [-582.710] (-583.898) (-575.966) * (-580.163) (-582.312) (-586.969) [-578.892] -- 0:00:33
      756500 -- [-574.414] (-582.776) (-578.705) (-577.864) * (-581.821) [-577.705] (-587.470) (-574.811) -- 0:00:33
      757000 -- [-578.909] (-586.904) (-578.526) (-577.222) * (-586.064) (-581.595) [-582.601] (-578.624) -- 0:00:33
      757500 -- (-579.693) (-583.878) (-579.898) [-580.040] * (-582.964) (-576.844) [-582.624] (-578.091) -- 0:00:33
      758000 -- (-580.210) (-589.677) [-582.146] (-582.615) * (-584.637) (-580.982) (-586.742) [-575.379] -- 0:00:33
      758500 -- (-580.585) [-579.113] (-579.235) (-577.174) * (-586.445) (-575.605) (-584.434) [-578.149] -- 0:00:33
      759000 -- [-582.810] (-581.201) (-577.801) (-579.218) * (-576.991) [-574.106] (-586.268) (-578.297) -- 0:00:33
      759500 -- [-582.517] (-584.260) (-584.049) (-579.410) * [-579.042] (-580.610) (-578.520) (-586.275) -- 0:00:32
      760000 -- [-576.633] (-577.719) (-587.937) (-578.052) * (-582.065) [-578.253] (-572.365) (-579.455) -- 0:00:32

      Average standard deviation of split frequencies: 0.004781

      760500 -- [-577.665] (-583.283) (-572.995) (-586.163) * (-589.305) [-575.314] (-579.121) (-580.062) -- 0:00:32
      761000 -- [-579.256] (-578.054) (-578.586) (-575.972) * [-583.925] (-580.236) (-581.239) (-576.906) -- 0:00:32
      761500 -- (-577.960) (-578.884) (-579.457) [-577.121] * [-582.218] (-577.800) (-580.885) (-578.263) -- 0:00:32
      762000 -- (-581.818) (-586.826) [-574.454] (-580.085) * (-582.376) (-584.890) (-576.671) [-582.028] -- 0:00:32
      762500 -- (-578.697) (-584.715) [-578.768] (-580.822) * (-582.898) [-579.317] (-576.713) (-582.675) -- 0:00:32
      763000 -- (-579.657) (-586.331) (-578.268) [-577.028] * (-589.514) [-573.804] (-576.926) (-575.933) -- 0:00:32
      763500 -- (-581.232) (-576.767) (-575.530) [-575.714] * [-584.818] (-586.562) (-577.681) (-581.510) -- 0:00:32
      764000 -- [-580.213] (-585.385) (-580.039) (-577.126) * (-577.426) (-577.828) (-582.612) [-577.269] -- 0:00:32
      764500 -- (-579.752) (-581.223) (-575.627) [-577.014] * [-579.835] (-578.968) (-585.553) (-580.729) -- 0:00:32
      765000 -- [-580.554] (-578.801) (-584.620) (-583.065) * (-579.733) (-578.470) (-582.572) [-581.722] -- 0:00:32

      Average standard deviation of split frequencies: 0.005011

      765500 -- (-579.580) (-578.362) [-578.556] (-581.827) * (-578.618) (-579.286) (-579.659) [-575.974] -- 0:00:32
      766000 -- (-584.425) [-578.697] (-578.327) (-573.588) * (-575.986) [-575.445] (-581.123) (-581.229) -- 0:00:32
      766500 -- (-581.364) [-576.073] (-578.150) (-574.993) * (-577.869) (-579.716) (-575.854) [-581.147] -- 0:00:31
      767000 -- (-579.072) (-575.113) [-577.004] (-580.267) * (-581.663) [-577.195] (-580.214) (-582.041) -- 0:00:31
      767500 -- (-580.966) [-573.598] (-594.277) (-581.117) * [-578.045] (-574.178) (-586.225) (-577.952) -- 0:00:31
      768000 -- (-579.567) (-578.952) (-578.723) [-576.834] * (-580.411) (-576.489) (-578.428) [-578.295] -- 0:00:31
      768500 -- [-579.202] (-579.963) (-583.447) (-583.907) * [-575.968] (-579.576) (-577.788) (-584.292) -- 0:00:31
      769000 -- (-584.996) (-576.241) [-578.768] (-583.403) * [-579.242] (-582.479) (-582.577) (-588.981) -- 0:00:31
      769500 -- (-587.485) (-587.294) (-580.245) [-577.665] * (-579.753) [-578.293] (-581.225) (-580.511) -- 0:00:31
      770000 -- [-575.628] (-585.498) (-578.502) (-579.221) * [-577.688] (-577.257) (-580.327) (-582.716) -- 0:00:31

      Average standard deviation of split frequencies: 0.006292

      770500 -- (-578.910) (-574.899) [-581.848] (-578.673) * [-575.673] (-582.467) (-582.917) (-581.154) -- 0:00:31
      771000 -- [-583.173] (-578.614) (-587.007) (-576.034) * [-581.911] (-580.119) (-580.129) (-582.739) -- 0:00:31
      771500 -- (-583.694) (-578.159) [-576.871] (-586.569) * (-579.173) [-582.705] (-582.946) (-581.584) -- 0:00:31
      772000 -- (-583.972) (-574.600) [-575.527] (-584.146) * (-584.202) (-579.414) [-579.811] (-578.225) -- 0:00:31
      772500 -- (-588.572) (-577.233) [-577.667] (-582.134) * (-581.821) [-578.127] (-574.662) (-576.394) -- 0:00:31
      773000 -- (-580.160) (-580.199) (-581.755) [-577.248] * [-577.692] (-576.098) (-579.241) (-576.213) -- 0:00:31
      773500 -- [-585.043] (-578.592) (-577.331) (-582.834) * (-577.404) (-577.113) (-578.175) [-582.268] -- 0:00:31
      774000 -- [-582.729] (-584.916) (-574.120) (-577.189) * [-576.904] (-577.865) (-580.763) (-582.597) -- 0:00:30
      774500 -- [-580.714] (-584.201) (-582.739) (-582.591) * [-576.207] (-586.481) (-575.771) (-586.637) -- 0:00:30
      775000 -- (-585.052) (-579.478) [-575.773] (-578.634) * (-573.460) (-578.618) (-577.138) [-576.535] -- 0:00:30

      Average standard deviation of split frequencies: 0.006248

      775500 -- [-584.534] (-580.524) (-581.932) (-580.602) * (-577.804) [-578.245] (-579.916) (-590.680) -- 0:00:30
      776000 -- (-581.848) (-574.449) [-577.259] (-578.974) * [-576.387] (-579.914) (-576.966) (-583.007) -- 0:00:30
      776500 -- (-582.132) (-580.109) (-579.720) [-579.447] * (-578.580) (-579.326) (-580.341) [-576.615] -- 0:00:30
      777000 -- (-583.217) (-579.553) [-577.360] (-583.543) * (-575.914) [-580.487] (-579.220) (-582.163) -- 0:00:30
      777500 -- [-578.097] (-575.189) (-579.959) (-579.579) * (-583.661) (-584.202) [-576.467] (-580.112) -- 0:00:30
      778000 -- (-589.833) [-581.394] (-577.405) (-582.817) * (-587.368) [-577.271] (-578.670) (-582.777) -- 0:00:30
      778500 -- (-588.815) (-575.882) (-582.682) [-580.076] * [-577.933] (-576.645) (-577.874) (-578.820) -- 0:00:30
      779000 -- [-576.477] (-579.533) (-582.478) (-576.985) * (-587.102) [-577.090] (-574.444) (-579.253) -- 0:00:30
      779500 -- (-575.946) (-587.083) [-582.133] (-581.669) * (-581.103) (-579.829) (-578.448) [-575.597] -- 0:00:30
      780000 -- (-580.407) [-576.079] (-580.409) (-579.541) * (-580.705) (-579.028) (-575.971) [-580.053] -- 0:00:30

      Average standard deviation of split frequencies: 0.005952

      780500 -- [-578.599] (-575.784) (-580.604) (-581.064) * (-580.789) [-580.637] (-586.955) (-587.286) -- 0:00:30
      781000 -- (-581.092) [-578.301] (-576.994) (-580.801) * (-585.276) [-583.794] (-575.882) (-578.748) -- 0:00:30
      781500 -- (-583.287) [-577.662] (-579.905) (-576.479) * [-576.939] (-578.484) (-581.547) (-576.730) -- 0:00:29
      782000 -- (-580.322) [-580.415] (-580.811) (-581.451) * [-576.601] (-578.622) (-585.467) (-579.074) -- 0:00:29
      782500 -- [-575.323] (-585.937) (-586.436) (-579.815) * [-576.917] (-577.140) (-581.026) (-579.486) -- 0:00:29
      783000 -- (-574.597) [-576.131] (-579.230) (-576.336) * (-587.225) [-578.584] (-576.576) (-578.482) -- 0:00:29
      783500 -- (-580.390) [-577.825] (-583.504) (-577.499) * (-584.814) [-581.393] (-583.678) (-579.057) -- 0:00:29
      784000 -- (-579.781) [-582.202] (-580.383) (-578.503) * (-593.876) (-583.182) (-580.428) [-578.708] -- 0:00:29
      784500 -- (-580.137) (-586.379) (-586.574) [-577.389] * [-580.003] (-579.831) (-576.114) (-582.112) -- 0:00:29
      785000 -- (-577.574) [-577.292] (-574.696) (-589.465) * (-574.883) (-583.263) (-577.543) [-581.738] -- 0:00:29

      Average standard deviation of split frequencies: 0.005826

      785500 -- (-577.425) (-576.021) [-576.521] (-578.750) * [-573.505] (-581.044) (-580.422) (-576.854) -- 0:00:29
      786000 -- [-580.459] (-584.081) (-579.138) (-577.252) * (-576.319) (-583.552) [-578.451] (-576.165) -- 0:00:29
      786500 -- (-578.441) [-578.837] (-578.788) (-577.925) * (-583.659) [-579.149] (-581.113) (-580.422) -- 0:00:29
      787000 -- (-582.478) [-584.936] (-576.998) (-580.320) * (-585.259) [-580.616] (-580.070) (-579.288) -- 0:00:29
      787500 -- (-580.951) (-581.681) [-578.451] (-581.400) * [-582.311] (-583.505) (-582.272) (-577.970) -- 0:00:29
      788000 -- (-579.683) (-577.795) (-581.767) [-582.653] * (-583.501) (-578.621) (-580.262) [-578.752] -- 0:00:29
      788500 -- (-580.044) [-575.892] (-584.401) (-590.160) * (-582.544) (-576.015) (-579.538) [-580.424] -- 0:00:28
      789000 -- (-580.055) (-589.785) [-578.230] (-584.526) * [-579.053] (-576.657) (-583.471) (-583.775) -- 0:00:28
      789500 -- (-577.551) (-579.794) [-581.342] (-581.396) * (-576.801) (-580.153) [-580.363] (-576.366) -- 0:00:28
      790000 -- (-584.526) (-580.228) [-575.384] (-581.528) * (-579.924) (-574.817) [-576.566] (-587.302) -- 0:00:28

      Average standard deviation of split frequencies: 0.005962

      790500 -- (-580.895) (-576.802) [-577.251] (-579.131) * (-578.825) (-577.015) (-577.140) [-580.374] -- 0:00:28
      791000 -- [-578.547] (-581.606) (-579.863) (-577.974) * (-574.889) [-577.592] (-574.874) (-576.987) -- 0:00:28
      791500 -- [-580.624] (-577.709) (-581.641) (-576.215) * (-576.562) [-579.608] (-578.949) (-574.625) -- 0:00:28
      792000 -- (-577.561) [-578.723] (-579.479) (-581.094) * [-581.259] (-582.457) (-580.235) (-576.433) -- 0:00:28
      792500 -- (-580.612) (-582.290) [-575.321] (-580.203) * (-584.233) (-578.897) (-581.427) [-576.583] -- 0:00:28
      793000 -- [-577.700] (-578.697) (-575.528) (-576.009) * (-584.619) (-580.928) [-580.766] (-579.532) -- 0:00:28
      793500 -- (-580.452) (-584.901) [-582.545] (-581.731) * (-579.904) (-585.503) [-581.656] (-584.312) -- 0:00:28
      794000 -- (-574.229) (-582.366) [-577.982] (-578.881) * (-580.163) [-577.150] (-589.037) (-579.011) -- 0:00:28
      794500 -- [-582.606] (-584.354) (-580.765) (-576.509) * (-588.244) (-583.933) [-583.275] (-584.658) -- 0:00:28
      795000 -- [-586.093] (-582.958) (-576.943) (-578.818) * [-579.122] (-579.915) (-585.046) (-577.084) -- 0:00:28

      Average standard deviation of split frequencies: 0.005668

      795500 -- (-578.912) (-592.678) (-583.250) [-580.868] * [-583.391] (-576.700) (-579.500) (-582.712) -- 0:00:28
      796000 -- [-583.564] (-587.388) (-578.668) (-582.204) * [-579.210] (-576.303) (-587.550) (-578.394) -- 0:00:27
      796500 -- [-577.938] (-584.310) (-587.269) (-574.859) * (-589.836) (-575.770) [-575.190] (-579.257) -- 0:00:27
      797000 -- (-577.299) [-582.652] (-586.435) (-583.096) * (-582.104) (-579.332) [-577.573] (-590.511) -- 0:00:27
      797500 -- (-579.933) [-585.928] (-578.872) (-580.235) * (-576.059) (-585.032) [-576.100] (-580.911) -- 0:00:27
      798000 -- (-580.876) (-582.727) [-582.402] (-578.565) * (-580.166) [-580.499] (-581.612) (-587.303) -- 0:00:27
      798500 -- (-578.106) (-581.834) [-574.595] (-584.132) * (-583.362) (-581.291) [-578.945] (-587.342) -- 0:00:27
      799000 -- (-574.464) (-587.578) (-580.728) [-583.954] * [-582.681] (-576.865) (-577.933) (-587.138) -- 0:00:27
      799500 -- (-574.085) (-581.253) [-577.324] (-585.365) * (-581.114) [-576.542] (-581.371) (-575.499) -- 0:00:27
      800000 -- (-579.129) [-574.747] (-581.682) (-579.836) * (-584.155) (-580.657) [-574.516] (-579.836) -- 0:00:27

      Average standard deviation of split frequencies: 0.005635

      800500 -- (-578.420) (-577.577) (-579.741) [-578.527] * (-583.951) [-577.837] (-578.125) (-577.740) -- 0:00:27
      801000 -- [-573.914] (-581.713) (-582.239) (-575.261) * (-584.640) (-579.710) [-573.669] (-580.123) -- 0:00:27
      801500 -- [-578.670] (-579.497) (-581.903) (-581.870) * (-582.123) (-581.746) [-575.157] (-574.259) -- 0:00:27
      802000 -- (-577.519) [-579.706] (-581.674) (-576.728) * (-589.137) [-576.129] (-579.711) (-578.826) -- 0:00:27
      802500 -- [-578.384] (-580.453) (-577.144) (-581.913) * (-588.215) [-580.123] (-575.391) (-582.956) -- 0:00:27
      803000 -- (-572.879) [-580.765] (-579.475) (-583.765) * (-583.757) (-581.076) [-578.605] (-574.229) -- 0:00:26
      803500 -- [-580.542] (-578.526) (-579.440) (-581.168) * [-586.604] (-585.175) (-579.081) (-579.901) -- 0:00:26
      804000 -- (-573.995) (-586.715) (-575.048) [-575.804] * (-588.760) (-581.188) [-578.535] (-577.552) -- 0:00:26
      804500 -- (-577.238) (-577.329) (-582.777) [-576.522] * (-586.161) (-581.596) [-578.270] (-576.293) -- 0:00:26
      805000 -- [-578.553] (-581.106) (-582.893) (-577.953) * (-579.803) [-581.367] (-578.648) (-574.469) -- 0:00:26

      Average standard deviation of split frequencies: 0.006183

      805500 -- (-579.632) (-584.395) (-580.711) [-577.710] * (-577.859) [-581.162] (-577.820) (-577.409) -- 0:00:26
      806000 -- (-578.926) (-581.726) (-580.716) [-576.624] * [-580.881] (-581.955) (-578.836) (-576.481) -- 0:00:26
      806500 -- (-577.937) [-578.614] (-576.411) (-576.987) * (-584.199) (-583.210) (-584.090) [-578.033] -- 0:00:26
      807000 -- [-575.929] (-578.290) (-580.998) (-580.497) * (-578.985) (-579.667) [-579.087] (-580.747) -- 0:00:26
      807500 -- (-581.475) (-577.312) (-576.083) [-578.970] * (-583.359) (-578.545) [-573.675] (-579.953) -- 0:00:26
      808000 -- [-576.397] (-577.520) (-575.616) (-578.703) * (-585.105) (-582.893) [-578.493] (-581.724) -- 0:00:26
      808500 -- (-580.236) (-579.051) (-580.900) [-580.113] * (-581.748) [-584.982] (-575.488) (-578.334) -- 0:00:26
      809000 -- (-576.402) (-578.320) [-579.306] (-581.095) * (-579.895) [-576.615] (-584.533) (-580.106) -- 0:00:26
      809500 -- (-575.974) (-581.473) (-584.007) [-580.610] * (-582.900) (-579.614) [-577.846] (-578.051) -- 0:00:26
      810000 -- [-577.598] (-576.765) (-583.601) (-579.259) * (-578.504) (-579.663) [-580.141] (-586.355) -- 0:00:26

      Average standard deviation of split frequencies: 0.006313

      810500 -- (-581.245) (-579.622) (-580.716) [-577.421] * (-579.087) [-581.942] (-585.728) (-579.026) -- 0:00:25
      811000 -- (-579.117) (-577.234) (-576.307) [-575.518] * (-587.441) (-579.195) (-580.615) [-579.087] -- 0:00:25
      811500 -- (-584.081) (-577.274) [-577.557] (-584.102) * (-587.123) (-579.227) [-577.340] (-577.607) -- 0:00:25
      812000 -- (-578.416) [-578.432] (-583.764) (-575.432) * (-583.209) (-585.669) (-580.307) [-583.064] -- 0:00:25
      812500 -- (-579.157) (-583.376) [-577.048] (-584.402) * (-575.826) (-589.225) (-576.056) [-583.150] -- 0:00:25
      813000 -- (-580.517) (-581.510) [-577.534] (-580.217) * (-577.393) (-576.896) [-579.394] (-579.415) -- 0:00:25
      813500 -- (-574.935) [-586.266] (-582.394) (-582.280) * (-582.255) [-576.594] (-581.444) (-578.466) -- 0:00:25
      814000 -- [-579.722] (-580.110) (-581.019) (-578.062) * (-577.059) (-579.849) [-581.831] (-578.122) -- 0:00:25
      814500 -- (-576.489) (-577.273) (-585.250) [-574.965] * (-578.612) (-578.477) (-577.941) [-582.001] -- 0:00:25
      815000 -- [-575.917] (-580.292) (-583.866) (-577.929) * (-577.491) (-574.677) [-574.650] (-577.205) -- 0:00:25

      Average standard deviation of split frequencies: 0.006437

      815500 -- (-579.969) [-575.702] (-588.321) (-586.768) * (-579.203) (-580.763) [-574.739] (-580.255) -- 0:00:25
      816000 -- (-578.381) (-580.474) [-581.673] (-578.450) * [-578.514] (-581.998) (-574.589) (-582.359) -- 0:00:25
      816500 -- [-580.614] (-574.867) (-584.863) (-576.669) * (-577.968) (-582.601) [-578.158] (-582.454) -- 0:00:25
      817000 -- (-578.916) [-574.103] (-587.599) (-578.038) * (-579.600) [-573.913] (-575.563) (-579.059) -- 0:00:25
      817500 -- (-580.100) (-580.890) (-575.669) [-574.749] * [-576.620] (-580.935) (-578.092) (-580.694) -- 0:00:25
      818000 -- (-580.817) [-574.252] (-582.264) (-576.869) * (-580.170) (-581.305) (-586.451) [-576.990] -- 0:00:24
      818500 -- (-581.630) [-576.641] (-573.928) (-584.930) * [-578.337] (-585.235) (-580.144) (-578.316) -- 0:00:24
      819000 -- (-584.845) (-581.824) [-577.730] (-581.125) * (-579.324) (-578.850) (-581.864) [-579.786] -- 0:00:24
      819500 -- [-580.722] (-577.576) (-577.691) (-577.559) * (-576.504) (-579.428) (-579.305) [-576.787] -- 0:00:24
      820000 -- (-583.342) [-574.846] (-580.941) (-577.184) * (-583.942) [-585.346] (-577.849) (-579.029) -- 0:00:24

      Average standard deviation of split frequencies: 0.006729

      820500 -- [-577.843] (-579.920) (-583.749) (-581.566) * [-579.644] (-580.249) (-577.323) (-576.889) -- 0:00:24
      821000 -- (-578.176) (-585.560) [-579.748] (-590.809) * [-574.443] (-584.536) (-575.934) (-583.956) -- 0:00:24
      821500 -- (-583.718) [-580.635] (-577.244) (-577.937) * (-583.208) [-582.003] (-575.904) (-580.862) -- 0:00:24
      822000 -- [-575.223] (-582.288) (-577.412) (-576.100) * (-576.737) (-582.392) [-580.172] (-575.588) -- 0:00:24
      822500 -- (-579.698) [-582.689] (-590.343) (-579.027) * (-576.543) (-584.449) (-582.132) [-578.849] -- 0:00:24
      823000 -- (-576.957) (-579.388) [-577.755] (-580.903) * [-577.045] (-585.608) (-577.809) (-580.862) -- 0:00:24
      823500 -- (-576.774) [-580.537] (-590.056) (-579.086) * [-588.137] (-579.134) (-579.248) (-578.164) -- 0:00:24
      824000 -- (-580.168) (-583.705) (-583.798) [-581.195] * [-577.226] (-581.174) (-577.295) (-577.834) -- 0:00:24
      824500 -- (-577.152) (-583.515) [-577.752] (-580.285) * (-582.005) (-576.440) [-579.872] (-582.746) -- 0:00:24
      825000 -- (-583.220) (-583.717) (-580.077) [-581.493] * (-574.810) (-577.902) [-581.547] (-585.943) -- 0:00:23

      Average standard deviation of split frequencies: 0.006848

      825500 -- (-580.567) [-582.058] (-581.405) (-581.810) * [-574.427] (-582.172) (-585.542) (-581.106) -- 0:00:23
      826000 -- (-579.291) (-579.569) (-591.454) [-583.866] * [-575.118] (-581.652) (-582.414) (-580.174) -- 0:00:23
      826500 -- [-583.756] (-577.842) (-587.299) (-584.756) * (-577.601) [-580.048] (-580.355) (-577.679) -- 0:00:23
      827000 -- (-577.152) (-582.301) (-578.421) [-574.694] * (-578.122) (-582.678) (-584.930) [-572.934] -- 0:00:23
      827500 -- (-577.040) (-582.437) (-578.861) [-575.386] * (-574.993) (-583.212) (-578.283) [-576.318] -- 0:00:23
      828000 -- (-573.495) (-580.338) (-581.815) [-580.713] * [-581.850] (-583.659) (-576.391) (-575.065) -- 0:00:23
      828500 -- (-580.502) (-579.100) (-579.696) [-578.650] * (-580.218) (-582.214) (-581.016) [-580.141] -- 0:00:23
      829000 -- [-591.171] (-583.875) (-580.631) (-579.917) * (-581.969) [-584.156] (-577.797) (-573.896) -- 0:00:23
      829500 -- (-581.507) (-581.960) (-579.686) [-579.509] * (-578.591) (-577.895) (-575.822) [-573.550] -- 0:00:23
      830000 -- (-586.224) (-578.498) (-579.170) [-576.112] * [-578.817] (-581.199) (-574.667) (-579.849) -- 0:00:23

      Average standard deviation of split frequencies: 0.006648

      830500 -- (-578.233) [-576.576] (-582.064) (-580.713) * (-584.352) (-580.915) (-578.491) [-577.702] -- 0:00:23
      831000 -- (-576.018) [-575.235] (-579.083) (-579.089) * (-580.047) (-577.052) [-579.856] (-575.311) -- 0:00:23
      831500 -- (-585.630) (-583.445) [-576.326] (-584.741) * (-581.208) [-576.488] (-580.793) (-578.602) -- 0:00:23
      832000 -- (-581.138) (-578.252) [-576.499] (-580.375) * [-581.004] (-577.888) (-577.128) (-575.944) -- 0:00:23
      832500 -- [-574.494] (-578.202) (-575.930) (-574.539) * (-580.813) (-578.625) [-576.925] (-582.218) -- 0:00:22
      833000 -- (-584.525) (-576.936) [-575.289] (-584.086) * [-578.435] (-584.766) (-580.239) (-574.348) -- 0:00:22
      833500 -- (-587.117) (-579.946) (-577.953) [-580.786] * [-576.463] (-576.256) (-583.235) (-577.252) -- 0:00:22
      834000 -- (-576.448) [-578.425] (-579.935) (-582.649) * [-576.426] (-575.305) (-580.820) (-592.214) -- 0:00:22
      834500 -- (-581.072) (-586.912) [-580.029] (-582.103) * (-580.723) [-576.929] (-578.148) (-582.395) -- 0:00:22
      835000 -- (-584.375) (-585.266) [-577.246] (-583.533) * (-576.963) (-582.165) (-585.204) [-582.111] -- 0:00:22

      Average standard deviation of split frequencies: 0.006686

      835500 -- (-578.428) [-580.353] (-575.634) (-578.276) * (-582.986) (-577.810) (-579.947) [-581.709] -- 0:00:22
      836000 -- (-576.624) (-578.060) [-578.086] (-581.620) * (-577.360) [-574.811] (-582.030) (-581.408) -- 0:00:22
      836500 -- (-577.267) [-587.192] (-575.299) (-582.795) * [-577.481] (-576.934) (-580.173) (-577.328) -- 0:00:22
      837000 -- (-576.076) (-582.594) [-573.818] (-580.126) * (-576.517) (-575.843) (-582.194) [-581.851] -- 0:00:22
      837500 -- (-577.409) [-583.960] (-576.933) (-576.559) * (-580.374) (-575.978) [-573.607] (-576.300) -- 0:00:22
      838000 -- (-577.612) (-581.247) [-580.443] (-579.377) * (-578.095) [-578.980] (-583.432) (-578.891) -- 0:00:22
      838500 -- [-578.570] (-576.712) (-576.360) (-581.937) * [-577.605] (-576.063) (-577.617) (-579.820) -- 0:00:22
      839000 -- (-578.237) [-577.865] (-582.653) (-580.214) * (-581.075) (-578.907) (-580.876) [-577.113] -- 0:00:22
      839500 -- [-583.741] (-582.930) (-581.300) (-576.522) * [-579.900] (-579.508) (-575.705) (-580.466) -- 0:00:21
      840000 -- (-576.435) [-581.392] (-576.849) (-578.820) * (-576.398) [-578.991] (-587.027) (-581.516) -- 0:00:21

      Average standard deviation of split frequencies: 0.006168

      840500 -- [-579.780] (-583.743) (-576.815) (-576.470) * (-579.827) (-578.519) (-582.271) [-579.241] -- 0:00:21
      841000 -- (-583.032) (-579.845) (-578.591) [-579.504] * (-576.698) [-580.616] (-579.518) (-578.043) -- 0:00:21
      841500 -- (-580.121) (-577.815) (-576.192) [-581.695] * (-584.663) (-583.597) [-578.304] (-582.667) -- 0:00:21
      842000 -- [-580.637] (-580.657) (-577.910) (-577.301) * (-580.300) (-581.815) [-576.794] (-577.599) -- 0:00:21
      842500 -- (-581.213) (-579.319) (-580.531) [-578.075] * (-582.943) (-578.764) [-579.521] (-576.532) -- 0:00:21
      843000 -- (-584.026) (-581.307) (-588.078) [-577.273] * (-578.422) [-580.578] (-577.862) (-580.412) -- 0:00:21
      843500 -- (-576.039) [-582.012] (-580.110) (-580.069) * (-582.347) (-576.971) [-579.458] (-579.598) -- 0:00:21
      844000 -- (-578.564) (-579.880) [-579.048] (-581.688) * [-580.456] (-577.532) (-584.554) (-576.117) -- 0:00:21
      844500 -- (-583.007) (-577.743) [-582.869] (-580.659) * (-583.652) (-574.057) [-579.970] (-582.441) -- 0:00:21
      845000 -- (-579.859) [-575.772] (-577.948) (-580.366) * (-580.569) (-579.353) [-582.429] (-580.852) -- 0:00:21

      Average standard deviation of split frequencies: 0.005970

      845500 -- (-574.348) (-576.178) [-586.895] (-580.759) * (-583.020) (-584.917) [-577.500] (-579.440) -- 0:00:21
      846000 -- (-576.406) [-580.174] (-590.653) (-585.208) * (-586.439) (-578.683) [-578.863] (-583.361) -- 0:00:21
      846500 -- (-580.195) [-579.578] (-585.958) (-590.579) * (-579.670) [-579.870] (-579.235) (-574.776) -- 0:00:21
      847000 -- (-578.078) (-577.949) (-593.184) [-585.222] * (-575.745) (-583.940) (-577.408) [-574.558] -- 0:00:20
      847500 -- (-580.063) (-577.432) (-581.875) [-576.892] * [-577.661] (-578.298) (-578.458) (-586.152) -- 0:00:20
      848000 -- (-580.931) [-578.305] (-580.243) (-581.902) * (-583.147) [-581.060] (-583.245) (-577.945) -- 0:00:20
      848500 -- (-580.009) [-578.310] (-579.324) (-582.308) * (-578.802) (-580.625) (-577.496) [-577.669] -- 0:00:20
      849000 -- [-577.735] (-578.135) (-578.041) (-580.125) * [-576.321] (-579.283) (-577.331) (-583.185) -- 0:00:20
      849500 -- [-579.005] (-578.551) (-584.030) (-577.531) * [-577.207] (-572.330) (-577.925) (-579.688) -- 0:00:20
      850000 -- (-579.387) (-576.655) (-578.140) [-579.603] * (-586.619) (-575.090) [-580.440] (-582.897) -- 0:00:20

      Average standard deviation of split frequencies: 0.005542

      850500 -- [-579.232] (-574.603) (-578.664) (-577.823) * [-577.382] (-578.805) (-581.045) (-586.721) -- 0:00:20
      851000 -- (-577.512) (-581.258) (-581.722) [-578.058] * (-580.425) [-577.126] (-578.656) (-582.031) -- 0:00:20
      851500 -- (-578.064) (-577.598) (-590.720) [-577.355] * (-584.171) (-584.082) (-578.914) [-580.049] -- 0:00:20
      852000 -- [-582.600] (-583.574) (-576.675) (-577.573) * (-588.700) (-587.604) (-577.949) [-578.537] -- 0:00:20
      852500 -- (-578.541) (-582.563) (-575.959) [-580.236] * (-581.286) [-582.608] (-578.660) (-587.991) -- 0:00:20
      853000 -- (-580.449) [-582.147] (-584.579) (-580.580) * (-588.328) (-575.086) [-577.063] (-584.196) -- 0:00:20
      853500 -- (-577.915) [-588.130] (-580.762) (-583.531) * (-585.218) [-576.508] (-575.547) (-584.786) -- 0:00:20
      854000 -- [-577.929] (-580.169) (-578.053) (-579.725) * (-589.542) [-582.448] (-574.725) (-577.815) -- 0:00:20
      854500 -- (-577.712) (-578.393) (-576.025) [-581.710] * [-588.430] (-577.660) (-578.002) (-578.738) -- 0:00:19
      855000 -- (-580.330) [-580.002] (-576.951) (-576.686) * (-583.657) (-580.027) (-578.907) [-578.963] -- 0:00:19

      Average standard deviation of split frequencies: 0.005114

      855500 -- (-581.473) [-583.514] (-577.384) (-582.157) * (-580.535) (-581.277) [-579.524] (-583.255) -- 0:00:19
      856000 -- (-581.282) [-580.109] (-574.950) (-580.898) * (-577.076) [-579.011] (-577.528) (-583.068) -- 0:00:19
      856500 -- (-585.784) [-577.242] (-578.153) (-577.611) * [-577.053] (-578.306) (-577.618) (-584.744) -- 0:00:19
      857000 -- (-580.285) (-582.551) [-576.908] (-576.962) * (-578.425) [-578.681] (-573.244) (-586.175) -- 0:00:19
      857500 -- (-581.503) (-578.436) [-577.733] (-585.739) * [-581.247] (-581.013) (-575.874) (-578.458) -- 0:00:19
      858000 -- (-580.181) (-577.200) [-580.029] (-580.005) * (-581.021) [-582.879] (-579.365) (-582.171) -- 0:00:19
      858500 -- (-575.605) (-582.595) (-581.086) [-576.015] * (-582.581) [-581.748] (-581.402) (-578.336) -- 0:00:19
      859000 -- (-576.930) (-580.108) [-578.253] (-583.032) * [-575.687] (-578.022) (-580.727) (-578.837) -- 0:00:19
      859500 -- [-580.438] (-581.112) (-580.117) (-585.327) * (-581.080) [-576.587] (-577.234) (-580.936) -- 0:00:19
      860000 -- (-578.639) (-579.747) (-578.616) [-577.476] * (-579.672) [-577.502] (-583.047) (-579.033) -- 0:00:19

      Average standard deviation of split frequencies: 0.004773

      860500 -- (-577.547) (-580.356) (-583.086) [-575.440] * (-578.616) (-579.264) [-582.140] (-576.714) -- 0:00:19
      861000 -- (-583.701) [-578.006] (-579.284) (-582.000) * (-578.868) (-583.822) [-580.105] (-579.428) -- 0:00:19
      861500 -- [-580.346] (-577.613) (-579.833) (-575.814) * (-578.650) (-582.786) (-582.207) [-583.936] -- 0:00:18
      862000 -- (-578.400) [-579.831] (-576.590) (-582.569) * (-579.415) [-581.329] (-576.618) (-582.902) -- 0:00:18
      862500 -- [-580.969] (-580.590) (-577.523) (-579.280) * (-583.412) (-575.351) [-579.071] (-577.612) -- 0:00:18
      863000 -- (-580.251) [-578.991] (-577.937) (-578.344) * (-590.562) [-576.980] (-583.812) (-578.557) -- 0:00:18
      863500 -- [-580.198] (-583.987) (-581.229) (-580.097) * (-578.849) (-580.385) (-580.231) [-578.934] -- 0:00:18
      864000 -- (-585.188) (-581.291) [-577.415] (-575.410) * (-579.270) [-582.569] (-577.921) (-577.728) -- 0:00:18
      864500 -- (-585.795) (-586.821) [-582.480] (-585.921) * (-583.111) (-583.571) (-579.620) [-575.453] -- 0:00:18
      865000 -- (-590.215) (-581.381) [-579.734] (-581.771) * (-576.812) (-575.595) [-575.761] (-579.987) -- 0:00:18

      Average standard deviation of split frequencies: 0.004199

      865500 -- [-581.849] (-583.329) (-586.129) (-579.518) * (-577.356) (-574.557) (-577.469) [-577.228] -- 0:00:18
      866000 -- [-586.534] (-580.724) (-585.839) (-583.287) * [-580.782] (-574.608) (-583.685) (-577.970) -- 0:00:18
      866500 -- (-578.393) (-579.131) (-586.700) [-578.339] * (-580.045) (-582.551) [-578.225] (-579.820) -- 0:00:18
      867000 -- (-586.173) (-584.870) [-577.711] (-577.084) * (-575.824) [-577.345] (-579.290) (-585.506) -- 0:00:18
      867500 -- (-581.642) (-574.802) [-577.032] (-575.385) * [-573.456] (-574.050) (-579.920) (-582.340) -- 0:00:18
      868000 -- (-579.354) (-572.763) [-578.580] (-577.122) * (-581.781) (-581.706) (-583.366) [-582.103] -- 0:00:18
      868500 -- [-579.993] (-583.073) (-583.353) (-578.294) * (-575.550) (-578.346) [-574.750] (-579.306) -- 0:00:18
      869000 -- (-582.278) [-577.368] (-578.868) (-580.667) * (-576.889) (-578.351) [-576.862] (-584.047) -- 0:00:17
      869500 -- (-579.610) [-574.917] (-574.806) (-589.038) * (-578.189) [-576.997] (-577.960) (-587.422) -- 0:00:17
      870000 -- (-582.144) (-577.600) [-574.665] (-579.530) * (-577.437) (-576.862) [-581.130] (-576.629) -- 0:00:17

      Average standard deviation of split frequencies: 0.003481

      870500 -- (-584.083) (-581.385) (-576.205) [-580.517] * (-582.545) [-581.240] (-578.695) (-578.287) -- 0:00:17
      871000 -- (-578.383) (-578.118) (-576.589) [-577.158] * [-576.799] (-578.338) (-577.336) (-578.327) -- 0:00:17
      871500 -- (-583.564) (-575.329) [-580.532] (-576.161) * (-573.367) (-582.534) (-591.549) [-576.517] -- 0:00:17
      872000 -- (-583.060) (-580.832) [-575.215] (-582.030) * [-574.527] (-576.251) (-577.382) (-577.797) -- 0:00:17
      872500 -- (-576.431) (-581.902) (-574.190) [-579.158] * (-580.810) [-583.181] (-583.612) (-578.806) -- 0:00:17
      873000 -- [-581.524] (-585.771) (-582.755) (-578.894) * [-575.224] (-575.998) (-583.024) (-578.649) -- 0:00:17
      873500 -- (-573.814) (-576.846) [-577.123] (-578.868) * (-572.832) (-583.407) [-577.810] (-582.739) -- 0:00:17
      874000 -- (-590.790) [-584.954] (-580.380) (-580.656) * (-581.600) [-579.605] (-578.780) (-583.710) -- 0:00:17
      874500 -- (-574.949) [-580.748] (-582.155) (-584.325) * (-579.148) (-578.198) (-581.609) [-579.188] -- 0:00:17
      875000 -- (-577.713) [-581.455] (-578.064) (-584.837) * (-577.917) [-580.192] (-580.577) (-580.739) -- 0:00:17

      Average standard deviation of split frequencies: 0.003229

      875500 -- (-573.439) (-591.082) (-574.691) [-582.016] * (-582.649) [-579.176] (-582.413) (-580.001) -- 0:00:17
      876000 -- [-578.926] (-584.853) (-583.150) (-583.749) * (-583.933) [-574.087] (-580.780) (-577.818) -- 0:00:16
      876500 -- (-577.399) (-581.801) (-580.944) [-577.092] * [-577.559] (-582.391) (-581.415) (-584.555) -- 0:00:16
      877000 -- (-580.195) (-579.882) (-576.928) [-577.714] * (-587.032) [-581.854] (-580.470) (-579.203) -- 0:00:16
      877500 -- (-579.714) (-584.411) (-581.979) [-580.018] * (-578.989) (-577.017) (-579.463) [-574.153] -- 0:00:16
      878000 -- (-579.586) (-577.898) (-587.037) [-577.671] * (-578.736) (-583.158) [-577.940] (-580.118) -- 0:00:16
      878500 -- [-574.207] (-576.612) (-581.214) (-576.398) * [-578.111] (-579.577) (-578.428) (-582.567) -- 0:00:16
      879000 -- (-577.218) (-583.257) (-581.935) [-577.725] * [-581.714] (-578.660) (-582.155) (-577.833) -- 0:00:16
      879500 -- (-582.133) (-578.156) (-579.736) [-578.