--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 02 15:23:30 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/143/CG42404-PF/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.05 -920.58
2 -902.42 -917.98
--------------------------------------
TOTAL -902.22 -919.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.268821 0.052009 0.853714 1.730708 1.249277 1252.22 1376.61 1.001
r(A<->C){all} 0.062076 0.000805 0.013374 0.117128 0.058357 648.52 766.71 1.000
r(A<->G){all} 0.309898 0.006325 0.167056 0.473700 0.302486 649.60 699.33 1.001
r(A<->T){all} 0.048614 0.001635 0.000004 0.126531 0.038888 635.20 667.13 1.002
r(C<->G){all} 0.060836 0.000568 0.019268 0.107490 0.058402 972.84 1016.37 1.000
r(C<->T){all} 0.447272 0.007439 0.277694 0.605797 0.446625 468.21 533.35 1.000
r(G<->T){all} 0.071304 0.001282 0.009186 0.140505 0.065774 547.54 575.34 1.000
pi(A){all} 0.199817 0.000429 0.158778 0.240747 0.199497 1100.68 1107.35 1.000
pi(C){all} 0.293292 0.000574 0.245764 0.338201 0.293025 1204.01 1210.33 1.000
pi(G){all} 0.303565 0.000591 0.257447 0.349787 0.303071 989.78 1044.92 1.000
pi(T){all} 0.203325 0.000464 0.162366 0.247852 0.203335 935.18 979.95 1.000
alpha{1,2} 0.076717 0.000451 0.027168 0.120270 0.077426 1017.23 1104.00 1.001
alpha{3} 2.168964 0.613283 0.930709 3.843801 2.042884 1244.39 1275.74 1.001
pinvar{all} 0.513680 0.003394 0.399276 0.624896 0.517660 1183.53 1205.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -812.22435
Model 2: PositiveSelection -812.223634
Model 0: one-ratio -812.223634
Model 3: discrete -812.223634
Model 7: beta -812.233035
Model 8: beta&w>1 -812.233751
Model 0 vs 1 0.0014320000000225264
Model 2 vs 1 0.0014320000000225264
Model 8 vs 7 0.0014320000000225264
>C1
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C2
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C3
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C4
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C5
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C6
MYLLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C7
MYFLALLAFIGNAKDGSAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C8
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C9
MYFLALLAFIGNAKDGNAVSSSMIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C10
MYFLALLAFIGNAKDGNAVSSSLGGSCRDYNGKMYETGMHYMPGPDSCRL
CICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGSTD
FGIoo
>C11
MYFLALLAFIGNAKDGNAVSSSLGGSCRDYNGKMYETGMHYMPGPDSCRL
CICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGSTD
FGIoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=107
C1 MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
C2 MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
C3 MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
C4 MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
C5 MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
C6 MYLLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
C7 MYFLALLAFIGNAKDGSAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
C8 MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
C9 MYFLALLAFIGNAKDGNAVSSSMIPGGSCRDYNGKMYETGMHYMPGPDSC
C10 MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC
C11 MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC
**:*************.*****: *************************
C1 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C2 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C3 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C4 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C5 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C6 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C7 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C8 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C9 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C10 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
C11 RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
**************************************************
C1 TDFGI--
C2 TDFGI--
C3 TDFGI--
C4 TDFGI--
C5 TDFGI--
C6 TDFGI--
C7 TDFGI--
C8 TDFGI--
C9 TDFGI--
C10 TDFGIoo
C11 TDFGIoo
*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 105 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11730]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [11730]--->[11662]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/143/CG42404-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.541 Mb, Max= 30.825 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C2
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C3
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C4
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C5
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C6
MYLLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C7
MYFLALLAFIGNAKDGSAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C8
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C9
MYFLALLAFIGNAKDGNAVSSSMIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C10
MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGIoo
>C11
MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGIoo
FORMAT of file /tmp/tmp5099483208155293866aln Not Supported[FATAL:T-COFFEE]
>C1
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C2
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C3
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C4
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C5
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C6
MYLLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C7
MYFLALLAFIGNAKDGSAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C8
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C9
MYFLALLAFIGNAKDGNAVSSSMIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI--
>C10
MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGIoo
>C11
MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGIoo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:107 S:99 BS:107
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.05 C1 C6 99.05
TOP 5 0 99.05 C6 C1 99.05
BOT 0 6 99.05 C1 C7 99.05
TOP 6 0 99.05 C7 C1 99.05
BOT 0 7 100.00 C1 C8 100.00
TOP 7 0 100.00 C8 C1 100.00
BOT 0 8 99.05 C1 C9 99.05
TOP 8 0 99.05 C9 C1 99.05
BOT 0 9 100.00 C1 C10 100.00
TOP 9 0 100.00 C10 C1 100.00
BOT 0 10 100.00 C1 C11 100.00
TOP 10 0 100.00 C11 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.05 C2 C6 99.05
TOP 5 1 99.05 C6 C2 99.05
BOT 1 6 99.05 C2 C7 99.05
TOP 6 1 99.05 C7 C2 99.05
BOT 1 7 100.00 C2 C8 100.00
TOP 7 1 100.00 C8 C2 100.00
BOT 1 8 99.05 C2 C9 99.05
TOP 8 1 99.05 C9 C2 99.05
BOT 1 9 100.00 C2 C10 100.00
TOP 9 1 100.00 C10 C2 100.00
BOT 1 10 100.00 C2 C11 100.00
TOP 10 1 100.00 C11 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.05 C3 C6 99.05
TOP 5 2 99.05 C6 C3 99.05
BOT 2 6 99.05 C3 C7 99.05
TOP 6 2 99.05 C7 C3 99.05
BOT 2 7 100.00 C3 C8 100.00
TOP 7 2 100.00 C8 C3 100.00
BOT 2 8 99.05 C3 C9 99.05
TOP 8 2 99.05 C9 C3 99.05
BOT 2 9 100.00 C3 C10 100.00
TOP 9 2 100.00 C10 C3 100.00
BOT 2 10 100.00 C3 C11 100.00
TOP 10 2 100.00 C11 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.05 C4 C6 99.05
TOP 5 3 99.05 C6 C4 99.05
BOT 3 6 99.05 C4 C7 99.05
TOP 6 3 99.05 C7 C4 99.05
BOT 3 7 100.00 C4 C8 100.00
TOP 7 3 100.00 C8 C4 100.00
BOT 3 8 99.05 C4 C9 99.05
TOP 8 3 99.05 C9 C4 99.05
BOT 3 9 100.00 C4 C10 100.00
TOP 9 3 100.00 C10 C4 100.00
BOT 3 10 100.00 C4 C11 100.00
TOP 10 3 100.00 C11 C4 100.00
BOT 4 5 99.05 C5 C6 99.05
TOP 5 4 99.05 C6 C5 99.05
BOT 4 6 99.05 C5 C7 99.05
TOP 6 4 99.05 C7 C5 99.05
BOT 4 7 100.00 C5 C8 100.00
TOP 7 4 100.00 C8 C5 100.00
BOT 4 8 99.05 C5 C9 99.05
TOP 8 4 99.05 C9 C5 99.05
BOT 4 9 100.00 C5 C10 100.00
TOP 9 4 100.00 C10 C5 100.00
BOT 4 10 100.00 C5 C11 100.00
TOP 10 4 100.00 C11 C5 100.00
BOT 5 6 98.10 C6 C7 98.10
TOP 6 5 98.10 C7 C6 98.10
BOT 5 7 99.05 C6 C8 99.05
TOP 7 5 99.05 C8 C6 99.05
BOT 5 8 98.10 C6 C9 98.10
TOP 8 5 98.10 C9 C6 98.10
BOT 5 9 99.03 C6 C10 99.03
TOP 9 5 99.03 C10 C6 99.03
BOT 5 10 99.03 C6 C11 99.03
TOP 10 5 99.03 C11 C6 99.03
BOT 6 7 99.05 C7 C8 99.05
TOP 7 6 99.05 C8 C7 99.05
BOT 6 8 98.10 C7 C9 98.10
TOP 8 6 98.10 C9 C7 98.10
BOT 6 9 99.03 C7 C10 99.03
TOP 9 6 99.03 C10 C7 99.03
BOT 6 10 99.03 C7 C11 99.03
TOP 10 6 99.03 C11 C7 99.03
BOT 7 8 99.05 C8 C9 99.05
TOP 8 7 99.05 C9 C8 99.05
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 8 9 99.03 C9 C10 99.03
TOP 9 8 99.03 C10 C9 99.03
BOT 8 10 99.03 C9 C11 99.03
TOP 10 8 99.03 C11 C9 99.03
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
AVG 0 C1 * 99.71
AVG 1 C2 * 99.71
AVG 2 C3 * 99.71
AVG 3 C4 * 99.71
AVG 4 C5 * 99.71
AVG 5 C6 * 98.85
AVG 6 C7 * 98.85
AVG 7 C8 * 99.71
AVG 8 C9 * 98.85
AVG 9 C10 * 99.71
AVG 10 C11 * 99.71
TOT TOT * 99.48
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA
C2 ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
C3 ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
C4 ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA
C5 ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
C6 ATGTATCTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
C7 ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGGAG
C8 ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
C9 ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
C10 ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA
C11 ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
****** ******************* ********************.*.
C1 CGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG
C2 TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG
C3 TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG
C4 TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGACTACAATG
C5 TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGACTACAATG
C6 TGCGGTGAGCTCGAGCCTGATCCCCGGCGGGTCCTGCCGCGACTACAATG
C7 CGCGGTGAGCTCGAGCCTTATCCCCGGCGGCTCCTGCCGCGACTACAATG
C8 TGCGGTGAGCTCGAGCCTGATCCCTGGCGGCTCCTGCCGGGACTACAATG
C9 CGCGGTGAGCTCAAGCATGATCCCAGGTGGGTCTTGCCGGGATTACAATG
C10 CGCGGTGAGCTCGAGCCTC------GGAGGCTCCTGCCGCGACTATAATG
C11 CGCTGTGAGCTCGAGCCTC------GGAGGCTCCTGCCGCGACTATAATG
** ********.***.* ** ** ** ***** ** ** ****
C1 GAAAGATGTACGAGACTGGCATGCACTATATGCCGGGACCCGACTCATGC
C2 GCAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCATGC
C3 GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCGTGC
C4 GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCATGC
C5 GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCGGACTCATGT
C6 GGAAGATGTACGAGACGGGCATGCACTACATGCCCGGTCCCGACTCCTGC
C7 GAAAGATGTACGAGACGGGCATGCACTACATGCCGGGGCCCGACTCCTGT
C8 GGAAGATGTACGAGACGGGCATGCATTATATGCCAGGACCGGACTCCTGC
C9 GGAAAATGTACGAGACGGGAATGCACTATATGCCAGGTCCCGACTCTTGC
C10 GGAAGATGTACGAGACGGGCATGCACTATATGCCAGGACCCGACTCCTGC
C11 GAAAAATGTACGAGACGGGCATGCACTACATGCCAGGACCTGACTCCTGC
* **.*********** **.***** ** ***** ** ** ***** **
C1 CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCTTGCAAGATGGTGCT
C2 CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCCTGCAAGATGGTGCT
C3 CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCCTGCAAGATGGTGCT
C4 CGCCTGTGCATCTGCGACAGCGGACTGCCCAAGGCGTGCAAGATGGTGCT
C5 CGCCTGTGCATCTGCGACAGCGGACTGCCCAAGGCGTGCAAGATGGTGCT
C6 CGCCTGTGCATCTGCGACAGCGGGCTGCCCAAGGCGTGCAAGATGGTGCT
C7 CGCCTGTGCATCTGCGACAGCGGGCTGCCCAAGGCGTGCAAGATGGTGCT
C8 CGCCTGTGCATCTGCGATAGCGGATTGCCAAAGGCATGCAAGATGGTCCT
C9 CGCCTCTGCATCTGCGACAGCGGGTTGCCCAAGGCCTGCAAGATGGTACT
C10 CGCCTCTGCATCTGCGACAGCGGGCTGCCCAAGGCCTGCAAAATGGTGCT
C11 CGCCTGTGCATCTGCGACAGTGGACTGCCCAAGGCCTGCAAGATGGTGCT
***** *********** ** **. ****.***** *****.***** **
C1 CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
C2 CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
C3 CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
C4 CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
C5 GTGCGAGGCGTTTAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGTGGCA
C6 CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
C7 GTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
C8 CTGTGAGGCGTTTAGCAAGTGCAAGTCCTTCCAGACAGTGGGCAGCGGGA
C9 CTGTGAGGCGTTTAGCAAATGCAAGTCCTTCCAAACCGTTGGTAGTGGCA
C10 CTGCGAGGCTTTCAGCAAGTGCAAGTCCTTTCAGACGGTGGGCAGCGGCA
C11 CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
** ***** ** *****.*********** **.** ** ** ** ** *
C1 ACAACTGCTGCGAGGTGATCTGCCTGGATGACCAGTTCAGCGATGGGAGC
C2 ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC
C3 ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC
C4 ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGAAGC
C5 ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAATTCAGCGATGGGAGC
C6 ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC
C7 ACAACTGCTGCGAGGTCATCTGCCTGGACGACCAGTTCAGCGATGGGAGC
C8 ACAACTGTTGCGAGGTAATCTGCCTGGACGACCAATTCAGCGATGGGAGC
C9 ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC
C10 ACAATTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC
C11 ACAATTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC
**** ** ******** *********** *****.******** **.***
C1 ACCGACTTCGGCATT------
C2 ACCGACTTCGGCATT------
C3 ACCGACTTCGGCATT------
C4 ACCGACTTCGGCATT------
C5 ACCGACTTCGGCATT------
C6 ACCGACTTTGGCATT------
C7 ACCGACTTCGGCATT------
C8 ACTGACTTTGGCATT------
C9 ACTGACTTTGGCATT------
C10 ACCGACTTTGGCATT------
C11 ACCGACTTCGGCATT------
** ***** ******
>C1
ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA
CGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG
GAAAGATGTACGAGACTGGCATGCACTATATGCCGGGACCCGACTCATGC
CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCTTGCAAGATGGTGCT
CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
ACAACTGCTGCGAGGTGATCTGCCTGGATGACCAGTTCAGCGATGGGAGC
ACCGACTTCGGCATT------
>C2
ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG
GCAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCATGC
CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCCTGCAAGATGGTGCT
CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC
ACCGACTTCGGCATT------
>C3
ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG
GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCGTGC
CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCCTGCAAGATGGTGCT
CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC
ACCGACTTCGGCATT------
>C4
ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA
TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGACTACAATG
GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCATGC
CGCCTGTGCATCTGCGACAGCGGACTGCCCAAGGCGTGCAAGATGGTGCT
CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGAAGC
ACCGACTTCGGCATT------
>C5
ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGACTACAATG
GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCGGACTCATGT
CGCCTGTGCATCTGCGACAGCGGACTGCCCAAGGCGTGCAAGATGGTGCT
GTGCGAGGCGTTTAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGTGGCA
ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAATTCAGCGATGGGAGC
ACCGACTTCGGCATT------
>C6
ATGTATCTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
TGCGGTGAGCTCGAGCCTGATCCCCGGCGGGTCCTGCCGCGACTACAATG
GGAAGATGTACGAGACGGGCATGCACTACATGCCCGGTCCCGACTCCTGC
CGCCTGTGCATCTGCGACAGCGGGCTGCCCAAGGCGTGCAAGATGGTGCT
CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC
ACCGACTTTGGCATT------
>C7
ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGGAG
CGCGGTGAGCTCGAGCCTTATCCCCGGCGGCTCCTGCCGCGACTACAATG
GAAAGATGTACGAGACGGGCATGCACTACATGCCGGGGCCCGACTCCTGT
CGCCTGTGCATCTGCGACAGCGGGCTGCCCAAGGCGTGCAAGATGGTGCT
GTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
ACAACTGCTGCGAGGTCATCTGCCTGGACGACCAGTTCAGCGATGGGAGC
ACCGACTTCGGCATT------
>C8
ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
TGCGGTGAGCTCGAGCCTGATCCCTGGCGGCTCCTGCCGGGACTACAATG
GGAAGATGTACGAGACGGGCATGCATTATATGCCAGGACCGGACTCCTGC
CGCCTGTGCATCTGCGATAGCGGATTGCCAAAGGCATGCAAGATGGTCCT
CTGTGAGGCGTTTAGCAAGTGCAAGTCCTTCCAGACAGTGGGCAGCGGGA
ACAACTGTTGCGAGGTAATCTGCCTGGACGACCAATTCAGCGATGGGAGC
ACTGACTTTGGCATT------
>C9
ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
CGCGGTGAGCTCAAGCATGATCCCAGGTGGGTCTTGCCGGGATTACAATG
GGAAAATGTACGAGACGGGAATGCACTATATGCCAGGTCCCGACTCTTGC
CGCCTCTGCATCTGCGACAGCGGGTTGCCCAAGGCCTGCAAGATGGTACT
CTGTGAGGCGTTTAGCAAATGCAAGTCCTTCCAAACCGTTGGTAGTGGCA
ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC
ACTGACTTTGGCATT------
>C10
ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA
CGCGGTGAGCTCGAGCCTC------GGAGGCTCCTGCCGCGACTATAATG
GGAAGATGTACGAGACGGGCATGCACTATATGCCAGGACCCGACTCCTGC
CGCCTCTGCATCTGCGACAGCGGGCTGCCCAAGGCCTGCAAAATGGTGCT
CTGCGAGGCTTTCAGCAAGTGCAAGTCCTTTCAGACGGTGGGCAGCGGCA
ACAATTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC
ACCGACTTTGGCATT------
>C11
ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA
CGCTGTGAGCTCGAGCCTC------GGAGGCTCCTGCCGCGACTATAATG
GAAAAATGTACGAGACGGGCATGCACTACATGCCAGGACCTGACTCCTGC
CGCCTGTGCATCTGCGACAGTGGACTGCCCAAGGCCTGCAAGATGGTGCT
CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA
ACAATTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC
ACCGACTTCGGCATT------
>C1
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C2
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C3
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C4
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C5
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C6
MYLLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C7
MYFLALLAFIGNAKDGSAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C8
MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C9
MYFLALLAFIGNAKDGNAVSSSMIPGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C10
MYFLALLAFIGNAKDGNAVSSSLooGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
>C11
MYFLALLAFIGNAKDGNAVSSSLooGGSCRDYNGKMYETGMHYMPGPDSC
RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
TDFGI
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 321 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478099559
Setting output file names to "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1370579913
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1657674682
Seed = 756897311
Swapseed = 1478099559
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 10 unique site patterns
Division 2 has 8 unique site patterns
Division 3 has 52 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1360.323964 -- -24.640631
Chain 2 -- -1361.696876 -- -24.640631
Chain 3 -- -1366.065331 -- -24.640631
Chain 4 -- -1381.737880 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1392.056711 -- -24.640631
Chain 2 -- -1368.765941 -- -24.640631
Chain 3 -- -1356.052002 -- -24.640631
Chain 4 -- -1375.504462 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1360.324] (-1361.697) (-1366.065) (-1381.738) * [-1392.057] (-1368.766) (-1356.052) (-1375.504)
500 -- (-994.567) (-989.625) [-989.573] (-999.230) * (-983.716) (-994.717) [-985.581] (-989.789) -- 0:33:19
1000 -- (-992.010) (-976.882) [-959.060] (-973.597) * [-973.420] (-976.581) (-973.841) (-976.456) -- 0:16:39
1500 -- (-961.036) (-969.670) [-933.854] (-945.346) * (-959.592) [-946.013] (-963.299) (-965.297) -- 0:11:05
2000 -- (-910.498) (-951.373) [-919.862] (-913.655) * (-956.725) [-921.152] (-940.378) (-945.592) -- 0:08:19
2500 -- (-910.505) (-941.199) [-911.076] (-917.635) * (-955.035) [-919.720] (-923.379) (-932.258) -- 0:06:39
3000 -- (-904.878) (-930.046) [-906.739] (-916.626) * (-932.372) (-915.756) (-927.671) [-913.502] -- 0:05:32
3500 -- [-910.421] (-914.083) (-918.160) (-916.069) * (-913.075) (-911.038) (-919.238) [-907.813] -- 0:04:44
4000 -- (-903.191) (-907.152) (-902.370) [-909.427] * (-915.956) (-921.251) (-924.770) [-912.259] -- 0:08:18
4500 -- (-908.251) (-917.486) [-901.909] (-909.179) * (-908.632) (-929.122) [-914.094] (-908.632) -- 0:07:22
5000 -- [-911.421] (-927.464) (-904.654) (-913.870) * [-907.708] (-918.209) (-908.685) (-911.334) -- 0:06:38
Average standard deviation of split frequencies: 0.075858
5500 -- [-909.658] (-924.957) (-905.326) (-903.874) * (-908.886) (-915.230) (-913.592) [-903.239] -- 0:06:01
6000 -- (-910.123) (-911.431) [-909.013] (-907.436) * (-913.126) (-915.554) (-907.199) [-918.086] -- 0:05:31
6500 -- (-902.432) [-912.490] (-911.647) (-919.099) * [-907.811] (-917.251) (-913.964) (-911.572) -- 0:05:05
7000 -- (-916.650) [-914.674] (-907.712) (-906.919) * [-913.072] (-921.092) (-913.113) (-907.280) -- 0:04:43
7500 -- (-915.496) (-910.264) [-906.464] (-913.629) * (-913.909) (-913.052) (-915.864) [-908.335] -- 0:06:37
8000 -- [-907.858] (-907.965) (-908.331) (-909.509) * (-910.074) (-919.523) [-913.088] (-912.410) -- 0:06:12
8500 -- [-907.509] (-911.648) (-917.012) (-911.205) * [-914.579] (-911.574) (-908.320) (-915.096) -- 0:05:49
9000 -- (-910.740) (-922.915) [-917.434] (-913.623) * [-909.210] (-907.566) (-911.778) (-914.489) -- 0:05:30
9500 -- [-904.356] (-912.559) (-923.031) (-918.954) * (-916.833) [-908.042] (-912.054) (-905.186) -- 0:05:12
10000 -- (-908.372) [-907.684] (-912.451) (-904.816) * (-915.200) (-914.339) [-910.841] (-913.760) -- 0:04:57
Average standard deviation of split frequencies: 0.075761
10500 -- (-915.395) (-910.557) (-911.566) [-910.368] * [-910.377] (-907.899) (-923.198) (-911.204) -- 0:06:16
11000 -- (-907.993) [-907.808] (-909.538) (-909.641) * (-912.915) (-908.904) (-921.305) [-900.074] -- 0:05:59
11500 -- (-912.569) (-918.137) [-903.793] (-907.885) * [-911.964] (-906.098) (-915.632) (-910.191) -- 0:05:43
12000 -- (-919.696) [-908.327] (-898.857) (-911.425) * (-914.152) [-906.360] (-920.903) (-915.088) -- 0:05:29
12500 -- (-918.520) (-911.682) [-908.290] (-915.177) * [-907.731] (-901.981) (-919.982) (-914.443) -- 0:05:16
13000 -- (-912.855) (-914.322) [-911.575] (-908.670) * (-914.050) [-910.344] (-905.278) (-915.990) -- 0:05:03
13500 -- (-915.024) (-911.943) [-903.464] (-918.833) * (-905.853) [-905.304] (-907.887) (-907.253) -- 0:04:52
14000 -- (-915.038) [-912.944] (-907.079) (-917.926) * (-915.103) (-904.852) [-904.917] (-910.328) -- 0:05:52
14500 -- (-918.277) (-919.806) [-910.973] (-919.762) * [-908.809] (-904.229) (-913.383) (-905.557) -- 0:05:39
15000 -- (-910.397) (-910.796) [-907.412] (-910.363) * (-917.579) (-909.872) [-911.275] (-910.328) -- 0:05:28
Average standard deviation of split frequencies: 0.060207
15500 -- (-916.173) (-911.210) [-902.291] (-909.701) * (-908.192) [-917.576] (-907.761) (-912.955) -- 0:05:17
16000 -- [-903.367] (-919.562) (-913.423) (-915.623) * (-910.445) (-914.466) (-912.902) [-922.756] -- 0:05:07
16500 -- [-911.940] (-902.232) (-915.392) (-909.874) * (-907.182) (-909.746) [-907.454] (-912.186) -- 0:04:58
17000 -- (-907.777) (-906.058) (-910.104) [-899.750] * [-903.993] (-905.055) (-908.862) (-914.399) -- 0:04:49
17500 -- (-907.308) (-915.494) [-908.843] (-903.113) * (-923.561) [-912.148] (-906.412) (-917.516) -- 0:05:36
18000 -- (-905.945) [-911.128] (-909.658) (-913.235) * [-906.564] (-910.144) (-911.137) (-929.459) -- 0:05:27
18500 -- [-913.681] (-911.784) (-909.028) (-910.779) * (-912.807) (-905.854) [-910.528] (-916.680) -- 0:05:18
19000 -- (-912.233) (-902.483) [-904.516] (-927.383) * (-910.756) (-912.232) (-910.745) [-912.808] -- 0:05:09
19500 -- (-907.174) (-907.614) [-904.850] (-914.114) * (-908.680) (-911.993) [-908.174] (-912.674) -- 0:05:01
20000 -- (-905.266) [-910.368] (-907.553) (-917.091) * [-916.078] (-914.173) (-914.347) (-912.810) -- 0:04:54
Average standard deviation of split frequencies: 0.067344
20500 -- (-910.348) (-904.187) [-904.464] (-916.690) * (-914.357) [-917.443] (-914.539) (-913.379) -- 0:05:34
21000 -- (-912.671) (-910.306) (-904.933) [-907.970] * (-909.960) (-912.760) [-906.042] (-903.568) -- 0:05:26
21500 -- (-922.317) (-916.052) (-907.852) [-907.216] * [-908.796] (-920.274) (-913.843) (-915.985) -- 0:05:18
22000 -- [-915.177] (-912.517) (-913.782) (-910.736) * (-912.558) (-914.044) [-902.152] (-918.386) -- 0:05:11
22500 -- (-917.441) (-914.658) (-911.506) [-907.387] * [-901.578] (-915.591) (-908.003) (-909.637) -- 0:05:04
23000 -- (-909.858) (-910.231) (-906.176) [-920.281] * (-913.165) (-907.493) [-902.976] (-907.588) -- 0:04:57
23500 -- (-908.920) (-912.776) (-920.197) [-908.050] * [-904.280] (-929.034) (-904.032) (-913.690) -- 0:04:50
24000 -- (-917.453) (-913.254) [-907.476] (-909.165) * (-922.679) (-909.671) [-904.114] (-907.533) -- 0:05:25
24500 -- [-904.364] (-912.185) (-911.528) (-913.190) * (-921.320) [-899.899] (-913.345) (-915.796) -- 0:05:18
25000 -- (-910.502) [-907.991] (-907.139) (-915.675) * (-906.143) (-910.121) [-907.885] (-926.565) -- 0:05:12
Average standard deviation of split frequencies: 0.052816
25500 -- [-904.753] (-904.227) (-914.280) (-918.118) * (-918.133) (-914.142) [-922.059] (-913.223) -- 0:05:05
26000 -- (-905.818) (-908.759) (-905.264) [-914.029] * [-904.889] (-914.818) (-910.237) (-912.595) -- 0:04:59
26500 -- (-912.734) [-907.074] (-917.989) (-912.792) * (-910.589) (-908.121) (-913.885) [-904.343] -- 0:04:53
27000 -- (-906.349) (-907.752) (-915.904) [-900.098] * [-908.466] (-920.447) (-917.531) (-904.853) -- 0:04:48
27500 -- [-907.157] (-910.586) (-918.164) (-908.099) * (-901.312) (-912.232) (-915.358) [-905.431] -- 0:05:18
28000 -- (-912.638) [-912.016] (-927.633) (-924.377) * (-910.194) (-908.394) (-927.996) [-905.678] -- 0:05:12
28500 -- (-913.334) [-910.157] (-910.089) (-907.082) * (-911.763) (-904.780) (-909.493) [-905.069] -- 0:05:06
29000 -- (-916.503) (-925.350) (-909.947) [-907.564] * (-912.472) (-905.905) [-907.870] (-910.821) -- 0:05:01
29500 -- [-904.128] (-920.963) (-910.461) (-900.283) * (-917.551) (-914.926) [-909.824] (-908.587) -- 0:04:56
30000 -- (-916.790) [-906.958] (-909.727) (-904.245) * [-908.741] (-907.055) (-910.779) (-906.270) -- 0:04:51
Average standard deviation of split frequencies: 0.064829
30500 -- (-905.966) (-910.710) [-901.539] (-909.427) * (-907.463) (-915.603) (-915.936) [-910.382] -- 0:04:46
31000 -- [-907.762] (-908.866) (-907.415) (-910.885) * (-903.775) (-917.392) [-915.486] (-917.676) -- 0:05:12
31500 -- (-921.218) (-922.747) [-911.567] (-913.012) * [-916.348] (-906.914) (-908.163) (-915.651) -- 0:05:07
32000 -- [-910.780] (-908.789) (-910.129) (-908.378) * (-918.336) [-917.024] (-908.836) (-923.057) -- 0:05:02
32500 -- (-908.704) (-910.594) (-909.058) [-908.541] * (-914.445) (-918.395) (-904.379) [-904.805] -- 0:04:57
33000 -- (-914.656) (-908.350) [-906.399] (-919.449) * [-912.889] (-922.690) (-909.711) (-903.858) -- 0:04:53
33500 -- (-911.216) (-916.348) (-916.195) [-906.509] * (-917.585) (-911.935) [-908.721] (-906.466) -- 0:04:48
34000 -- (-918.822) (-908.110) (-907.764) [-901.629] * [-906.281] (-921.942) (-908.124) (-905.434) -- 0:04:44
34500 -- (-903.457) [-908.295] (-906.786) (-917.682) * (-909.574) (-929.087) [-903.308] (-915.921) -- 0:05:07
35000 -- (-904.692) (-923.107) (-909.449) [-905.091] * (-908.667) (-921.553) [-906.800] (-914.374) -- 0:05:03
Average standard deviation of split frequencies: 0.064818
35500 -- (-907.944) (-907.512) (-916.651) [-902.419] * [-905.352] (-911.881) (-910.305) (-915.994) -- 0:04:58
36000 -- (-906.494) [-909.170] (-913.679) (-907.456) * (-921.964) (-911.150) [-907.956] (-918.953) -- 0:04:54
36500 -- (-918.463) (-918.378) (-917.923) [-911.632] * (-909.048) (-906.556) [-915.786] (-910.289) -- 0:04:50
37000 -- (-916.418) (-906.947) [-916.580] (-908.972) * (-905.219) [-907.621] (-915.004) (-907.440) -- 0:04:46
37500 -- (-929.079) (-912.767) (-921.422) [-903.265] * (-905.706) (-908.752) [-914.712] (-907.512) -- 0:05:08
38000 -- (-911.824) (-906.444) (-911.680) [-907.042] * (-912.789) [-904.223] (-924.765) (-905.383) -- 0:05:03
38500 -- (-903.980) (-914.504) (-911.616) [-908.086] * (-921.105) (-910.907) [-914.692] (-903.576) -- 0:04:59
39000 -- (-904.673) (-908.601) (-913.703) [-904.365] * (-917.951) (-913.013) (-907.733) [-904.200] -- 0:04:55
39500 -- [-905.696] (-908.529) (-912.506) (-907.964) * [-903.866] (-916.270) (-913.149) (-908.555) -- 0:04:51
40000 -- (-910.677) [-910.164] (-912.659) (-915.838) * (-909.291) (-913.737) [-894.949] (-910.633) -- 0:04:48
Average standard deviation of split frequencies: 0.060067
40500 -- (-920.487) (-907.377) [-915.479] (-917.594) * (-911.048) (-912.144) (-905.680) [-903.132] -- 0:04:44
41000 -- (-913.247) (-911.207) [-908.883] (-910.608) * (-905.041) (-919.603) (-912.172) [-907.377] -- 0:05:04
41500 -- (-914.641) (-910.788) [-908.539] (-908.809) * (-909.584) [-907.963] (-907.526) (-926.639) -- 0:05:00
42000 -- (-918.930) (-903.567) (-912.711) [-902.769] * (-907.321) (-912.354) (-911.574) [-916.636] -- 0:04:56
42500 -- [-903.123] (-909.156) (-909.728) (-922.329) * (-913.652) (-910.097) [-906.546] (-910.437) -- 0:04:52
43000 -- (-911.978) [-909.978] (-912.006) (-922.482) * (-903.435) [-905.345] (-912.309) (-918.057) -- 0:04:49
43500 -- (-924.075) (-917.366) (-917.084) [-912.100] * (-903.788) (-913.910) [-906.953] (-903.177) -- 0:04:45
44000 -- [-911.631] (-907.026) (-912.359) (-906.997) * (-926.174) (-914.535) [-903.269] (-908.318) -- 0:04:42
44500 -- (-908.454) (-905.729) (-915.225) [-917.861] * (-920.493) (-907.673) (-907.326) [-905.953] -- 0:05:00
45000 -- (-910.711) [-903.650] (-915.833) (-914.030) * (-905.187) (-909.134) (-908.795) [-904.521] -- 0:04:57
Average standard deviation of split frequencies: 0.046543
45500 -- (-906.434) (-908.492) (-919.648) [-905.053] * (-920.381) (-909.931) (-910.274) [-907.146] -- 0:04:53
46000 -- [-908.872] (-905.513) (-909.151) (-922.040) * [-904.873] (-917.438) (-905.114) (-913.535) -- 0:04:50
46500 -- [-907.788] (-911.473) (-915.339) (-907.768) * (-903.938) [-904.472] (-916.484) (-915.441) -- 0:04:47
47000 -- [-915.220] (-914.544) (-907.349) (-906.550) * (-904.103) [-906.122] (-907.549) (-905.975) -- 0:04:43
47500 -- (-910.460) [-910.982] (-908.630) (-916.352) * [-905.344] (-904.426) (-912.791) (-910.636) -- 0:05:00
48000 -- [-902.307] (-910.589) (-903.745) (-911.155) * (-916.023) (-901.742) [-907.565] (-910.319) -- 0:04:57
48500 -- [-905.376] (-920.256) (-907.894) (-911.497) * [-911.987] (-913.944) (-917.541) (-914.113) -- 0:04:54
49000 -- [-902.358] (-920.002) (-916.250) (-908.030) * (-915.872) [-903.532] (-904.559) (-910.935) -- 0:04:51
49500 -- (-905.351) (-923.092) [-914.594] (-909.652) * [-912.344] (-905.781) (-913.793) (-910.006) -- 0:04:48
50000 -- (-910.248) [-915.945] (-922.753) (-905.698) * (-910.472) [-899.402] (-904.763) (-904.717) -- 0:04:45
Average standard deviation of split frequencies: 0.045711
50500 -- (-910.142) (-915.051) (-907.808) [-907.761] * [-906.084] (-914.052) (-916.388) (-904.477) -- 0:04:42
51000 -- (-916.367) [-905.810] (-904.696) (-920.632) * (-907.228) (-904.394) [-908.715] (-918.088) -- 0:04:57
51500 -- (-922.929) (-911.883) (-910.438) [-907.153] * (-918.651) (-904.900) (-917.186) [-907.349] -- 0:04:54
52000 -- (-903.016) (-904.217) [-900.679] (-916.677) * (-935.782) (-920.754) (-913.117) [-902.134] -- 0:04:51
52500 -- (-909.290) (-914.137) [-907.510] (-907.080) * (-918.700) [-913.900] (-912.900) (-902.518) -- 0:04:48
53000 -- (-917.853) [-906.467] (-910.027) (-911.200) * (-914.213) (-922.046) [-912.163] (-908.370) -- 0:04:45
53500 -- [-910.125] (-911.843) (-912.407) (-909.647) * [-908.258] (-917.078) (-909.248) (-910.938) -- 0:04:43
54000 -- (-917.883) [-907.074] (-913.090) (-917.228) * [-904.006] (-913.107) (-910.280) (-908.461) -- 0:04:57
54500 -- (-914.553) [-906.481] (-910.768) (-907.732) * [-915.398] (-914.767) (-913.860) (-912.367) -- 0:04:54
55000 -- [-906.565] (-898.690) (-911.031) (-911.828) * [-910.736] (-913.571) (-914.052) (-917.534) -- 0:04:52
Average standard deviation of split frequencies: 0.043493
55500 -- (-921.660) [-904.459] (-914.358) (-911.936) * [-909.614] (-909.501) (-910.329) (-920.226) -- 0:04:49
56000 -- (-911.157) [-907.513] (-920.140) (-913.821) * (-909.727) [-903.888] (-903.448) (-922.337) -- 0:04:46
56500 -- (-922.188) [-902.682] (-912.058) (-922.008) * (-912.227) [-905.889] (-912.049) (-919.484) -- 0:04:43
57000 -- (-911.133) (-908.108) [-907.347] (-919.335) * (-912.046) [-907.966] (-915.165) (-917.118) -- 0:04:57
57500 -- (-916.474) (-906.467) (-906.066) [-910.023] * (-903.338) [-904.153] (-918.879) (-911.912) -- 0:04:55
58000 -- (-913.221) [-906.303] (-911.099) (-912.677) * (-916.603) [-905.063] (-913.639) (-932.072) -- 0:04:52
58500 -- (-912.195) (-904.200) [-912.585] (-909.954) * (-914.530) [-908.944] (-919.887) (-909.315) -- 0:04:49
59000 -- (-910.317) (-906.961) (-926.420) [-906.937] * (-911.765) (-912.148) (-914.608) [-911.665] -- 0:04:47
59500 -- (-926.245) [-903.065] (-924.450) (-898.175) * (-913.736) (-909.147) (-917.036) [-913.863] -- 0:04:44
60000 -- (-914.787) (-909.007) (-927.490) [-907.006] * [-911.424] (-916.012) (-913.010) (-929.068) -- 0:04:42
Average standard deviation of split frequencies: 0.044856
60500 -- [-912.150] (-909.212) (-913.610) (-909.271) * [-906.364] (-904.235) (-913.876) (-917.181) -- 0:04:55
61000 -- (-915.138) [-910.333] (-911.789) (-908.522) * [-902.167] (-911.822) (-916.773) (-913.519) -- 0:04:52
61500 -- (-918.449) [-910.900] (-907.323) (-900.888) * (-913.451) [-906.923] (-914.144) (-915.337) -- 0:04:49
62000 -- [-909.514] (-908.454) (-921.678) (-903.962) * (-908.092) (-912.885) [-907.110] (-916.675) -- 0:04:47
62500 -- (-909.579) [-903.190] (-911.060) (-906.458) * (-912.743) [-905.472] (-908.040) (-917.096) -- 0:04:45
63000 -- (-913.376) (-909.835) [-906.793] (-908.774) * (-915.666) (-910.120) [-908.233] (-912.891) -- 0:04:42
63500 -- (-909.200) [-902.346] (-907.674) (-907.887) * (-916.225) [-904.915] (-908.963) (-921.814) -- 0:04:54
64000 -- [-906.757] (-913.388) (-920.821) (-906.370) * [-908.142] (-905.894) (-904.956) (-916.907) -- 0:04:52
64500 -- [-906.452] (-906.740) (-909.169) (-911.268) * (-912.920) (-904.279) [-909.855] (-911.803) -- 0:04:50
65000 -- (-910.562) [-909.035] (-917.707) (-913.019) * [-911.756] (-919.397) (-909.582) (-908.670) -- 0:04:47
Average standard deviation of split frequencies: 0.039608
65500 -- (-917.762) (-911.081) [-918.040] (-907.460) * (-904.163) (-908.218) [-903.976] (-906.506) -- 0:04:45
66000 -- (-918.447) (-912.266) [-904.856] (-913.286) * [-906.378] (-919.556) (-912.505) (-918.349) -- 0:04:43
66500 -- (-908.075) (-905.731) (-912.105) [-910.827] * (-907.523) [-909.699] (-924.491) (-917.337) -- 0:04:54
67000 -- (-910.808) (-918.643) (-925.409) [-912.129] * (-906.049) [-909.505] (-915.900) (-916.596) -- 0:04:52
67500 -- [-907.523] (-911.283) (-911.408) (-911.782) * (-902.071) (-915.728) [-906.839] (-911.299) -- 0:04:50
68000 -- (-922.728) (-916.008) [-905.666] (-908.883) * (-910.049) (-905.554) [-908.314] (-918.443) -- 0:04:47
68500 -- (-914.954) (-915.314) [-903.904] (-910.067) * (-908.639) (-911.944) [-908.230] (-913.974) -- 0:04:45
69000 -- (-911.635) [-912.889] (-908.702) (-911.805) * [-906.226] (-913.316) (-908.846) (-914.144) -- 0:04:43
69500 -- [-908.175] (-918.582) (-905.713) (-908.171) * (-907.849) (-914.973) (-915.665) [-906.817] -- 0:04:41
70000 -- (-917.521) (-910.116) [-903.492] (-914.246) * (-912.948) [-908.868] (-906.528) (-904.872) -- 0:04:52
Average standard deviation of split frequencies: 0.042026
70500 -- (-932.544) (-914.104) [-910.679] (-911.790) * [-906.400] (-907.929) (-906.663) (-918.808) -- 0:04:50
71000 -- (-926.295) [-912.806] (-908.651) (-909.793) * (-913.037) [-910.793] (-912.785) (-908.369) -- 0:04:47
71500 -- (-918.172) (-923.668) [-906.628] (-910.825) * (-907.830) [-910.832] (-907.815) (-912.227) -- 0:04:45
72000 -- [-909.341] (-915.855) (-915.408) (-906.523) * [-902.073] (-913.562) (-907.152) (-902.620) -- 0:04:43
72500 -- [-905.174] (-910.070) (-910.168) (-907.307) * (-914.652) (-912.282) (-916.173) [-906.527] -- 0:04:41
73000 -- [-906.183] (-910.740) (-904.443) (-908.395) * (-918.841) (-907.260) [-909.018] (-908.170) -- 0:04:39
73500 -- (-909.116) (-910.644) (-904.856) [-911.443] * (-917.056) [-911.010] (-905.471) (-919.394) -- 0:04:49
74000 -- (-911.979) [-908.231] (-909.188) (-912.372) * (-912.566) (-907.927) (-905.692) [-914.391] -- 0:04:47
74500 -- (-913.899) (-912.441) (-920.674) [-905.726] * [-911.603] (-905.905) (-915.293) (-907.547) -- 0:04:45
75000 -- (-907.913) (-914.606) [-904.327] (-921.554) * [-908.877] (-914.990) (-910.685) (-907.270) -- 0:04:43
Average standard deviation of split frequencies: 0.037807
75500 -- (-910.031) (-914.988) (-912.781) [-903.331] * (-914.750) (-912.254) (-910.442) [-903.873] -- 0:04:41
76000 -- (-915.602) (-905.519) (-914.791) [-912.139] * (-919.073) (-917.409) (-904.382) [-908.410] -- 0:04:39
76500 -- [-903.753] (-913.159) (-915.796) (-909.602) * (-912.150) (-912.909) (-920.835) [-905.506] -- 0:04:37
77000 -- [-906.131] (-906.129) (-919.283) (-912.666) * (-909.841) [-912.686] (-906.177) (-904.423) -- 0:04:47
77500 -- (-906.485) [-900.235] (-913.855) (-912.715) * (-907.500) [-906.950] (-906.655) (-919.947) -- 0:04:45
78000 -- (-915.438) (-908.704) (-916.372) [-907.611] * (-919.951) [-902.084] (-910.350) (-911.926) -- 0:04:43
78500 -- (-912.136) (-906.638) [-915.025] (-914.317) * (-910.216) (-906.485) (-909.479) [-909.502] -- 0:04:41
79000 -- [-907.556] (-912.881) (-923.303) (-916.275) * (-919.734) (-906.156) (-910.987) [-909.751] -- 0:04:39
79500 -- (-917.729) (-909.790) (-913.100) [-909.538] * (-911.871) (-908.015) (-917.096) [-915.456] -- 0:04:37
80000 -- (-906.564) (-911.192) (-915.365) [-916.788] * (-905.341) (-905.951) [-902.847] (-912.203) -- 0:04:47
Average standard deviation of split frequencies: 0.039984
80500 -- (-917.232) [-904.903] (-914.164) (-913.215) * [-906.825] (-910.596) (-912.255) (-910.597) -- 0:04:45
81000 -- (-924.554) (-911.562) (-913.660) [-907.433] * (-921.277) (-915.560) [-911.787] (-914.238) -- 0:04:43
81500 -- (-914.491) (-914.411) [-913.552] (-904.056) * (-904.080) [-902.040] (-917.401) (-914.867) -- 0:04:41
82000 -- (-907.002) [-911.979] (-916.551) (-910.414) * (-910.267) [-903.954] (-918.681) (-910.201) -- 0:04:39
82500 -- (-904.737) (-907.271) [-900.932] (-907.382) * (-913.598) (-907.710) (-919.128) [-907.401] -- 0:04:38
83000 -- [-908.306] (-908.603) (-906.114) (-928.058) * (-909.376) (-909.588) [-910.985] (-917.698) -- 0:04:36
83500 -- (-903.531) [-910.813] (-910.801) (-916.690) * (-904.666) [-901.953] (-906.971) (-920.648) -- 0:04:45
84000 -- (-908.323) [-907.424] (-915.545) (-918.514) * [-911.506] (-900.582) (-911.058) (-913.245) -- 0:04:43
84500 -- [-905.904] (-909.789) (-906.841) (-907.738) * [-916.475] (-911.406) (-912.053) (-916.795) -- 0:04:41
85000 -- (-911.675) (-908.206) (-909.537) [-914.703] * (-912.814) (-909.472) (-912.457) [-904.488] -- 0:04:39
Average standard deviation of split frequencies: 0.028561
85500 -- (-905.635) (-907.751) [-908.876] (-909.706) * [-908.182] (-911.515) (-909.198) (-916.473) -- 0:04:38
86000 -- [-903.340] (-905.831) (-905.480) (-907.728) * [-911.696] (-906.503) (-909.598) (-905.766) -- 0:04:36
86500 -- (-914.116) (-908.592) [-909.414] (-910.089) * [-900.512] (-915.193) (-914.570) (-902.704) -- 0:04:45
87000 -- (-911.565) (-919.123) (-915.297) [-903.882] * (-911.937) (-912.356) (-920.273) [-918.552] -- 0:04:43
87500 -- (-924.492) (-914.845) (-916.621) [-909.477] * [-904.266] (-911.934) (-919.278) (-903.074) -- 0:04:41
88000 -- [-909.243] (-915.357) (-908.173) (-907.385) * [-902.873] (-917.758) (-907.275) (-909.067) -- 0:04:39
88500 -- [-908.211] (-914.054) (-910.700) (-917.346) * (-906.066) [-916.407] (-923.831) (-911.232) -- 0:04:38
89000 -- (-916.356) (-909.414) (-912.997) [-902.184] * (-905.870) [-915.757] (-917.941) (-913.106) -- 0:04:36
89500 -- (-912.105) (-921.827) (-913.730) [-910.058] * [-901.740] (-908.540) (-907.152) (-921.774) -- 0:04:34
90000 -- [-903.510] (-908.926) (-915.355) (-923.273) * (-909.272) (-919.528) [-911.299] (-915.089) -- 0:04:43
Average standard deviation of split frequencies: 0.024579
90500 -- [-907.272] (-910.664) (-912.551) (-905.811) * (-907.539) (-919.800) [-908.261] (-915.915) -- 0:04:41
91000 -- (-902.170) (-922.987) (-917.042) [-900.513] * (-912.858) (-915.242) [-904.291] (-918.921) -- 0:04:39
91500 -- (-907.151) (-914.165) [-920.936] (-907.872) * (-913.282) (-930.395) [-905.292] (-913.867) -- 0:04:38
92000 -- (-908.749) (-923.266) (-929.881) [-903.835] * [-908.827] (-920.800) (-911.294) (-922.635) -- 0:04:36
92500 -- (-916.377) (-916.528) [-912.807] (-920.273) * (-917.263) (-917.667) (-901.092) [-912.628] -- 0:04:34
93000 -- [-918.441] (-921.947) (-909.186) (-908.175) * (-911.217) (-914.426) [-909.808] (-913.093) -- 0:04:42
93500 -- (-916.572) (-913.519) (-912.548) [-901.762] * [-904.634] (-923.545) (-909.504) (-919.747) -- 0:04:41
94000 -- (-912.851) (-909.813) (-907.089) [-907.346] * [-906.462] (-911.891) (-906.352) (-921.759) -- 0:04:39
94500 -- (-919.001) [-916.983] (-909.800) (-910.656) * (-912.403) (-919.120) [-909.093] (-909.871) -- 0:04:37
95000 -- [-915.859] (-907.466) (-906.654) (-909.729) * [-908.448] (-909.823) (-916.436) (-924.905) -- 0:04:36
Average standard deviation of split frequencies: 0.021980
95500 -- (-909.914) (-917.959) [-909.164] (-912.716) * (-902.013) (-903.506) [-913.376] (-919.483) -- 0:04:34
96000 -- (-908.927) (-918.721) [-917.664] (-912.211) * [-911.823] (-911.334) (-914.188) (-918.132) -- 0:04:33
96500 -- (-911.191) (-914.289) (-911.844) [-909.293] * (-906.179) (-913.489) [-914.228] (-916.940) -- 0:04:40
97000 -- (-919.402) (-911.727) (-909.154) [-906.704] * [-905.767] (-903.552) (-913.719) (-913.352) -- 0:04:39
97500 -- (-914.397) [-912.542] (-907.607) (-903.687) * (-915.560) (-913.407) [-898.357] (-916.368) -- 0:04:37
98000 -- (-915.062) (-906.367) [-908.238] (-908.105) * (-913.935) (-916.258) [-906.117] (-919.452) -- 0:04:36
98500 -- [-904.756] (-919.178) (-909.309) (-907.145) * (-913.466) (-907.100) (-908.642) [-907.808] -- 0:04:34
99000 -- (-920.535) (-916.490) (-910.524) [-920.128] * [-908.064] (-905.181) (-908.905) (-909.930) -- 0:04:33
99500 -- [-906.951] (-923.086) (-919.322) (-911.449) * [-908.507] (-905.750) (-912.325) (-909.994) -- 0:04:40
100000 -- [-902.825] (-918.105) (-909.532) (-908.411) * (-918.011) (-912.578) [-908.443] (-911.635) -- 0:04:39
Average standard deviation of split frequencies: 0.023180
100500 -- (-912.752) (-927.486) (-905.666) [-912.369] * (-909.631) [-906.928] (-911.960) (-925.169) -- 0:04:37
101000 -- (-915.887) (-934.828) [-902.342] (-910.727) * (-914.209) (-904.497) [-903.788] (-913.047) -- 0:04:35
101500 -- [-912.968] (-914.159) (-903.575) (-909.000) * [-911.932] (-914.932) (-900.381) (-913.925) -- 0:04:34
102000 -- (-923.105) (-922.433) [-908.246] (-912.404) * (-913.516) (-914.533) [-907.755] (-917.277) -- 0:04:32
102500 -- (-909.531) (-918.320) (-911.223) [-915.153] * (-919.581) [-906.853] (-905.204) (-917.966) -- 0:04:31
103000 -- (-918.572) (-908.166) [-904.898] (-911.903) * (-910.558) (-912.266) [-905.009] (-913.969) -- 0:04:38
103500 -- (-908.947) [-907.390] (-914.016) (-908.808) * (-910.931) [-910.978] (-914.609) (-912.800) -- 0:04:37
104000 -- (-909.836) [-910.897] (-906.506) (-928.930) * (-906.493) [-904.538] (-913.794) (-913.767) -- 0:04:35
104500 -- (-906.951) (-917.098) [-907.189] (-916.523) * (-900.891) (-916.438) [-906.401] (-905.867) -- 0:04:34
105000 -- [-912.366] (-912.769) (-903.712) (-905.355) * (-909.007) [-907.047] (-903.456) (-917.450) -- 0:04:32
Average standard deviation of split frequencies: 0.018234
105500 -- (-916.199) (-914.357) (-906.661) [-912.470] * (-912.960) (-913.127) (-906.331) [-909.892] -- 0:04:31
106000 -- (-907.159) [-905.660] (-903.717) (-911.242) * (-920.130) [-912.112] (-919.494) (-914.233) -- 0:04:29
106500 -- [-911.663] (-912.251) (-905.615) (-914.217) * [-913.889] (-906.595) (-913.464) (-921.001) -- 0:04:36
107000 -- (-906.044) [-912.816] (-909.272) (-914.343) * [-906.840] (-914.016) (-905.424) (-906.539) -- 0:04:35
107500 -- [-898.727] (-905.742) (-906.392) (-919.964) * (-907.094) [-904.559] (-909.346) (-914.273) -- 0:04:33
108000 -- (-903.997) [-912.599] (-911.323) (-920.795) * (-909.097) (-908.529) (-910.765) [-911.688] -- 0:04:32
108500 -- (-913.093) [-900.680] (-904.330) (-910.681) * (-907.773) [-907.311] (-911.981) (-910.278) -- 0:04:31
109000 -- (-913.659) (-906.001) (-907.840) [-909.887] * (-914.189) (-915.271) (-919.443) [-925.980] -- 0:04:29
109500 -- (-903.542) (-906.974) (-909.939) [-907.805] * (-907.758) [-905.818] (-915.480) (-919.346) -- 0:04:36
110000 -- [-903.459] (-905.403) (-907.923) (-903.759) * [-903.500] (-911.101) (-910.602) (-919.654) -- 0:04:35
Average standard deviation of split frequencies: 0.017252
110500 -- [-907.197] (-907.148) (-907.661) (-911.217) * [-902.894] (-912.292) (-908.088) (-903.430) -- 0:04:33
111000 -- [-899.039] (-913.532) (-917.910) (-908.837) * (-902.746) (-908.109) (-906.750) [-910.664] -- 0:04:32
111500 -- (-911.770) [-905.476] (-905.530) (-915.399) * (-908.493) (-904.097) [-906.151] (-913.771) -- 0:04:30
112000 -- (-909.012) (-911.827) [-907.697] (-908.558) * (-917.749) [-900.333] (-916.031) (-916.479) -- 0:04:29
112500 -- (-912.845) (-918.682) [-904.263] (-907.306) * [-910.053] (-907.782) (-919.648) (-909.350) -- 0:04:28
113000 -- (-910.014) (-913.803) [-899.454] (-903.388) * [-913.402] (-906.931) (-911.049) (-915.112) -- 0:04:34
113500 -- (-909.807) (-908.657) [-906.396] (-907.787) * (-923.914) (-915.662) [-913.487] (-918.745) -- 0:04:33
114000 -- [-905.352] (-910.857) (-909.266) (-914.798) * (-921.081) (-902.938) [-904.059] (-918.581) -- 0:04:32
114500 -- (-916.893) (-914.041) (-922.725) [-899.246] * [-919.580] (-924.801) (-906.732) (-913.983) -- 0:04:30
115000 -- (-913.730) (-928.017) [-909.781] (-901.836) * (-905.859) (-919.327) [-906.604] (-911.433) -- 0:04:29
Average standard deviation of split frequencies: 0.016052
115500 -- (-911.614) (-912.618) (-911.135) [-901.401] * [-903.481] (-911.028) (-905.174) (-906.766) -- 0:04:28
116000 -- (-910.705) (-918.662) (-915.658) [-911.372] * (-911.281) [-907.451] (-913.082) (-910.850) -- 0:04:26
116500 -- (-915.772) (-917.172) [-912.247] (-902.935) * (-908.884) [-906.109] (-908.012) (-910.554) -- 0:04:33
117000 -- [-903.685] (-925.011) (-910.600) (-906.272) * (-921.786) (-907.090) [-908.025] (-919.809) -- 0:04:31
117500 -- [-913.336] (-925.139) (-904.144) (-909.146) * (-916.354) [-911.778] (-920.271) (-907.216) -- 0:04:30
118000 -- (-919.720) (-910.157) [-908.481] (-917.368) * (-924.734) [-909.208] (-909.026) (-915.155) -- 0:04:29
118500 -- (-934.237) (-910.830) (-911.138) [-911.708] * (-905.474) (-906.475) (-910.953) [-902.140] -- 0:04:27
119000 -- (-920.118) (-910.641) (-907.776) [-907.967] * (-921.461) (-904.315) [-906.196] (-911.097) -- 0:04:26
119500 -- (-912.862) (-906.223) [-909.410] (-915.638) * (-914.852) (-915.074) [-921.186] (-906.991) -- 0:04:25
120000 -- (-922.611) [-904.409] (-916.906) (-912.716) * [-912.107] (-910.442) (-908.174) (-909.350) -- 0:04:31
Average standard deviation of split frequencies: 0.016017
120500 -- (-920.193) [-908.136] (-911.655) (-914.532) * (-910.482) (-914.784) [-909.918] (-913.059) -- 0:04:30
121000 -- (-911.123) [-905.918] (-913.475) (-915.956) * (-919.682) [-907.305] (-903.410) (-920.984) -- 0:04:28
121500 -- (-903.544) (-917.402) [-906.486] (-915.696) * (-909.001) (-914.538) [-901.429] (-918.236) -- 0:04:27
122000 -- (-903.286) (-911.392) (-916.289) [-904.665] * (-910.241) (-912.142) (-914.698) [-902.265] -- 0:04:26
122500 -- (-914.584) (-911.010) (-917.221) [-907.699] * (-900.316) (-917.929) (-917.130) [-906.992] -- 0:04:25
123000 -- (-914.572) (-915.230) (-904.100) [-902.163] * [-906.617] (-912.776) (-918.090) (-910.170) -- 0:04:23
123500 -- (-906.462) (-911.265) [-905.134] (-913.087) * [-905.468] (-910.368) (-915.681) (-913.870) -- 0:04:29
124000 -- [-909.872] (-914.003) (-904.869) (-909.774) * (-911.342) (-917.672) [-906.547] (-904.241) -- 0:04:28
124500 -- (-900.552) (-909.547) [-916.574] (-915.081) * [-905.005] (-920.718) (-899.493) (-913.971) -- 0:04:27
125000 -- (-908.024) (-921.357) (-905.178) [-911.098] * (-903.056) (-913.915) [-913.578] (-917.472) -- 0:04:26
Average standard deviation of split frequencies: 0.017816
125500 -- (-923.183) (-914.584) [-907.217] (-905.550) * (-907.876) [-913.826] (-910.820) (-900.473) -- 0:04:24
126000 -- (-910.313) (-900.291) [-903.986] (-911.095) * (-909.937) (-904.488) (-912.417) [-910.979] -- 0:04:23
126500 -- [-905.511] (-908.512) (-912.815) (-910.150) * (-916.834) (-912.211) [-915.066] (-904.534) -- 0:04:29
127000 -- (-909.125) (-903.761) (-902.809) [-908.277] * (-911.844) (-911.366) [-907.323] (-907.682) -- 0:04:28
127500 -- (-905.574) (-908.016) (-908.134) [-904.448] * (-910.506) [-911.699] (-910.870) (-913.167) -- 0:04:26
128000 -- [-899.727] (-909.838) (-919.023) (-921.554) * [-903.043] (-908.156) (-915.067) (-910.125) -- 0:04:25
128500 -- (-907.424) (-913.611) (-911.221) [-908.849] * (-901.873) (-914.076) [-909.739] (-916.659) -- 0:04:24
129000 -- (-903.046) (-910.218) (-903.383) [-912.636] * (-917.644) [-909.491] (-912.491) (-911.333) -- 0:04:23
129500 -- [-908.215] (-922.146) (-909.160) (-911.160) * (-910.143) [-912.269] (-918.441) (-904.511) -- 0:04:28
130000 -- [-905.699] (-905.441) (-918.594) (-910.919) * (-914.741) [-907.034] (-913.067) (-910.356) -- 0:04:27
Average standard deviation of split frequencies: 0.015579
130500 -- (-916.364) [-906.260] (-910.999) (-914.384) * (-921.818) (-915.480) (-916.181) [-907.855] -- 0:04:26
131000 -- (-911.602) (-904.736) (-910.490) [-902.678] * (-910.251) (-915.336) [-906.132] (-915.559) -- 0:04:25
131500 -- [-907.487] (-915.577) (-909.855) (-903.654) * (-915.385) (-913.909) (-906.344) [-903.427] -- 0:04:24
132000 -- [-911.407] (-916.178) (-915.870) (-904.961) * [-911.201] (-909.301) (-909.990) (-910.667) -- 0:04:23
132500 -- (-905.988) (-905.417) (-920.158) [-908.356] * [-908.890] (-909.166) (-899.075) (-905.149) -- 0:04:21
133000 -- [-912.154] (-917.922) (-908.230) (-907.261) * (-905.589) [-906.332] (-919.963) (-911.114) -- 0:04:27
133500 -- (-914.127) (-914.089) [-904.165] (-912.164) * [-906.158] (-919.029) (-907.940) (-915.552) -- 0:04:26
134000 -- (-916.240) (-923.859) (-903.021) [-900.468] * [-905.314] (-913.407) (-917.347) (-910.318) -- 0:04:24
134500 -- (-910.983) (-919.260) (-911.643) [-912.628] * [-907.659] (-913.420) (-903.914) (-909.793) -- 0:04:23
135000 -- (-912.455) (-912.328) [-901.521] (-929.008) * (-904.223) (-923.328) (-912.296) [-904.662] -- 0:04:22
Average standard deviation of split frequencies: 0.014558
135500 -- (-913.840) [-916.900] (-903.727) (-924.867) * (-902.165) (-910.557) [-907.899] (-916.186) -- 0:04:21
136000 -- (-915.816) (-913.892) [-905.807] (-909.675) * [-908.425] (-910.484) (-907.930) (-918.310) -- 0:04:20
136500 -- (-915.258) (-907.465) (-913.767) [-909.667] * (-911.443) (-899.537) [-903.510] (-913.455) -- 0:04:25
137000 -- (-908.620) (-900.294) (-923.918) [-920.769] * [-908.485] (-916.540) (-914.401) (-905.135) -- 0:04:24
137500 -- [-903.736] (-908.618) (-910.428) (-919.364) * (-906.173) [-908.263] (-910.168) (-914.795) -- 0:04:23
138000 -- (-915.333) [-901.671] (-918.106) (-906.562) * (-903.665) [-906.019] (-910.229) (-918.195) -- 0:04:22
138500 -- (-912.495) (-917.916) [-904.120] (-915.611) * [-910.956] (-910.889) (-928.036) (-917.440) -- 0:04:21
139000 -- (-914.879) (-909.182) [-910.239] (-916.000) * [-904.794] (-912.841) (-913.623) (-911.497) -- 0:04:20
139500 -- (-919.733) (-908.688) [-906.777] (-911.266) * (-904.486) (-912.670) (-912.807) [-907.456] -- 0:04:19
140000 -- (-910.115) (-916.704) [-909.422] (-917.303) * [-912.197] (-914.339) (-907.268) (-912.265) -- 0:04:24
Average standard deviation of split frequencies: 0.017761
140500 -- (-909.772) [-904.327] (-907.204) (-922.778) * (-914.552) (-917.221) (-901.748) [-908.389] -- 0:04:23
141000 -- (-916.613) (-908.994) (-908.997) [-905.942] * (-907.697) (-920.599) [-906.447] (-906.112) -- 0:04:21
141500 -- (-919.650) [-906.152] (-918.549) (-913.058) * (-907.150) (-905.435) (-912.540) [-907.887] -- 0:04:20
142000 -- (-918.004) (-912.415) [-906.610] (-912.143) * (-903.228) (-907.063) (-910.557) [-910.748] -- 0:04:19
142500 -- (-906.159) [-910.391] (-924.036) (-917.723) * (-911.973) (-911.233) [-908.914] (-907.788) -- 0:04:18
143000 -- [-910.879] (-917.509) (-909.958) (-913.923) * (-916.001) (-906.450) (-926.836) [-909.509] -- 0:04:17
143500 -- (-918.772) [-910.897] (-904.340) (-914.517) * (-914.291) [-905.729] (-908.215) (-926.623) -- 0:04:22
144000 -- [-916.726] (-910.735) (-917.356) (-928.272) * [-905.867] (-904.295) (-918.029) (-910.262) -- 0:04:21
144500 -- (-917.916) [-909.570] (-917.911) (-916.977) * (-908.514) (-907.391) [-906.130] (-914.927) -- 0:04:20
145000 -- (-907.927) (-905.922) [-914.967] (-909.710) * (-908.742) (-928.277) (-912.306) [-910.921] -- 0:04:19
Average standard deviation of split frequencies: 0.018758
145500 -- (-928.879) (-910.463) [-901.406] (-911.681) * [-908.162] (-915.793) (-922.460) (-911.327) -- 0:04:18
146000 -- (-914.798) [-910.214] (-905.846) (-913.661) * (-908.146) (-931.742) (-909.494) [-906.279] -- 0:04:17
146500 -- (-908.173) (-912.283) [-906.759] (-906.225) * (-915.674) (-914.958) [-905.300] (-908.439) -- 0:04:16
147000 -- (-912.215) (-914.137) (-915.648) [-905.879] * (-914.062) (-908.694) (-908.753) [-901.446] -- 0:04:21
147500 -- (-913.191) [-907.694] (-916.602) (-902.702) * [-908.535] (-918.092) (-912.627) (-909.992) -- 0:04:20
148000 -- (-916.170) (-907.514) [-913.315] (-911.109) * (-917.187) (-917.336) [-905.374] (-914.104) -- 0:04:19
148500 -- (-904.591) [-909.220] (-909.350) (-911.098) * (-909.235) [-916.994] (-913.695) (-924.732) -- 0:04:18
149000 -- (-915.155) [-910.220] (-909.018) (-906.087) * [-908.673] (-903.116) (-910.857) (-916.601) -- 0:04:17
149500 -- (-910.661) (-902.532) (-908.855) [-906.753] * [-903.305] (-908.895) (-917.246) (-916.647) -- 0:04:16
150000 -- (-908.045) (-903.949) [-905.196] (-908.006) * [-904.006] (-915.624) (-909.194) (-910.508) -- 0:04:14
Average standard deviation of split frequencies: 0.019086
150500 -- [-907.277] (-902.821) (-913.197) (-907.053) * [-909.115] (-915.084) (-909.422) (-914.572) -- 0:04:19
151000 -- (-907.520) (-911.624) (-905.171) [-916.863] * (-911.792) (-914.358) [-909.721] (-907.103) -- 0:04:18
151500 -- (-919.335) [-908.979] (-906.022) (-913.422) * (-911.893) [-906.478] (-905.432) (-911.049) -- 0:04:17
152000 -- (-913.560) [-911.938] (-907.782) (-918.410) * (-916.287) [-910.402] (-906.334) (-920.513) -- 0:04:16
152500 -- (-920.260) [-902.698] (-913.027) (-910.983) * (-916.343) (-914.134) [-909.851] (-911.930) -- 0:04:15
153000 -- (-901.477) [-903.311] (-907.263) (-916.532) * [-901.177] (-909.003) (-919.996) (-917.971) -- 0:04:14
153500 -- (-903.775) (-911.169) [-911.619] (-919.503) * (-903.963) (-918.796) [-909.690] (-907.132) -- 0:04:13
154000 -- [-901.136] (-919.725) (-925.181) (-917.857) * (-910.153) (-935.068) [-902.982] (-918.933) -- 0:04:18
154500 -- [-910.392] (-919.935) (-904.008) (-913.193) * (-907.038) (-926.613) [-909.953] (-917.510) -- 0:04:17
155000 -- [-902.442] (-915.654) (-904.997) (-914.851) * (-906.278) (-912.505) [-909.691] (-905.742) -- 0:04:16
Average standard deviation of split frequencies: 0.018563
155500 -- [-911.947] (-914.089) (-908.349) (-915.420) * (-913.154) (-915.410) [-909.480] (-906.674) -- 0:04:15
156000 -- (-909.493) [-904.009] (-911.413) (-918.758) * (-904.741) (-910.225) [-907.043] (-926.965) -- 0:04:14
156500 -- [-909.730] (-911.884) (-905.242) (-916.900) * (-907.218) (-907.593) (-906.193) [-911.902] -- 0:04:13
157000 -- (-906.292) [-910.698] (-912.025) (-906.715) * [-906.839] (-912.602) (-908.408) (-912.932) -- 0:04:12
157500 -- (-910.692) [-903.179] (-920.030) (-913.227) * [-917.721] (-911.600) (-919.222) (-909.611) -- 0:04:16
158000 -- (-910.771) [-904.741] (-926.510) (-911.323) * (-921.127) [-907.220] (-908.725) (-910.558) -- 0:04:15
158500 -- [-906.018] (-911.493) (-917.139) (-917.600) * (-914.130) (-917.687) [-916.797] (-916.249) -- 0:04:14
159000 -- (-903.826) (-920.694) [-906.865] (-917.197) * (-914.884) [-911.289] (-915.559) (-909.913) -- 0:04:13
159500 -- (-927.923) (-915.474) [-905.972] (-910.053) * (-910.481) [-904.706] (-908.316) (-909.588) -- 0:04:12
160000 -- (-917.734) [-906.220] (-909.075) (-912.494) * (-919.146) (-906.526) [-910.528] (-907.684) -- 0:04:11
Average standard deviation of split frequencies: 0.016906
160500 -- (-910.085) [-909.486] (-912.584) (-919.109) * (-918.515) (-918.838) (-919.251) [-912.926] -- 0:04:16
161000 -- (-922.919) [-900.427] (-912.112) (-909.573) * (-902.288) (-919.109) [-902.639] (-914.451) -- 0:04:15
161500 -- (-919.231) (-908.552) [-907.206] (-921.931) * (-915.356) (-909.826) [-908.039] (-916.664) -- 0:04:14
162000 -- (-910.288) [-913.957] (-910.970) (-918.809) * (-909.293) (-912.324) [-906.770] (-909.012) -- 0:04:13
162500 -- (-913.685) (-905.111) [-904.657] (-910.306) * [-901.841] (-913.285) (-910.666) (-906.502) -- 0:04:12
163000 -- [-911.299] (-907.432) (-912.515) (-920.799) * (-906.619) (-917.059) (-908.983) [-910.727] -- 0:04:11
163500 -- (-905.494) [-910.491] (-912.350) (-919.714) * (-900.289) (-914.677) (-919.631) [-906.445] -- 0:04:10
164000 -- (-912.605) (-908.587) (-906.723) [-913.976] * [-903.211] (-912.538) (-907.407) (-914.294) -- 0:04:14
164500 -- (-913.614) (-912.866) [-918.078] (-911.325) * (-900.788) [-906.806] (-909.321) (-908.848) -- 0:04:13
165000 -- (-904.701) (-921.214) [-913.472] (-920.215) * (-906.057) (-903.537) (-906.082) [-903.847] -- 0:04:13
Average standard deviation of split frequencies: 0.016264
165500 -- [-909.187] (-914.234) (-916.828) (-919.472) * (-917.493) (-911.674) [-913.441] (-917.004) -- 0:04:12
166000 -- (-912.276) (-911.662) [-906.217] (-916.735) * (-923.251) [-908.749] (-910.099) (-913.660) -- 0:04:11
166500 -- [-905.114] (-907.383) (-908.710) (-912.074) * (-912.471) (-911.566) [-908.018] (-912.559) -- 0:04:10
167000 -- (-907.979) (-908.720) [-908.325] (-907.616) * [-917.746] (-909.751) (-911.133) (-906.991) -- 0:04:09
167500 -- [-912.386] (-908.574) (-908.421) (-910.461) * (-915.431) (-904.286) [-909.813] (-915.580) -- 0:04:13
168000 -- (-915.992) (-922.203) [-907.375] (-907.724) * [-907.376] (-911.257) (-910.517) (-914.455) -- 0:04:12
168500 -- (-906.987) [-913.602] (-908.829) (-908.782) * (-907.379) (-912.231) (-904.650) [-909.613] -- 0:04:11
169000 -- (-907.454) (-906.132) [-904.770] (-921.447) * [-910.503] (-917.956) (-905.591) (-912.359) -- 0:04:10
169500 -- (-913.628) [-907.767] (-903.778) (-911.166) * (-910.990) (-910.683) (-916.434) [-910.709] -- 0:04:09
170000 -- (-918.521) (-906.896) [-901.344] (-907.621) * (-904.935) [-905.497] (-913.286) (-911.353) -- 0:04:08
Average standard deviation of split frequencies: 0.018546
170500 -- (-918.354) (-907.159) (-909.313) [-905.595] * [-910.569] (-914.106) (-906.412) (-907.050) -- 0:04:08
171000 -- (-914.220) (-915.600) [-903.745] (-908.765) * [-905.860] (-917.691) (-913.970) (-910.831) -- 0:04:12
171500 -- (-906.435) (-916.866) (-920.168) [-904.120] * [-905.420] (-912.386) (-912.091) (-918.671) -- 0:04:11
172000 -- (-908.177) (-914.011) [-903.662] (-915.585) * (-909.175) [-902.069] (-909.195) (-920.402) -- 0:04:10
172500 -- (-909.146) (-914.781) [-913.523] (-909.809) * (-909.546) [-919.954] (-914.304) (-929.153) -- 0:04:09
173000 -- [-907.505] (-909.787) (-916.712) (-913.564) * (-912.298) (-916.401) (-916.443) [-906.320] -- 0:04:08
173500 -- (-903.638) (-914.601) [-910.331] (-910.111) * (-917.543) [-907.434] (-918.631) (-916.205) -- 0:04:07
174000 -- (-905.065) (-907.994) [-906.542] (-906.949) * (-911.908) (-912.831) [-909.287] (-911.298) -- 0:04:06
174500 -- (-917.730) (-904.368) (-916.867) [-912.220] * (-907.846) [-904.879] (-906.078) (-902.162) -- 0:04:10
175000 -- (-910.625) [-907.834] (-913.523) (-912.194) * (-914.018) (-908.744) (-909.381) [-909.321] -- 0:04:09
Average standard deviation of split frequencies: 0.019259
175500 -- (-910.564) [-908.065] (-909.794) (-914.984) * (-924.297) (-909.118) (-907.786) [-910.916] -- 0:04:08
176000 -- [-904.155] (-921.245) (-904.642) (-920.920) * [-909.837] (-903.906) (-913.641) (-908.974) -- 0:04:08
176500 -- (-917.272) (-907.580) [-905.498] (-908.384) * (-904.058) [-900.899] (-920.055) (-906.711) -- 0:04:07
177000 -- (-909.993) (-900.779) [-909.584] (-916.297) * (-910.134) [-906.667] (-908.350) (-908.622) -- 0:04:06
177500 -- (-913.938) (-913.041) (-914.186) [-899.641] * (-919.929) (-914.203) (-911.359) [-907.634] -- 0:04:05
178000 -- (-916.066) (-904.903) [-906.640] (-920.555) * (-918.109) [-908.073] (-905.484) (-913.270) -- 0:04:09
178500 -- (-911.835) [-909.119] (-909.332) (-907.275) * (-910.250) [-903.209] (-908.501) (-905.125) -- 0:04:08
179000 -- (-930.875) (-920.523) (-910.805) [-912.058] * [-905.289] (-912.573) (-902.063) (-919.018) -- 0:04:07
179500 -- [-924.493] (-912.298) (-915.602) (-913.146) * [-904.111] (-913.919) (-913.547) (-911.716) -- 0:04:06
180000 -- (-916.107) (-913.443) [-905.808] (-927.389) * (-915.840) (-911.244) (-918.586) [-903.063] -- 0:04:05
Average standard deviation of split frequencies: 0.021247
180500 -- [-909.736] (-905.936) (-910.652) (-926.341) * (-920.042) [-920.319] (-916.455) (-909.180) -- 0:04:05
181000 -- (-915.267) (-916.011) (-914.697) [-904.182] * (-915.713) (-911.601) [-904.823] (-910.954) -- 0:04:08
181500 -- (-912.759) [-907.276] (-922.432) (-924.717) * (-909.782) (-908.651) (-914.325) [-916.152] -- 0:04:08
182000 -- [-903.644] (-907.208) (-912.879) (-910.442) * [-906.987] (-909.049) (-910.896) (-917.191) -- 0:04:07
182500 -- [-908.903] (-911.330) (-914.393) (-908.995) * (-907.329) (-904.636) (-910.708) [-909.814] -- 0:04:06
183000 -- [-909.064] (-917.907) (-908.820) (-908.952) * (-910.750) [-903.352] (-901.402) (-907.803) -- 0:04:05
183500 -- (-918.275) (-920.323) (-910.954) [-902.805] * (-908.028) (-912.168) (-905.168) [-906.339] -- 0:04:04
184000 -- [-910.308] (-916.685) (-914.485) (-929.926) * (-913.070) [-908.417] (-912.004) (-911.366) -- 0:04:03
184500 -- [-902.887] (-913.748) (-910.021) (-908.837) * [-911.714] (-906.444) (-912.515) (-908.011) -- 0:04:07
185000 -- (-908.374) (-912.307) (-913.028) [-908.478] * (-907.295) (-903.188) (-917.067) [-906.302] -- 0:04:06
Average standard deviation of split frequencies: 0.021724
185500 -- (-909.099) [-902.857] (-918.240) (-911.376) * (-911.222) [-902.139] (-906.270) (-917.903) -- 0:04:05
186000 -- (-911.106) (-920.669) (-916.809) [-905.986] * [-911.216] (-911.806) (-911.986) (-918.827) -- 0:04:05
186500 -- [-899.733] (-912.032) (-916.374) (-912.936) * [-908.214] (-914.373) (-907.803) (-910.077) -- 0:04:04
187000 -- [-911.234] (-916.790) (-926.650) (-924.861) * [-914.576] (-914.170) (-915.237) (-913.436) -- 0:04:03
187500 -- [-909.612] (-910.435) (-930.616) (-907.904) * (-912.385) (-906.187) (-923.075) [-913.366] -- 0:04:02
188000 -- [-907.787] (-907.328) (-924.584) (-911.402) * (-910.195) [-909.295] (-910.008) (-910.169) -- 0:04:06
188500 -- (-913.573) (-903.594) (-910.792) [-908.778] * (-915.350) (-908.296) (-910.983) [-910.451] -- 0:04:05
189000 -- [-908.640] (-918.208) (-902.861) (-913.675) * (-914.450) (-907.676) (-908.338) [-908.487] -- 0:04:04
189500 -- [-908.637] (-905.983) (-905.821) (-912.390) * (-914.665) (-911.935) (-920.494) [-905.111] -- 0:04:03
190000 -- (-906.367) [-905.831] (-912.682) (-911.961) * (-904.856) (-910.969) (-911.273) [-905.499] -- 0:04:02
Average standard deviation of split frequencies: 0.022016
190500 -- [-903.761] (-910.578) (-905.818) (-916.746) * (-913.196) (-908.395) (-914.885) [-901.128] -- 0:04:02
191000 -- (-908.504) (-908.179) [-906.237] (-910.506) * (-908.108) (-914.186) (-910.528) [-908.922] -- 0:04:01
191500 -- (-910.280) (-919.283) [-913.631] (-913.253) * (-918.634) (-916.219) (-910.573) [-905.061] -- 0:04:04
192000 -- (-912.965) (-914.542) (-913.899) [-915.366] * (-926.064) (-909.727) (-901.843) [-905.750] -- 0:04:04
192500 -- (-912.776) [-910.196] (-913.457) (-912.338) * (-918.361) (-912.127) (-909.448) [-905.164] -- 0:04:03
193000 -- (-914.997) (-909.386) (-925.138) [-899.588] * (-916.431) (-908.639) (-908.594) [-909.195] -- 0:04:02
193500 -- (-926.440) [-905.430] (-912.460) (-910.184) * (-910.364) (-905.274) (-914.377) [-917.452] -- 0:04:01
194000 -- [-923.471] (-903.786) (-900.692) (-907.951) * (-917.626) [-908.768] (-907.224) (-910.303) -- 0:04:00
194500 -- (-907.588) (-910.259) (-922.248) [-904.940] * (-907.704) (-910.312) [-905.257] (-916.873) -- 0:04:04
195000 -- (-924.028) (-913.763) (-924.055) [-918.227] * (-924.559) (-914.319) [-904.170] (-910.582) -- 0:04:03
Average standard deviation of split frequencies: 0.021761
195500 -- [-903.989] (-912.893) (-917.728) (-904.840) * (-914.369) [-907.980] (-906.813) (-910.357) -- 0:04:02
196000 -- [-913.080] (-911.587) (-909.981) (-922.455) * (-910.933) [-910.832] (-913.864) (-904.228) -- 0:04:02
196500 -- (-914.680) (-904.698) (-904.762) [-908.117] * (-908.457) (-912.582) (-911.238) [-906.896] -- 0:04:01
197000 -- (-914.503) (-911.141) (-911.891) [-901.309] * (-921.662) [-908.047] (-909.402) (-912.387) -- 0:04:00
197500 -- (-907.739) (-913.745) [-902.211] (-910.017) * (-908.812) [-909.032] (-917.591) (-921.733) -- 0:03:59
198000 -- (-901.569) [-906.720] (-908.376) (-902.074) * (-899.572) [-908.613] (-920.444) (-901.159) -- 0:04:03
198500 -- [-904.809] (-918.090) (-900.088) (-909.161) * [-912.061] (-911.709) (-911.565) (-915.445) -- 0:04:02
199000 -- [-912.726] (-910.086) (-915.401) (-904.635) * (-915.443) (-916.389) (-927.066) [-908.898] -- 0:04:01
199500 -- [-908.983] (-915.313) (-923.628) (-914.157) * [-909.723] (-910.380) (-914.700) (-919.760) -- 0:04:00
200000 -- (-905.649) (-913.562) (-918.475) [-906.206] * [-912.130] (-911.992) (-910.776) (-915.643) -- 0:03:59
Average standard deviation of split frequencies: 0.022485
200500 -- (-906.748) [-904.778] (-915.828) (-916.201) * (-908.464) [-909.142] (-919.530) (-910.498) -- 0:03:59
201000 -- (-920.159) [-913.329] (-914.463) (-913.728) * (-911.530) (-913.948) (-916.807) [-910.185] -- 0:03:58
201500 -- (-910.305) [-908.581] (-916.962) (-903.104) * (-911.757) [-903.369] (-915.961) (-913.038) -- 0:04:01
202000 -- (-916.004) [-909.562] (-916.927) (-907.675) * [-910.375] (-906.618) (-913.318) (-919.594) -- 0:04:00
202500 -- (-913.339) [-911.311] (-915.141) (-911.978) * [-909.527] (-908.526) (-918.519) (-910.684) -- 0:04:00
203000 -- (-907.754) (-904.994) (-917.259) [-919.274] * (-906.523) [-906.711] (-909.614) (-922.821) -- 0:03:59
203500 -- (-924.040) [-910.380] (-907.615) (-911.689) * (-908.051) (-914.658) [-911.870] (-916.299) -- 0:03:58
204000 -- [-906.262] (-912.151) (-909.330) (-910.229) * (-914.907) (-922.350) [-916.567] (-922.303) -- 0:03:58
204500 -- [-906.490] (-903.818) (-907.818) (-912.998) * (-908.887) [-916.443] (-920.424) (-915.864) -- 0:03:57
205000 -- (-911.766) (-908.909) [-913.336] (-919.958) * [-908.338] (-906.968) (-914.398) (-911.679) -- 0:04:00
Average standard deviation of split frequencies: 0.023538
205500 -- [-908.547] (-916.292) (-909.169) (-910.780) * (-914.892) (-907.015) [-913.615] (-913.281) -- 0:03:59
206000 -- (-914.584) [-903.615] (-914.702) (-901.976) * [-904.062] (-905.387) (-915.342) (-910.680) -- 0:03:58
206500 -- (-906.856) (-905.965) (-912.948) [-911.793] * (-908.957) [-902.490] (-922.036) (-904.586) -- 0:03:58
207000 -- [-910.163] (-913.578) (-922.674) (-915.527) * [-907.297] (-903.505) (-909.880) (-907.332) -- 0:03:57
207500 -- (-913.836) (-908.310) (-908.898) [-904.623] * (-917.369) (-911.115) [-912.512] (-910.168) -- 0:03:56
208000 -- (-915.558) (-902.686) [-903.792] (-912.300) * (-903.592) (-916.781) (-919.147) [-905.054] -- 0:03:56
208500 -- (-926.088) (-908.399) (-906.496) [-903.611] * (-911.278) (-910.913) [-908.768] (-906.669) -- 0:03:59
209000 -- (-910.775) [-905.804] (-909.454) (-902.126) * (-903.371) [-906.306] (-909.961) (-907.697) -- 0:03:58
209500 -- (-917.132) (-908.898) [-904.878] (-912.233) * (-912.883) (-905.085) [-909.027] (-913.887) -- 0:03:57
210000 -- (-914.302) (-912.229) [-903.715] (-903.333) * (-908.830) (-908.999) (-907.679) [-910.135] -- 0:03:56
Average standard deviation of split frequencies: 0.021524
210500 -- [-910.703] (-902.738) (-923.136) (-917.263) * (-915.999) (-908.428) [-916.873] (-913.409) -- 0:03:56
211000 -- (-905.002) (-906.008) [-911.167] (-905.450) * (-911.102) (-903.667) [-899.803] (-909.382) -- 0:03:55
211500 -- [-900.644] (-903.455) (-915.021) (-912.700) * (-919.311) [-911.771] (-908.294) (-908.360) -- 0:03:54
212000 -- (-901.755) [-904.756] (-916.365) (-906.992) * (-904.115) (-903.286) (-912.665) [-906.440] -- 0:03:57
212500 -- [-901.203] (-903.542) (-906.789) (-921.964) * (-917.568) (-916.277) [-909.091] (-910.636) -- 0:03:57
213000 -- (-900.374) (-913.803) (-916.565) [-906.790] * (-909.764) [-907.775] (-910.132) (-912.870) -- 0:03:56
213500 -- (-920.584) (-902.016) [-907.450] (-911.045) * (-907.404) [-902.524] (-909.001) (-912.094) -- 0:03:55
214000 -- (-907.281) (-909.987) (-912.669) [-913.297] * [-922.554] (-905.848) (-915.943) (-910.995) -- 0:03:55
214500 -- [-906.111] (-905.783) (-905.600) (-911.926) * (-908.328) (-910.739) [-907.291] (-911.395) -- 0:03:54
215000 -- [-904.867] (-917.976) (-907.402) (-921.452) * (-908.703) [-902.147] (-914.219) (-916.136) -- 0:03:53
Average standard deviation of split frequencies: 0.022864
215500 -- (-925.533) [-909.085] (-911.436) (-923.270) * (-913.667) [-906.601] (-915.997) (-904.858) -- 0:03:56
216000 -- (-914.058) (-917.763) [-908.627] (-913.822) * [-903.426] (-906.482) (-915.212) (-913.896) -- 0:03:55
216500 -- [-905.491] (-912.094) (-921.259) (-905.784) * (-909.737) (-915.470) (-908.739) [-918.385] -- 0:03:55
217000 -- (-920.997) [-908.025] (-915.566) (-910.501) * [-914.893] (-907.943) (-908.913) (-912.112) -- 0:03:54
217500 -- (-913.752) (-910.455) (-913.065) [-910.278] * [-904.167] (-905.936) (-904.841) (-904.644) -- 0:03:53
218000 -- (-904.089) (-907.989) (-909.794) [-904.452] * (-907.011) (-914.155) (-920.244) [-903.173] -- 0:03:53
218500 -- (-913.009) (-904.073) (-914.063) [-902.374] * [-907.658] (-908.018) (-910.597) (-920.395) -- 0:03:52
219000 -- (-915.169) [-911.751] (-905.813) (-906.178) * (-910.995) [-899.617] (-920.818) (-911.461) -- 0:03:55
219500 -- (-914.061) (-908.762) [-907.840] (-907.719) * [-912.546] (-907.663) (-913.304) (-909.449) -- 0:03:54
220000 -- (-917.045) [-904.216] (-903.694) (-908.967) * (-904.615) (-908.496) (-919.141) [-912.664] -- 0:03:53
Average standard deviation of split frequencies: 0.024415
220500 -- (-912.662) (-906.164) (-916.049) [-909.130] * (-906.647) (-910.209) [-913.224] (-907.622) -- 0:03:53
221000 -- (-918.761) (-907.759) (-910.754) [-911.800] * (-914.617) [-902.692] (-920.127) (-920.206) -- 0:03:52
221500 -- (-917.616) (-907.818) (-911.756) [-907.802] * (-918.730) [-906.018] (-911.711) (-909.329) -- 0:03:51
222000 -- [-903.796] (-907.457) (-912.207) (-926.732) * (-908.776) (-915.174) (-908.270) [-913.361] -- 0:03:54
222500 -- (-904.964) (-906.590) [-910.519] (-905.224) * (-906.521) (-906.619) (-906.788) [-902.413] -- 0:03:54
223000 -- (-915.381) (-913.684) [-903.256] (-904.537) * [-903.790] (-912.385) (-912.239) (-908.322) -- 0:03:53
223500 -- (-906.941) [-904.192] (-913.269) (-906.468) * [-906.327] (-906.951) (-904.705) (-904.378) -- 0:03:52
224000 -- [-910.480] (-910.654) (-908.278) (-911.098) * (-912.309) (-907.359) [-905.975] (-909.538) -- 0:03:52
224500 -- (-916.277) [-908.034] (-920.275) (-904.759) * (-917.482) (-910.739) (-915.426) [-910.090] -- 0:03:51
225000 -- [-907.097] (-915.030) (-903.076) (-907.051) * [-904.573] (-914.829) (-914.880) (-900.999) -- 0:03:50
Average standard deviation of split frequencies: 0.024434
225500 -- (-907.611) (-913.548) (-910.427) [-907.816] * [-909.066] (-905.491) (-907.725) (-908.203) -- 0:03:53
226000 -- [-913.654] (-905.424) (-913.558) (-911.296) * (-904.220) (-924.999) [-900.314] (-900.550) -- 0:03:52
226500 -- (-919.351) [-903.691] (-909.811) (-913.079) * [-901.892] (-908.282) (-909.826) (-900.531) -- 0:03:52
227000 -- (-924.084) (-914.415) [-911.422] (-923.475) * (-918.060) (-915.537) (-906.979) [-902.266] -- 0:03:51
227500 -- [-913.459] (-904.387) (-908.848) (-916.170) * [-904.691] (-917.843) (-913.742) (-906.637) -- 0:03:50
228000 -- (-901.322) (-916.111) (-906.491) [-914.008] * (-917.957) (-924.726) (-904.633) [-912.573] -- 0:03:50
228500 -- (-908.215) (-908.745) [-911.670] (-924.439) * (-907.420) (-929.743) [-905.833] (-912.177) -- 0:03:49
229000 -- [-902.320] (-902.722) (-913.766) (-916.441) * (-913.911) (-907.577) (-911.230) [-907.546] -- 0:03:52
229500 -- [-900.895] (-900.638) (-920.110) (-922.779) * [-906.271] (-914.281) (-911.259) (-905.798) -- 0:03:51
230000 -- (-913.306) (-908.154) [-917.071] (-919.354) * [-907.020] (-911.766) (-915.919) (-907.413) -- 0:03:50
Average standard deviation of split frequencies: 0.027638
230500 -- (-921.509) [-908.738] (-910.790) (-916.211) * [-907.767] (-913.726) (-909.450) (-913.922) -- 0:03:50
231000 -- [-910.828] (-928.429) (-910.705) (-916.901) * (-917.050) (-910.957) (-911.891) [-906.628] -- 0:03:49
231500 -- (-908.848) (-925.417) [-906.076] (-917.187) * (-908.007) (-911.328) [-917.721] (-911.494) -- 0:03:49
232000 -- (-925.246) [-912.451] (-911.812) (-917.041) * (-907.701) [-914.602] (-918.496) (-912.930) -- 0:03:51
232500 -- (-920.473) (-915.109) [-903.810] (-906.040) * (-911.281) (-918.318) [-904.564] (-912.923) -- 0:03:51
233000 -- (-917.723) (-908.816) (-917.841) [-902.964] * (-908.587) [-911.492] (-911.188) (-916.421) -- 0:03:50
233500 -- (-911.209) (-915.484) [-911.088] (-912.360) * [-908.617] (-908.579) (-907.196) (-911.344) -- 0:03:49
234000 -- (-917.396) (-903.614) [-910.187] (-910.671) * [-909.098] (-914.900) (-912.611) (-911.528) -- 0:03:49
234500 -- (-913.943) (-917.129) (-909.077) [-913.840] * [-915.650] (-910.259) (-909.469) (-911.663) -- 0:03:48
235000 -- (-909.298) (-908.768) (-917.918) [-909.278] * [-902.043] (-915.691) (-902.955) (-917.405) -- 0:03:47
Average standard deviation of split frequencies: 0.027584
235500 -- (-916.604) (-901.769) [-914.837] (-917.795) * (-909.929) [-916.108] (-908.660) (-909.211) -- 0:03:50
236000 -- (-921.131) [-904.632] (-917.062) (-913.646) * (-903.968) (-914.506) (-911.751) [-913.910] -- 0:03:49
236500 -- (-919.430) (-905.892) [-906.498] (-910.782) * (-909.384) (-910.876) [-911.384] (-924.691) -- 0:03:49
237000 -- (-912.911) [-907.056] (-908.093) (-917.924) * [-900.901] (-916.622) (-904.699) (-920.975) -- 0:03:48
237500 -- [-911.164] (-912.933) (-905.159) (-918.768) * (-912.733) [-901.679] (-923.864) (-916.489) -- 0:03:47
238000 -- [-908.343] (-907.546) (-905.444) (-912.221) * (-912.362) [-905.290] (-910.539) (-917.355) -- 0:03:47
238500 -- (-908.404) (-909.089) (-914.220) [-906.658] * [-907.433] (-907.814) (-915.815) (-903.659) -- 0:03:49
239000 -- (-912.159) (-911.569) [-903.691] (-928.944) * (-912.841) [-907.648] (-912.514) (-912.041) -- 0:03:49
239500 -- (-914.802) [-909.022] (-907.293) (-908.881) * [-908.894] (-917.078) (-910.780) (-911.297) -- 0:03:48
240000 -- (-919.785) (-902.117) [-904.965] (-908.876) * (-914.468) (-915.250) [-909.339] (-910.617) -- 0:03:47
Average standard deviation of split frequencies: 0.026303
240500 -- [-909.511] (-919.626) (-914.040) (-917.174) * (-910.182) (-913.044) (-910.014) [-910.830] -- 0:03:47
241000 -- (-913.960) [-904.781] (-911.448) (-911.217) * (-914.426) (-913.302) [-907.334] (-910.353) -- 0:03:46
241500 -- (-913.459) (-918.102) (-899.749) [-914.363] * [-917.855] (-903.138) (-905.116) (-919.772) -- 0:03:46
242000 -- (-909.871) [-904.862] (-908.582) (-910.708) * (-918.144) (-916.409) (-912.975) [-919.575] -- 0:03:48
242500 -- [-909.826] (-905.629) (-905.877) (-913.696) * (-908.405) [-915.256] (-914.539) (-908.410) -- 0:03:48
243000 -- (-918.129) [-912.140] (-899.881) (-905.386) * (-925.922) [-920.481] (-915.092) (-910.710) -- 0:03:47
243500 -- [-913.648] (-914.658) (-910.942) (-922.560) * [-920.834] (-926.438) (-910.567) (-911.839) -- 0:03:46
244000 -- (-919.695) [-908.153] (-910.219) (-913.120) * [-906.448] (-914.916) (-908.999) (-908.905) -- 0:03:46
244500 -- (-917.626) (-907.859) (-917.196) [-903.963] * (-907.944) [-906.734] (-911.070) (-915.134) -- 0:03:45
245000 -- (-905.527) [-908.910] (-912.522) (-916.500) * (-904.589) [-907.360] (-908.897) (-908.196) -- 0:03:44
Average standard deviation of split frequencies: 0.025459
245500 -- (-909.246) [-916.037] (-910.194) (-914.660) * (-907.535) (-906.994) (-912.195) [-909.274] -- 0:03:47
246000 -- [-909.536] (-913.157) (-921.042) (-911.759) * (-906.871) (-906.208) (-929.522) [-904.942] -- 0:03:46
246500 -- (-906.824) [-913.587] (-917.690) (-906.585) * (-905.814) [-907.988] (-908.462) (-907.346) -- 0:03:46
247000 -- (-905.825) (-918.733) [-909.287] (-914.992) * (-914.590) (-919.406) [-910.480] (-905.861) -- 0:03:45
247500 -- [-905.826] (-917.022) (-911.619) (-921.680) * [-911.080] (-916.835) (-919.658) (-910.504) -- 0:03:44
248000 -- (-912.256) (-919.229) (-903.747) [-916.132] * (-918.461) (-914.550) (-916.637) [-912.624] -- 0:03:44
248500 -- [-907.866] (-911.830) (-911.437) (-906.498) * (-915.911) [-911.743] (-916.560) (-913.551) -- 0:03:43
249000 -- (-921.633) (-925.750) (-915.089) [-912.847] * (-916.072) [-902.638] (-909.597) (-922.793) -- 0:03:46
249500 -- (-918.980) [-909.931] (-920.082) (-908.456) * (-920.330) (-915.714) [-914.147] (-909.421) -- 0:03:45
250000 -- (-908.324) [-905.730] (-915.053) (-914.944) * (-919.490) [-908.093] (-912.189) (-920.407) -- 0:03:44
Average standard deviation of split frequencies: 0.024918
250500 -- (-920.503) (-906.873) [-909.794] (-913.703) * (-907.981) [-907.157] (-908.094) (-910.091) -- 0:03:44
251000 -- [-913.373] (-916.679) (-918.567) (-911.454) * [-906.562] (-907.916) (-905.800) (-920.361) -- 0:03:43
251500 -- [-908.228] (-915.050) (-911.332) (-913.209) * (-913.689) [-902.304] (-908.776) (-917.488) -- 0:03:43
252000 -- (-917.131) (-911.533) (-919.340) [-911.608] * (-913.381) [-904.121] (-910.521) (-923.857) -- 0:03:42
252500 -- (-911.445) (-916.760) (-913.696) [-917.268] * (-913.435) [-904.297] (-908.015) (-909.528) -- 0:03:44
253000 -- (-904.459) (-910.510) [-911.613] (-908.015) * [-910.677] (-914.167) (-919.167) (-911.634) -- 0:03:44
253500 -- (-910.069) (-912.153) (-912.051) [-913.095] * [-900.157] (-916.173) (-911.959) (-909.457) -- 0:03:43
254000 -- (-917.933) [-910.672] (-910.992) (-909.512) * (-916.939) (-916.990) [-905.361] (-918.424) -- 0:03:43
254500 -- (-913.550) (-908.170) (-909.750) [-910.203] * (-917.620) (-914.841) [-903.467] (-909.481) -- 0:03:42
255000 -- (-902.402) (-912.436) (-909.429) [-902.787] * [-905.405] (-913.243) (-906.468) (-911.330) -- 0:03:42
Average standard deviation of split frequencies: 0.024399
255500 -- (-914.738) (-907.354) (-922.739) [-907.975] * (-907.667) [-913.586] (-915.071) (-914.574) -- 0:03:44
256000 -- (-907.483) (-912.511) (-922.243) [-901.082] * (-917.758) [-906.239] (-902.115) (-911.199) -- 0:03:43
256500 -- [-918.395] (-917.694) (-910.940) (-913.947) * (-912.982) [-908.375] (-912.941) (-908.311) -- 0:03:43
257000 -- (-916.779) [-905.699] (-914.527) (-927.796) * (-918.284) (-918.735) (-905.774) [-908.113] -- 0:03:42
257500 -- (-918.834) [-906.590] (-907.980) (-908.442) * (-907.682) (-911.082) [-913.287] (-914.358) -- 0:03:42
258000 -- [-914.429] (-905.101) (-918.752) (-914.901) * [-903.383] (-914.473) (-908.460) (-910.729) -- 0:03:41
258500 -- (-903.939) (-913.045) [-907.750] (-910.975) * [-904.830] (-910.133) (-910.892) (-910.141) -- 0:03:40
259000 -- [-906.409] (-909.629) (-907.395) (-911.430) * (-912.189) (-910.368) [-910.091] (-916.410) -- 0:03:43
259500 -- (-905.554) (-910.600) [-909.935] (-914.267) * (-903.588) [-899.615] (-915.877) (-916.189) -- 0:03:42
260000 -- (-906.498) (-903.403) (-914.508) [-907.697] * (-902.918) (-911.936) [-906.573] (-912.966) -- 0:03:41
Average standard deviation of split frequencies: 0.024505
260500 -- [-903.958] (-913.032) (-929.666) (-915.075) * (-913.597) [-904.899] (-910.822) (-904.782) -- 0:03:41
261000 -- [-905.404] (-907.049) (-920.328) (-905.567) * [-908.725] (-910.100) (-914.931) (-905.522) -- 0:03:40
261500 -- (-902.675) (-918.200) (-900.520) [-909.149] * (-909.384) (-916.714) [-912.312] (-908.052) -- 0:03:40
262000 -- (-916.400) (-918.580) [-907.038] (-918.259) * (-913.323) (-910.058) [-908.990] (-916.872) -- 0:03:39
262500 -- [-912.532] (-913.816) (-923.955) (-908.015) * (-908.644) [-906.099] (-913.714) (-910.114) -- 0:03:41
263000 -- (-908.835) [-913.401] (-913.221) (-908.950) * (-913.365) [-909.537] (-900.546) (-915.239) -- 0:03:41
263500 -- (-912.094) (-922.840) (-905.790) [-908.643] * [-907.750] (-916.645) (-907.183) (-909.838) -- 0:03:40
264000 -- (-907.890) (-919.626) (-918.979) [-907.275] * [-910.269] (-919.013) (-913.974) (-912.573) -- 0:03:40
264500 -- [-911.722] (-914.169) (-910.640) (-908.160) * (-910.298) (-906.839) [-907.991] (-909.719) -- 0:03:39
265000 -- (-904.347) (-910.539) [-903.291] (-908.410) * (-905.187) [-908.933] (-917.335) (-916.314) -- 0:03:39
Average standard deviation of split frequencies: 0.022950
265500 -- (-905.112) (-912.613) [-907.321] (-914.570) * (-910.181) (-908.452) [-908.116] (-908.316) -- 0:03:38
266000 -- (-922.700) (-917.352) (-906.147) [-907.699] * (-916.602) (-916.669) [-905.610] (-916.819) -- 0:03:40
266500 -- (-906.861) (-910.997) [-917.409] (-902.872) * (-908.708) [-913.575] (-912.695) (-900.786) -- 0:03:40
267000 -- [-906.849] (-922.194) (-907.773) (-904.376) * (-909.091) (-903.023) (-907.786) [-905.880] -- 0:03:39
267500 -- [-903.822] (-921.124) (-911.069) (-911.105) * (-914.312) (-912.395) (-905.039) [-902.242] -- 0:03:39
268000 -- (-912.159) [-917.918] (-910.680) (-914.929) * (-908.889) [-909.886] (-906.940) (-905.312) -- 0:03:38
268500 -- (-908.679) (-933.574) [-913.662] (-907.425) * (-911.281) (-914.236) (-911.493) [-911.236] -- 0:03:37
269000 -- (-917.578) (-909.614) (-911.582) [-908.825] * (-923.638) (-907.641) (-909.813) [-899.364] -- 0:03:37
269500 -- (-912.888) [-918.842] (-913.451) (-913.177) * (-914.411) (-910.349) (-911.996) [-903.939] -- 0:03:39
270000 -- [-912.992] (-913.055) (-908.771) (-910.628) * (-918.905) (-905.928) (-912.242) [-908.243] -- 0:03:38
Average standard deviation of split frequencies: 0.021149
270500 -- (-921.075) (-909.882) (-902.015) [-909.565] * [-911.442] (-914.732) (-916.236) (-908.703) -- 0:03:38
271000 -- (-915.685) (-912.898) (-907.212) [-916.623] * [-915.501] (-905.569) (-911.289) (-906.312) -- 0:03:37
271500 -- (-912.341) [-902.890] (-904.606) (-915.864) * (-912.067) (-904.684) (-909.858) [-908.698] -- 0:03:37
272000 -- [-907.208] (-907.423) (-911.117) (-905.932) * (-917.060) [-910.061] (-918.452) (-912.198) -- 0:03:36
272500 -- (-917.043) [-912.618] (-911.505) (-907.181) * (-919.252) (-911.483) [-909.950] (-908.334) -- 0:03:38
273000 -- [-915.710] (-911.670) (-914.811) (-911.129) * (-912.646) (-906.474) (-913.800) [-914.198] -- 0:03:38
273500 -- (-922.573) (-908.583) [-908.440] (-920.104) * (-913.400) (-911.770) (-919.218) [-904.686] -- 0:03:37
274000 -- [-914.911] (-906.680) (-911.870) (-909.969) * (-910.945) [-909.694] (-915.792) (-906.548) -- 0:03:37
274500 -- (-913.484) [-915.485] (-908.197) (-903.320) * (-923.362) (-908.846) (-909.318) [-902.969] -- 0:03:36
275000 -- (-909.183) (-905.796) (-913.611) [-905.900] * (-922.023) [-905.943] (-915.639) (-902.718) -- 0:03:36
Average standard deviation of split frequencies: 0.021862
275500 -- (-920.073) [-907.135] (-918.174) (-912.823) * (-911.378) (-911.916) (-910.807) [-910.875] -- 0:03:35
276000 -- (-913.666) (-910.863) (-917.383) [-911.920] * (-909.200) [-907.324] (-912.247) (-910.706) -- 0:03:37
276500 -- (-910.148) (-917.924) (-913.567) [-908.295] * (-909.804) (-914.029) [-905.112] (-914.777) -- 0:03:37
277000 -- (-915.683) (-915.066) (-912.971) [-905.402] * [-913.262] (-918.662) (-923.091) (-905.288) -- 0:03:36
277500 -- (-910.428) (-913.984) (-913.458) [-906.755] * (-911.324) (-918.204) (-910.675) [-901.694] -- 0:03:36
278000 -- [-915.694] (-907.977) (-914.712) (-918.517) * (-910.373) (-917.028) (-908.737) [-900.168] -- 0:03:35
278500 -- (-904.836) [-915.609] (-911.591) (-915.562) * [-910.486] (-917.692) (-908.466) (-907.026) -- 0:03:35
279000 -- (-908.108) (-926.978) (-915.778) [-903.760] * (-909.876) (-919.558) [-906.255] (-906.965) -- 0:03:37
279500 -- (-910.241) (-917.724) (-913.199) [-910.639] * [-905.176] (-910.026) (-909.972) (-907.127) -- 0:03:36
280000 -- (-908.767) (-921.029) [-916.337] (-922.983) * [-910.516] (-907.449) (-910.506) (-915.825) -- 0:03:35
Average standard deviation of split frequencies: 0.021499
280500 -- [-914.142] (-922.977) (-912.541) (-905.199) * (-903.758) [-905.609] (-912.877) (-924.443) -- 0:03:35
281000 -- (-911.330) (-915.124) (-911.211) [-921.381] * (-927.347) (-911.709) (-900.593) [-900.988] -- 0:03:34
281500 -- (-923.241) (-911.947) (-912.327) [-904.234] * (-908.547) [-908.383] (-909.199) (-908.521) -- 0:03:34
282000 -- [-906.428] (-915.592) (-912.239) (-916.889) * (-913.233) (-907.318) (-906.492) [-915.635] -- 0:03:33
282500 -- (-904.630) [-911.431] (-912.836) (-908.349) * (-920.281) (-907.401) (-911.376) [-914.046] -- 0:03:35
283000 -- (-914.173) (-908.261) (-915.185) [-908.195] * (-920.384) (-901.329) (-907.388) [-907.970] -- 0:03:35
283500 -- [-915.500] (-911.688) (-910.061) (-911.149) * (-911.865) [-910.136] (-912.053) (-916.165) -- 0:03:34
284000 -- (-922.713) (-925.682) (-919.946) [-905.495] * (-913.102) (-906.646) [-912.773] (-907.378) -- 0:03:34
284500 -- [-914.591] (-918.967) (-911.376) (-909.927) * (-919.678) (-915.952) (-907.494) [-918.144] -- 0:03:33
285000 -- [-910.928] (-917.054) (-917.216) (-913.064) * (-913.024) (-906.697) [-917.089] (-915.072) -- 0:03:33
Average standard deviation of split frequencies: 0.020851
285500 -- [-904.385] (-909.713) (-922.084) (-914.103) * (-913.446) [-908.802] (-906.314) (-907.028) -- 0:03:32
286000 -- (-917.345) [-907.104] (-915.840) (-913.895) * (-912.555) [-907.380] (-901.387) (-911.383) -- 0:03:34
286500 -- [-913.030] (-903.862) (-909.159) (-905.839) * [-908.634] (-914.504) (-905.351) (-917.989) -- 0:03:34
287000 -- [-907.104] (-919.456) (-913.145) (-918.721) * (-910.751) (-918.520) [-903.291] (-903.839) -- 0:03:33
287500 -- (-904.576) (-917.008) [-904.036] (-911.502) * (-912.098) (-921.984) (-926.755) [-907.342] -- 0:03:33
288000 -- (-915.661) (-910.074) [-904.372] (-913.583) * (-912.394) (-923.174) (-912.811) [-903.627] -- 0:03:32
288500 -- (-915.492) [-912.923] (-912.629) (-916.519) * (-918.288) (-918.086) [-907.609] (-914.595) -- 0:03:32
289000 -- (-904.304) (-911.908) [-910.706] (-904.763) * (-918.086) (-916.164) [-906.375] (-922.649) -- 0:03:31
289500 -- (-908.449) (-917.763) [-908.866] (-911.141) * (-926.967) [-914.170] (-914.740) (-910.457) -- 0:03:33
290000 -- (-911.300) [-911.119] (-911.284) (-914.373) * (-917.636) [-905.093] (-915.067) (-918.173) -- 0:03:32
Average standard deviation of split frequencies: 0.021083
290500 -- (-911.224) [-914.114] (-913.872) (-912.847) * (-912.161) [-910.864] (-914.261) (-912.187) -- 0:03:32
291000 -- [-909.501] (-932.230) (-915.177) (-905.860) * (-914.175) (-913.335) [-913.567] (-918.713) -- 0:03:31
291500 -- [-904.094] (-922.554) (-906.799) (-905.022) * (-911.834) (-913.113) (-909.104) [-915.413] -- 0:03:31
292000 -- (-911.365) (-906.263) (-911.521) [-906.126] * (-912.564) (-915.635) [-898.740] (-911.379) -- 0:03:30
292500 -- [-907.450] (-912.394) (-906.668) (-911.125) * (-908.651) (-910.585) (-900.466) [-910.911] -- 0:03:32
293000 -- (-912.629) (-920.787) (-914.449) [-911.255] * (-917.660) (-908.908) [-906.596] (-912.460) -- 0:03:32
293500 -- (-908.570) [-909.383] (-917.794) (-903.146) * (-911.019) [-914.075] (-903.270) (-918.244) -- 0:03:31
294000 -- (-912.073) (-918.477) (-915.781) [-904.764] * (-916.149) (-911.516) (-908.343) [-908.174] -- 0:03:31
294500 -- (-918.618) [-906.204] (-905.260) (-909.028) * (-911.817) [-902.421] (-911.418) (-916.406) -- 0:03:30
295000 -- (-919.546) (-909.101) (-912.986) [-903.187] * (-913.898) [-908.573] (-913.247) (-912.010) -- 0:03:30
Average standard deviation of split frequencies: 0.020226
295500 -- (-904.310) (-906.969) [-908.931] (-904.414) * [-906.279] (-913.011) (-904.644) (-905.096) -- 0:03:32
296000 -- (-913.097) (-920.608) (-916.974) [-903.216] * (-913.412) (-910.662) [-914.896] (-904.448) -- 0:03:31
296500 -- (-905.157) [-914.766] (-914.320) (-913.505) * (-912.035) (-913.558) (-915.922) [-906.114] -- 0:03:31
297000 -- (-903.062) [-911.367] (-914.830) (-904.638) * (-910.488) [-904.618] (-914.915) (-907.752) -- 0:03:30
297500 -- [-904.174] (-916.494) (-914.110) (-908.581) * (-912.888) [-910.234] (-913.701) (-929.204) -- 0:03:30
298000 -- (-914.170) [-909.267] (-913.004) (-911.784) * (-918.563) (-909.989) (-911.041) [-906.718] -- 0:03:29
298500 -- (-922.130) (-903.496) (-914.624) [-913.055] * [-916.407] (-910.948) (-909.229) (-921.508) -- 0:03:29
299000 -- (-911.512) (-904.729) [-915.261] (-911.508) * (-919.535) [-907.541] (-907.660) (-905.141) -- 0:03:31
299500 -- [-899.645] (-911.563) (-914.479) (-918.492) * [-909.871] (-917.398) (-910.935) (-913.808) -- 0:03:30
300000 -- (-916.328) [-904.264] (-908.329) (-915.711) * (-910.543) (-910.434) (-918.566) [-909.874] -- 0:03:29
Average standard deviation of split frequencies: 0.020069
300500 -- (-912.003) (-908.907) [-912.266] (-925.668) * (-915.055) [-907.086] (-916.885) (-923.477) -- 0:03:29
301000 -- (-917.013) (-917.694) [-907.218] (-915.726) * (-918.686) (-907.166) [-901.853] (-904.927) -- 0:03:29
301500 -- (-918.204) [-912.671] (-909.092) (-915.855) * (-912.876) [-909.636] (-913.208) (-910.251) -- 0:03:28
302000 -- (-914.564) (-907.355) [-909.425] (-918.789) * (-927.622) [-909.399] (-909.428) (-906.923) -- 0:03:28
302500 -- (-905.441) (-913.703) [-904.725] (-909.965) * (-909.525) [-910.392] (-910.592) (-912.604) -- 0:03:29
303000 -- (-911.287) (-917.255) [-903.324] (-909.777) * (-911.310) (-913.494) [-915.008] (-906.198) -- 0:03:29
303500 -- [-909.836] (-922.738) (-907.526) (-912.834) * [-912.486] (-906.310) (-908.258) (-908.903) -- 0:03:28
304000 -- (-916.838) (-911.201) (-905.464) [-906.167] * (-921.402) [-916.022] (-910.238) (-910.643) -- 0:03:28
304500 -- (-904.391) [-905.157] (-909.426) (-908.346) * (-920.385) (-922.376) (-903.534) [-907.950] -- 0:03:27
305000 -- (-905.237) (-904.565) (-905.383) [-902.833] * (-916.069) (-915.464) (-914.481) [-908.218] -- 0:03:27
Average standard deviation of split frequencies: 0.020720
305500 -- [-903.952] (-906.076) (-907.907) (-909.264) * (-919.791) (-909.491) (-910.547) [-905.080] -- 0:03:26
306000 -- [-910.218] (-911.160) (-915.742) (-908.594) * (-916.484) [-905.943] (-909.557) (-905.200) -- 0:03:28
306500 -- (-908.140) (-913.167) [-903.725] (-908.433) * (-902.846) (-904.666) (-916.999) [-913.245] -- 0:03:28
307000 -- (-907.665) [-902.890] (-912.802) (-913.843) * (-911.202) [-905.502] (-916.153) (-908.007) -- 0:03:27
307500 -- (-912.572) [-910.015] (-913.670) (-910.456) * (-908.297) [-905.448] (-914.429) (-904.238) -- 0:03:27
308000 -- (-907.708) [-904.961] (-909.506) (-921.603) * [-902.024] (-916.106) (-909.267) (-924.031) -- 0:03:26
308500 -- (-902.545) (-912.397) [-904.497] (-911.974) * (-909.074) (-913.316) [-909.507] (-911.558) -- 0:03:26
309000 -- (-907.390) (-909.150) [-908.878] (-921.983) * (-910.641) (-909.509) [-906.278] (-910.432) -- 0:03:25
309500 -- [-906.050] (-911.326) (-907.995) (-922.550) * (-903.708) (-917.406) [-912.907] (-909.653) -- 0:03:27
310000 -- [-904.298] (-906.190) (-905.312) (-913.783) * [-908.272] (-913.992) (-902.796) (-903.158) -- 0:03:26
Average standard deviation of split frequencies: 0.020333
310500 -- (-906.103) [-910.864] (-909.213) (-924.380) * (-925.807) (-913.616) (-917.470) [-907.123] -- 0:03:26
311000 -- (-902.708) [-903.105] (-912.271) (-914.566) * (-924.522) [-915.335] (-924.616) (-904.265) -- 0:03:26
311500 -- [-905.802] (-917.282) (-909.805) (-914.181) * [-907.656] (-907.698) (-919.307) (-903.913) -- 0:03:25
312000 -- [-905.728] (-905.820) (-913.251) (-909.940) * [-909.031] (-905.827) (-909.455) (-906.349) -- 0:03:25
312500 -- (-905.777) (-916.050) (-920.962) [-910.465] * (-912.343) (-907.205) [-903.448] (-913.819) -- 0:03:26
313000 -- (-905.524) [-906.327] (-912.458) (-917.318) * (-914.769) (-907.574) [-906.940] (-912.294) -- 0:03:26
313500 -- (-911.110) (-909.613) (-918.576) [-900.850] * (-905.675) [-901.701] (-913.411) (-913.424) -- 0:03:25
314000 -- (-919.004) (-908.982) [-904.688] (-918.657) * (-910.035) (-916.793) (-909.587) [-911.130] -- 0:03:25
314500 -- (-912.977) (-909.925) [-901.372] (-906.707) * (-910.579) (-920.721) (-910.935) [-911.738] -- 0:03:24
315000 -- (-923.306) [-906.424] (-907.114) (-913.126) * (-903.853) (-906.426) [-899.787] (-911.018) -- 0:03:24
Average standard deviation of split frequencies: 0.019468
315500 -- (-915.132) [-906.244] (-912.878) (-911.707) * [-909.801] (-913.266) (-912.660) (-922.492) -- 0:03:23
316000 -- (-915.883) [-917.275] (-909.423) (-912.816) * (-924.015) (-912.048) [-904.659] (-913.944) -- 0:03:25
316500 -- (-908.780) (-909.871) (-915.158) [-909.018] * (-904.379) (-915.643) (-909.510) [-916.484] -- 0:03:25
317000 -- (-904.437) [-911.535] (-911.722) (-907.826) * (-911.704) [-904.689] (-909.321) (-908.963) -- 0:03:24
317500 -- [-906.032] (-918.661) (-920.125) (-919.435) * (-914.188) (-913.314) [-913.082] (-917.386) -- 0:03:24
318000 -- (-925.595) (-914.666) (-919.444) [-909.550] * (-912.718) (-907.319) (-899.512) [-905.974] -- 0:03:23
318500 -- (-906.418) (-911.135) (-913.461) [-906.561] * (-905.186) (-909.678) [-904.980] (-919.636) -- 0:03:23
319000 -- [-912.737] (-909.264) (-908.637) (-918.704) * (-906.026) (-907.715) [-917.413] (-913.379) -- 0:03:22
319500 -- (-908.423) (-922.710) [-909.250] (-907.002) * (-914.654) [-908.058] (-915.851) (-910.679) -- 0:03:24
320000 -- (-905.867) (-919.424) [-905.328] (-911.337) * [-907.893] (-908.672) (-909.987) (-911.626) -- 0:03:23
Average standard deviation of split frequencies: 0.018376
320500 -- [-911.190] (-923.454) (-901.451) (-909.605) * (-908.363) [-902.484] (-905.687) (-909.737) -- 0:03:23
321000 -- (-906.866) (-915.068) [-912.989] (-914.008) * (-911.731) [-901.557] (-917.431) (-905.033) -- 0:03:23
321500 -- (-906.318) (-913.196) (-922.915) [-903.165] * (-909.793) (-903.263) [-905.138] (-917.807) -- 0:03:22
322000 -- (-906.884) [-909.184] (-913.405) (-914.029) * (-910.087) (-904.470) [-906.531] (-908.872) -- 0:03:22
322500 -- (-922.694) (-905.994) [-900.520] (-920.413) * (-915.450) [-901.470] (-910.531) (-907.064) -- 0:03:21
323000 -- (-921.994) (-907.448) [-904.346] (-909.189) * (-902.115) [-901.240] (-905.888) (-912.600) -- 0:03:23
323500 -- (-913.610) (-921.151) (-905.868) [-907.501] * (-910.486) (-914.619) (-910.163) [-902.043] -- 0:03:22
324000 -- (-913.629) (-921.829) [-901.172] (-903.734) * (-918.214) (-909.944) [-907.317] (-908.253) -- 0:03:22
324500 -- (-924.644) (-911.782) [-902.080] (-910.587) * (-923.925) (-913.979) (-904.246) [-910.102] -- 0:03:21
325000 -- (-914.070) (-909.640) [-908.043] (-911.427) * (-912.275) [-910.840] (-908.173) (-916.005) -- 0:03:21
Average standard deviation of split frequencies: 0.018798
325500 -- (-908.926) [-907.139] (-907.010) (-918.409) * (-920.359) (-918.656) (-918.579) [-912.566] -- 0:03:21
326000 -- (-917.040) (-907.776) (-907.872) [-916.555] * (-913.393) (-915.259) [-905.721] (-909.935) -- 0:03:20
326500 -- (-906.461) (-912.546) (-911.885) [-906.129] * (-913.799) (-910.305) (-904.859) [-903.172] -- 0:03:22
327000 -- (-919.804) [-907.031] (-908.798) (-916.652) * (-918.779) (-911.073) [-908.869] (-920.454) -- 0:03:21
327500 -- [-908.789] (-921.168) (-909.196) (-921.863) * (-914.918) (-906.396) [-912.735] (-911.327) -- 0:03:21
328000 -- (-908.020) (-907.901) [-905.946] (-916.039) * (-908.394) (-909.767) [-909.684] (-913.818) -- 0:03:20
328500 -- [-907.939] (-914.053) (-903.130) (-909.402) * (-911.878) (-908.517) (-909.111) [-913.600] -- 0:03:20
329000 -- (-919.239) [-911.151] (-904.029) (-915.590) * (-909.000) [-902.712] (-914.397) (-906.696) -- 0:03:19
329500 -- (-916.880) (-902.167) [-904.059] (-914.293) * (-906.561) (-911.222) [-904.157] (-904.154) -- 0:03:21
330000 -- [-908.897] (-918.048) (-913.746) (-911.930) * (-920.452) (-905.905) (-916.875) [-913.212] -- 0:03:20
Average standard deviation of split frequencies: 0.017963
330500 -- (-905.177) (-913.110) [-914.772] (-916.098) * [-914.284] (-908.513) (-911.835) (-916.021) -- 0:03:20
331000 -- [-910.411] (-922.780) (-911.435) (-905.001) * (-922.686) (-913.139) (-907.462) [-906.753] -- 0:03:20
331500 -- [-910.574] (-920.633) (-915.112) (-908.627) * [-906.682] (-908.477) (-903.161) (-909.918) -- 0:03:19
332000 -- (-919.677) (-914.494) (-916.830) [-906.339] * (-913.093) (-910.732) (-910.507) [-906.067] -- 0:03:19
332500 -- (-911.808) [-912.045] (-911.929) (-906.463) * [-909.422] (-910.032) (-910.211) (-920.484) -- 0:03:18
333000 -- (-909.185) [-897.931] (-912.771) (-920.702) * (-912.414) (-911.675) (-903.563) [-911.780] -- 0:03:20
333500 -- [-904.907] (-909.825) (-919.689) (-909.623) * (-913.097) (-927.700) [-911.061] (-905.078) -- 0:03:19
334000 -- [-905.510] (-906.370) (-914.255) (-911.192) * (-915.718) [-910.796] (-916.073) (-905.128) -- 0:03:19
334500 -- [-913.088] (-911.888) (-913.498) (-914.061) * [-903.553] (-915.882) (-908.089) (-903.784) -- 0:03:18
335000 -- (-913.373) (-910.830) [-906.652] (-913.522) * (-911.659) [-912.763] (-909.419) (-933.213) -- 0:03:18
Average standard deviation of split frequencies: 0.017818
335500 -- (-910.092) (-917.073) [-914.021] (-916.447) * (-904.959) (-924.766) [-901.535] (-915.738) -- 0:03:18
336000 -- (-906.735) (-910.348) (-909.183) [-909.917] * (-902.503) (-910.914) [-905.918] (-917.404) -- 0:03:17
336500 -- [-916.694] (-905.048) (-908.589) (-919.829) * (-913.894) (-913.130) [-902.463] (-918.853) -- 0:03:19
337000 -- (-926.576) [-908.027] (-911.394) (-909.877) * (-907.310) (-914.819) [-905.998] (-915.782) -- 0:03:18
337500 -- [-906.425] (-911.599) (-914.172) (-903.894) * (-908.739) (-911.215) [-902.379] (-917.709) -- 0:03:18
338000 -- (-906.527) (-907.572) [-905.749] (-908.426) * (-914.713) (-901.241) [-905.868] (-922.215) -- 0:03:17
338500 -- (-910.493) (-910.599) [-900.878] (-910.187) * [-911.547] (-921.801) (-908.859) (-902.992) -- 0:03:17
339000 -- (-918.112) (-918.196) [-908.949] (-903.672) * [-907.980] (-908.375) (-916.717) (-906.818) -- 0:03:16
339500 -- (-910.843) (-911.166) [-910.538] (-913.119) * (-912.652) (-918.199) [-910.687] (-914.632) -- 0:03:16
340000 -- (-913.475) (-922.079) [-905.060] (-912.294) * (-915.763) (-908.510) (-915.272) [-906.986] -- 0:03:17
Average standard deviation of split frequencies: 0.017574
340500 -- (-906.410) (-913.083) (-909.980) [-909.612] * (-919.903) (-908.929) (-908.163) [-916.366] -- 0:03:17
341000 -- (-901.916) (-910.441) (-911.959) [-907.656] * (-913.536) [-907.657] (-918.457) (-909.367) -- 0:03:17
341500 -- (-911.264) [-902.086] (-914.421) (-917.151) * (-915.840) (-899.283) (-910.331) [-907.749] -- 0:03:16
342000 -- (-918.441) [-909.944] (-905.994) (-918.607) * (-913.850) (-911.790) (-914.430) [-912.915] -- 0:03:16
342500 -- (-915.008) (-916.441) [-901.572] (-903.217) * (-917.702) (-910.669) (-916.365) [-906.894] -- 0:03:15
343000 -- (-923.579) (-906.952) [-911.672] (-904.058) * (-920.098) (-911.050) (-916.648) [-904.915] -- 0:03:15
343500 -- (-915.297) (-919.041) (-903.463) [-916.435] * (-911.944) [-905.064] (-931.258) (-907.992) -- 0:03:16
344000 -- (-915.860) (-918.901) [-906.486] (-914.931) * [-906.642] (-905.026) (-930.121) (-921.026) -- 0:03:16
344500 -- (-919.233) [-913.806] (-914.562) (-925.498) * (-915.321) (-908.100) (-916.747) [-922.631] -- 0:03:15
345000 -- (-908.972) [-907.875] (-912.256) (-920.555) * (-910.181) (-914.814) (-918.407) [-903.707] -- 0:03:15
Average standard deviation of split frequencies: 0.016486
345500 -- (-910.526) (-911.134) [-907.804] (-903.942) * (-918.951) (-911.977) (-917.179) [-910.227] -- 0:03:15
346000 -- (-916.283) (-910.473) [-909.610] (-909.558) * (-911.484) (-922.344) (-915.743) [-905.123] -- 0:03:14
346500 -- (-916.618) [-902.845] (-907.829) (-910.787) * [-905.913] (-905.474) (-910.874) (-909.447) -- 0:03:14
347000 -- (-926.292) [-907.526] (-910.217) (-909.751) * (-907.390) (-910.870) [-907.611] (-920.134) -- 0:03:15
347500 -- (-921.117) [-899.368] (-903.279) (-922.647) * [-916.656] (-907.832) (-915.178) (-908.718) -- 0:03:15
348000 -- (-904.330) (-907.026) [-904.349] (-910.614) * (-918.731) [-912.847] (-916.454) (-914.570) -- 0:03:14
348500 -- [-909.778] (-923.222) (-907.551) (-908.025) * [-903.795] (-907.289) (-920.773) (-921.769) -- 0:03:14
349000 -- (-912.389) (-910.098) [-907.735] (-906.088) * (-916.617) (-906.934) [-907.336] (-911.583) -- 0:03:13
349500 -- (-914.521) [-912.734] (-909.117) (-904.854) * [-906.965] (-910.948) (-917.219) (-907.144) -- 0:03:13
350000 -- (-910.220) (-911.406) (-903.958) [-911.700] * [-904.793] (-926.952) (-923.747) (-910.454) -- 0:03:14
Average standard deviation of split frequencies: 0.017274
350500 -- [-910.655] (-912.638) (-914.516) (-907.192) * (-902.371) (-917.944) (-905.658) [-906.361] -- 0:03:14
351000 -- [-905.718] (-917.382) (-916.974) (-910.822) * (-906.882) (-917.242) (-914.444) [-909.625] -- 0:03:14
351500 -- [-910.871] (-909.830) (-923.873) (-906.335) * [-902.077] (-921.475) (-914.708) (-905.083) -- 0:03:13
352000 -- [-909.478] (-911.861) (-927.313) (-908.808) * (-906.290) (-910.150) [-912.922] (-909.856) -- 0:03:13
352500 -- (-920.398) (-908.285) [-907.274] (-906.598) * (-913.276) (-907.190) (-917.409) [-910.325] -- 0:03:12
353000 -- [-918.436] (-911.749) (-906.602) (-904.427) * (-914.799) (-910.929) (-914.798) [-910.194] -- 0:03:12
353500 -- (-909.788) (-914.027) [-910.967] (-911.902) * (-909.459) (-913.309) (-914.745) [-911.028] -- 0:03:13
354000 -- (-926.092) [-905.803] (-912.490) (-914.412) * (-902.341) [-908.292] (-906.811) (-911.377) -- 0:03:13
354500 -- (-911.486) (-919.367) (-907.940) [-909.916] * (-906.609) (-907.106) [-906.738] (-919.231) -- 0:03:13
355000 -- (-909.136) [-913.384] (-922.011) (-916.528) * [-902.381] (-938.511) (-906.569) (-910.037) -- 0:03:12
Average standard deviation of split frequencies: 0.017611
355500 -- (-911.873) (-904.406) (-914.132) [-911.817] * (-923.033) [-909.308] (-918.094) (-920.817) -- 0:03:12
356000 -- (-919.989) (-911.753) [-904.789] (-926.145) * [-910.470] (-917.220) (-906.744) (-920.796) -- 0:03:11
356500 -- (-916.511) (-911.365) [-903.976] (-923.834) * [-912.944] (-913.060) (-919.042) (-910.939) -- 0:03:11
357000 -- (-907.906) (-911.654) (-908.552) [-914.548] * [-914.210] (-916.397) (-912.581) (-919.813) -- 0:03:12
357500 -- (-912.191) [-909.170] (-908.427) (-912.355) * [-914.397] (-904.860) (-918.901) (-921.120) -- 0:03:12
358000 -- [-910.236] (-907.592) (-916.549) (-917.823) * [-901.648] (-915.003) (-916.896) (-913.008) -- 0:03:11
358500 -- (-911.636) (-923.130) (-915.548) [-918.753] * [-908.846] (-926.424) (-918.438) (-910.070) -- 0:03:11
359000 -- (-913.978) (-909.012) [-910.192] (-921.527) * (-913.877) (-912.505) [-906.783] (-918.791) -- 0:03:11
359500 -- (-917.336) (-920.937) (-909.888) [-917.431] * [-911.335] (-909.233) (-905.160) (-914.613) -- 0:03:10
360000 -- (-908.262) (-917.969) [-906.818] (-904.542) * (-921.173) (-909.479) (-915.263) [-909.734] -- 0:03:10
Average standard deviation of split frequencies: 0.018625
360500 -- [-910.986] (-908.945) (-915.784) (-916.152) * [-909.838] (-908.149) (-912.970) (-910.395) -- 0:03:11
361000 -- (-907.421) (-910.134) [-905.821] (-911.172) * [-910.589] (-911.870) (-915.418) (-911.814) -- 0:03:11
361500 -- [-906.338] (-920.278) (-904.082) (-903.389) * (-917.648) (-915.233) (-911.439) [-905.117] -- 0:03:10
362000 -- (-905.996) (-907.035) [-907.582] (-919.363) * (-914.049) [-913.771] (-920.490) (-916.979) -- 0:03:10
362500 -- (-901.746) (-915.714) (-910.274) [-908.052] * (-912.538) (-906.820) (-913.217) [-911.927] -- 0:03:09
363000 -- [-910.599] (-925.733) (-911.133) (-912.267) * (-921.625) (-910.800) (-906.490) [-909.348] -- 0:03:09
363500 -- (-907.009) (-915.946) (-907.341) [-903.738] * [-911.169] (-912.774) (-917.912) (-910.864) -- 0:03:10
364000 -- (-914.747) (-909.751) (-911.552) [-905.865] * (-911.928) (-912.387) (-919.266) [-910.127] -- 0:03:10
364500 -- [-908.225] (-914.850) (-904.777) (-915.158) * [-901.912] (-917.601) (-911.381) (-913.596) -- 0:03:10
365000 -- (-916.829) (-920.180) [-907.116] (-911.923) * (-915.487) (-918.974) [-915.056] (-917.594) -- 0:03:09
Average standard deviation of split frequencies: 0.018676
365500 -- (-913.162) [-905.303] (-914.651) (-915.636) * (-908.474) [-916.373] (-922.573) (-910.937) -- 0:03:09
366000 -- (-909.976) (-908.322) (-912.969) [-904.899] * (-919.151) [-912.279] (-924.466) (-915.487) -- 0:03:08
366500 -- [-906.932] (-915.836) (-916.515) (-912.366) * [-909.229] (-919.098) (-911.217) (-911.080) -- 0:03:08
367000 -- (-915.907) [-913.318] (-925.287) (-907.399) * (-903.831) (-918.720) (-911.340) [-902.072] -- 0:03:09
367500 -- (-916.555) (-905.460) (-911.851) [-915.435] * (-915.049) [-907.706] (-905.507) (-916.632) -- 0:03:09
368000 -- (-918.968) (-913.083) (-913.273) [-910.135] * [-908.254] (-917.203) (-919.203) (-907.112) -- 0:03:08
368500 -- (-913.708) [-906.601] (-916.234) (-907.817) * (-907.029) (-912.422) (-908.074) [-904.611] -- 0:03:08
369000 -- (-910.321) (-919.534) [-916.105] (-905.983) * (-904.469) (-913.708) [-901.381] (-905.957) -- 0:03:08
369500 -- (-916.499) (-920.440) (-908.194) [-900.840] * [-906.313] (-910.803) (-913.363) (-913.820) -- 0:03:07
370000 -- (-907.000) (-912.516) [-905.057] (-916.153) * (-910.203) [-909.722] (-900.168) (-912.396) -- 0:03:07
Average standard deviation of split frequencies: 0.019267
370500 -- (-915.354) (-912.282) (-914.633) [-903.893] * (-927.212) (-918.096) [-908.081] (-910.747) -- 0:03:08
371000 -- (-906.967) (-907.618) (-914.558) [-907.129] * [-899.928] (-923.669) (-913.358) (-909.256) -- 0:03:08
371500 -- (-916.592) [-905.863] (-912.737) (-900.179) * (-908.225) (-914.827) (-904.585) [-913.081] -- 0:03:07
372000 -- (-910.096) (-920.501) [-908.923] (-914.747) * (-906.620) (-905.221) [-906.903] (-909.572) -- 0:03:07
372500 -- (-913.219) (-915.519) [-914.393] (-912.737) * (-908.007) (-907.824) (-921.588) [-907.611] -- 0:03:06
373000 -- (-911.170) [-906.261] (-908.039) (-906.569) * [-905.149] (-907.265) (-912.655) (-917.577) -- 0:03:06
373500 -- (-915.949) [-910.103] (-916.325) (-904.742) * (-909.065) [-903.243] (-904.606) (-913.384) -- 0:03:06
374000 -- (-908.231) (-910.992) [-911.060] (-915.077) * (-915.060) (-911.577) [-907.668] (-911.696) -- 0:03:07
374500 -- (-913.477) [-900.868] (-918.952) (-917.159) * (-910.262) (-909.325) [-908.218] (-913.191) -- 0:03:07
375000 -- (-908.780) (-912.255) [-916.796] (-903.657) * (-909.392) (-918.990) [-908.828] (-917.131) -- 0:03:06
Average standard deviation of split frequencies: 0.018618
375500 -- (-905.244) [-905.886] (-918.564) (-908.378) * (-915.778) (-909.836) (-906.973) [-919.392] -- 0:03:06
376000 -- [-913.413] (-904.523) (-911.599) (-910.778) * (-916.081) [-905.381] (-910.063) (-909.053) -- 0:03:05
376500 -- [-905.362] (-917.300) (-912.685) (-913.659) * (-913.148) (-908.692) [-903.074] (-911.140) -- 0:03:05
377000 -- [-911.414] (-905.648) (-916.775) (-919.797) * (-908.954) (-911.560) (-906.344) [-906.623] -- 0:03:05
377500 -- (-904.424) (-912.170) (-918.102) [-912.571] * [-911.561] (-917.435) (-911.410) (-910.214) -- 0:03:06
378000 -- (-922.491) [-906.250] (-912.887) (-919.100) * (-919.980) (-909.591) [-908.169] (-911.770) -- 0:03:05
378500 -- (-909.904) (-912.806) [-905.726] (-914.849) * (-916.191) (-911.927) (-905.497) [-908.553] -- 0:03:05
379000 -- [-906.900] (-920.018) (-912.605) (-910.883) * (-910.857) (-924.251) (-903.822) [-903.276] -- 0:03:05
379500 -- (-910.391) (-914.502) [-906.610] (-920.682) * (-911.997) (-906.362) (-916.878) [-905.864] -- 0:03:04
380000 -- (-909.207) (-909.540) [-906.016] (-925.829) * (-911.686) (-909.560) [-911.748] (-903.633) -- 0:03:04
Average standard deviation of split frequencies: 0.017771
380500 -- [-908.371] (-910.829) (-907.563) (-913.439) * (-903.874) [-906.015] (-923.128) (-912.684) -- 0:03:05
381000 -- [-901.284] (-916.727) (-915.464) (-916.191) * (-907.432) (-915.337) [-910.070] (-904.329) -- 0:03:05
381500 -- (-909.063) [-911.616] (-916.410) (-911.725) * [-918.254] (-920.452) (-912.445) (-912.277) -- 0:03:04
382000 -- (-917.494) (-907.242) [-917.938] (-912.944) * [-907.618] (-905.623) (-907.610) (-902.936) -- 0:03:04
382500 -- [-907.614] (-906.711) (-915.156) (-912.020) * (-903.150) (-911.417) [-908.364] (-905.102) -- 0:03:04
383000 -- [-905.416] (-912.400) (-917.286) (-906.552) * (-905.760) (-918.772) [-907.963] (-916.290) -- 0:03:03
383500 -- (-909.102) [-906.017] (-911.740) (-929.474) * (-915.227) (-919.373) [-908.991] (-910.622) -- 0:03:03
384000 -- [-913.112] (-914.685) (-912.472) (-915.935) * (-909.523) (-916.574) [-911.700] (-904.852) -- 0:03:04
384500 -- (-906.915) (-923.580) [-900.569] (-915.918) * (-917.041) [-911.298] (-915.967) (-912.360) -- 0:03:04
385000 -- [-906.701] (-929.101) (-906.133) (-922.956) * (-907.699) [-909.976] (-908.369) (-905.503) -- 0:03:03
Average standard deviation of split frequencies: 0.017647
385500 -- (-907.111) (-911.368) [-903.447] (-908.871) * (-920.912) (-919.509) (-906.908) [-905.929] -- 0:03:03
386000 -- (-914.286) (-907.062) (-912.441) [-909.789] * (-912.668) (-932.963) (-908.982) [-903.802] -- 0:03:02
386500 -- [-905.883] (-915.723) (-918.387) (-922.748) * (-906.957) (-917.629) [-912.863] (-919.983) -- 0:03:02
387000 -- [-907.343] (-907.743) (-912.735) (-903.625) * (-907.064) (-913.333) [-914.823] (-905.279) -- 0:03:02
387500 -- (-918.690) [-907.432] (-913.401) (-906.285) * [-916.736] (-919.845) (-925.051) (-907.270) -- 0:03:03
388000 -- (-916.310) (-908.744) [-918.420] (-910.686) * (-906.673) (-916.028) (-917.046) [-903.429] -- 0:03:02
388500 -- (-916.268) [-903.816] (-919.965) (-913.949) * [-907.911] (-922.416) (-911.837) (-915.912) -- 0:03:02
389000 -- (-919.392) [-904.987] (-907.002) (-912.990) * [-907.740] (-914.066) (-914.058) (-912.991) -- 0:03:02
389500 -- (-911.851) [-911.874] (-909.112) (-919.540) * [-912.925] (-909.566) (-921.353) (-919.540) -- 0:03:01
390000 -- (-906.619) (-913.747) (-910.353) [-904.272] * (-917.739) (-923.472) [-906.159] (-909.724) -- 0:03:01
Average standard deviation of split frequencies: 0.017195
390500 -- (-916.259) (-904.631) (-919.412) [-908.477] * (-905.700) (-915.797) [-913.705] (-918.433) -- 0:03:01
391000 -- (-914.119) (-915.318) (-910.658) [-905.631] * [-906.062] (-909.108) (-911.947) (-917.040) -- 0:03:02
391500 -- (-915.595) (-906.784) (-908.806) [-919.087] * (-907.394) (-912.952) (-910.418) [-908.347] -- 0:03:01
392000 -- (-915.626) [-911.136] (-906.916) (-912.778) * (-906.435) (-903.857) [-910.450] (-915.448) -- 0:03:01
392500 -- (-910.934) (-917.545) [-910.192] (-909.330) * [-909.259] (-904.781) (-916.344) (-908.095) -- 0:03:01
393000 -- (-909.862) [-909.955] (-915.905) (-904.732) * (-913.567) (-908.014) [-910.636] (-911.765) -- 0:03:00
393500 -- (-904.849) [-917.565] (-916.332) (-905.580) * [-909.532] (-913.211) (-920.544) (-912.191) -- 0:03:00
394000 -- (-903.253) (-916.205) [-915.826] (-906.239) * (-912.499) (-918.472) [-904.024] (-908.409) -- 0:02:59
394500 -- (-908.673) [-909.443] (-914.051) (-912.748) * (-908.808) [-908.148] (-916.215) (-927.749) -- 0:03:01
395000 -- [-915.956] (-907.358) (-914.295) (-914.901) * [-905.560] (-914.148) (-912.729) (-920.562) -- 0:03:00
Average standard deviation of split frequencies: 0.018035
395500 -- (-931.019) [-896.444] (-914.778) (-904.395) * (-912.434) [-908.481] (-910.025) (-908.783) -- 0:03:00
396000 -- (-916.497) (-907.264) [-906.483] (-915.741) * (-907.449) [-903.478] (-910.702) (-914.160) -- 0:02:59
396500 -- (-904.589) (-901.656) (-909.888) [-904.958] * [-907.836] (-920.056) (-910.450) (-913.870) -- 0:02:59
397000 -- (-911.890) [-904.809] (-932.418) (-903.284) * (-910.981) [-912.718] (-905.149) (-916.805) -- 0:02:59
397500 -- (-922.925) [-906.621] (-907.185) (-910.379) * (-907.722) (-913.882) [-916.660] (-912.084) -- 0:03:00
398000 -- (-909.860) [-904.113] (-910.764) (-914.570) * (-919.503) [-911.219] (-906.200) (-908.590) -- 0:02:59
398500 -- (-916.495) [-902.003] (-923.922) (-918.667) * [-911.203] (-912.078) (-912.320) (-909.754) -- 0:02:59
399000 -- (-917.351) [-903.232] (-922.332) (-923.682) * [-912.728] (-917.410) (-908.627) (-913.590) -- 0:02:59
399500 -- (-902.972) (-913.239) (-920.221) [-905.239] * (-925.441) (-910.196) [-914.376] (-902.678) -- 0:02:58
400000 -- [-907.132] (-916.694) (-920.283) (-904.969) * (-912.538) (-910.810) (-913.258) [-907.916] -- 0:02:58
Average standard deviation of split frequencies: 0.017413
400500 -- [-911.622] (-916.071) (-936.146) (-901.962) * (-918.417) (-915.537) [-910.371] (-913.431) -- 0:02:58
401000 -- (-903.246) (-917.335) [-905.401] (-900.917) * [-912.049] (-918.160) (-919.800) (-918.297) -- 0:02:59
401500 -- [-903.622] (-911.682) (-907.797) (-912.403) * (-909.690) (-912.106) [-906.078] (-916.282) -- 0:02:58
402000 -- (-907.140) (-917.906) [-909.442] (-915.724) * (-911.348) (-921.719) (-906.567) [-907.526] -- 0:02:58
402500 -- [-904.264] (-905.904) (-907.852) (-919.024) * [-902.683] (-905.314) (-914.412) (-904.071) -- 0:02:58
403000 -- [-907.104] (-906.575) (-905.976) (-913.416) * [-906.658] (-914.587) (-912.739) (-911.419) -- 0:02:57
403500 -- (-912.369) (-909.154) (-913.046) [-902.545] * [-904.800] (-926.759) (-906.716) (-916.426) -- 0:02:57
404000 -- (-915.393) (-908.232) (-906.285) [-905.353] * [-908.585] (-915.808) (-917.741) (-918.565) -- 0:02:57
404500 -- [-910.423] (-909.452) (-922.508) (-906.176) * (-918.559) (-905.583) [-911.103] (-912.975) -- 0:02:58
405000 -- [-910.451] (-907.009) (-911.739) (-920.698) * (-925.429) (-912.424) [-900.478] (-903.127) -- 0:02:57
Average standard deviation of split frequencies: 0.017358
405500 -- (-914.572) [-903.367] (-917.806) (-918.794) * (-905.081) (-922.847) [-907.477] (-904.889) -- 0:02:57
406000 -- (-913.367) (-901.017) [-902.264] (-912.153) * (-916.651) (-921.553) [-915.647] (-915.860) -- 0:02:57
406500 -- (-910.767) (-904.874) [-909.895] (-914.430) * [-908.978] (-909.031) (-909.870) (-908.703) -- 0:02:56
407000 -- (-916.591) (-907.838) [-910.825] (-923.835) * (-914.854) [-905.903] (-912.580) (-913.878) -- 0:02:56
407500 -- (-919.811) (-907.022) [-909.220] (-910.297) * (-919.077) (-910.937) (-918.819) [-913.928] -- 0:02:55
408000 -- (-912.992) (-910.996) [-905.941] (-900.178) * (-910.131) (-912.883) [-909.756] (-917.847) -- 0:02:57
408500 -- (-911.740) (-915.630) (-904.220) [-908.364] * (-917.450) [-906.163] (-913.311) (-909.980) -- 0:02:56
409000 -- (-913.525) (-920.919) [-920.262] (-902.920) * [-904.235] (-909.420) (-908.905) (-914.139) -- 0:02:56
409500 -- (-907.935) (-913.273) (-914.115) [-901.677] * (-919.135) (-906.619) [-918.974] (-911.935) -- 0:02:55
410000 -- (-911.768) (-911.472) (-909.238) [-916.582] * (-918.505) (-918.903) (-922.920) [-914.920] -- 0:02:55
Average standard deviation of split frequencies: 0.017965
410500 -- [-902.876] (-904.132) (-911.871) (-905.554) * (-903.406) (-904.629) [-913.706] (-911.553) -- 0:02:55
411000 -- [-900.970] (-916.966) (-907.986) (-911.103) * (-912.432) (-904.981) (-919.139) [-913.246] -- 0:02:54
411500 -- (-900.185) [-897.312] (-917.479) (-906.755) * (-912.420) [-905.173] (-915.745) (-914.956) -- 0:02:55
412000 -- (-907.406) [-905.518] (-910.947) (-910.398) * (-906.092) [-915.136] (-913.150) (-917.463) -- 0:02:55
412500 -- (-910.635) [-907.956] (-921.425) (-909.412) * (-914.301) [-911.546] (-910.462) (-911.489) -- 0:02:55
413000 -- (-903.776) [-902.536] (-908.509) (-913.996) * (-913.105) (-908.583) [-903.680] (-904.792) -- 0:02:54
413500 -- (-908.857) [-912.430] (-907.308) (-909.611) * (-909.566) (-911.690) [-901.512] (-909.348) -- 0:02:54
414000 -- (-918.847) (-902.812) (-914.004) [-902.148] * (-906.082) (-914.639) (-907.699) [-915.675] -- 0:02:54
414500 -- (-911.973) (-906.082) (-907.941) [-898.489] * (-918.391) (-901.477) [-901.659] (-907.697) -- 0:02:55
415000 -- (-913.118) (-906.698) (-909.591) [-904.650] * (-907.262) [-911.682] (-914.190) (-907.537) -- 0:02:54
Average standard deviation of split frequencies: 0.017168
415500 -- (-916.832) [-913.856] (-909.126) (-917.379) * [-901.856] (-909.603) (-913.375) (-908.511) -- 0:02:54
416000 -- (-914.259) (-917.387) (-909.548) [-904.058] * (-901.758) (-908.959) [-905.312] (-920.585) -- 0:02:54
416500 -- (-910.833) (-906.889) (-908.715) [-907.114] * [-914.535] (-911.057) (-904.149) (-905.650) -- 0:02:53
417000 -- (-911.990) [-903.367] (-906.374) (-913.495) * (-915.669) (-908.837) (-909.069) [-901.714] -- 0:02:53
417500 -- [-904.585] (-912.827) (-908.632) (-915.744) * (-919.192) (-908.907) (-908.066) [-906.556] -- 0:02:53
418000 -- (-906.123) (-907.148) [-913.433] (-912.552) * (-920.794) (-906.646) [-909.780] (-911.324) -- 0:02:54
418500 -- [-905.343] (-913.711) (-901.701) (-915.755) * (-909.089) (-910.203) (-917.929) [-908.205] -- 0:02:53
419000 -- (-907.355) (-921.775) [-903.121] (-912.807) * (-912.409) (-908.380) (-909.150) [-904.219] -- 0:02:53
419500 -- (-909.816) [-906.892] (-916.716) (-913.235) * (-907.337) (-912.979) (-913.849) [-902.418] -- 0:02:52
420000 -- [-903.587] (-910.140) (-914.919) (-912.627) * (-914.022) [-905.546] (-904.355) (-906.667) -- 0:02:52
Average standard deviation of split frequencies: 0.016529
420500 -- (-908.980) (-919.191) [-907.953] (-916.809) * (-902.282) [-908.753] (-914.519) (-922.565) -- 0:02:52
421000 -- (-908.407) [-909.927] (-914.786) (-898.447) * [-899.939] (-917.642) (-912.046) (-905.268) -- 0:02:51
421500 -- [-901.375] (-914.395) (-913.338) (-910.822) * (-912.757) (-910.181) [-907.649] (-903.617) -- 0:02:52
422000 -- (-921.069) [-904.121] (-914.445) (-925.031) * (-914.745) [-906.638] (-917.658) (-914.418) -- 0:02:52
422500 -- [-904.410] (-910.424) (-913.654) (-909.479) * (-923.288) (-902.753) (-919.744) [-909.870] -- 0:02:52
423000 -- (-910.874) (-904.301) (-912.641) [-906.633] * (-914.304) (-909.966) [-911.809] (-930.359) -- 0:02:51
423500 -- (-912.103) [-908.410] (-913.950) (-909.950) * (-903.411) (-908.745) [-906.830] (-910.580) -- 0:02:51
424000 -- (-924.531) (-917.615) (-908.381) [-911.687] * (-914.257) (-915.067) [-909.483] (-917.544) -- 0:02:51
424500 -- (-917.994) (-916.028) (-910.415) [-915.135] * (-903.451) (-913.719) [-905.388] (-907.264) -- 0:02:50
425000 -- (-923.341) (-916.866) (-915.032) [-906.813] * [-902.751] (-903.489) (-905.716) (-913.927) -- 0:02:51
Average standard deviation of split frequencies: 0.016045
425500 -- (-913.634) (-906.249) (-922.032) [-905.952] * (-912.811) (-913.646) [-905.101] (-925.453) -- 0:02:51
426000 -- (-912.803) [-909.919] (-923.580) (-909.388) * [-908.188] (-908.310) (-912.038) (-914.501) -- 0:02:51
426500 -- (-907.962) [-904.587] (-911.676) (-914.674) * (-902.288) [-905.957] (-912.810) (-916.328) -- 0:02:50
427000 -- (-908.759) [-904.104] (-912.819) (-907.291) * [-915.845] (-913.105) (-914.116) (-922.979) -- 0:02:50
427500 -- (-906.800) [-904.139] (-912.665) (-919.378) * (-919.412) (-907.662) [-902.187] (-922.309) -- 0:02:50
428000 -- (-922.988) [-905.220] (-911.858) (-917.390) * (-915.254) (-918.481) (-915.725) [-916.187] -- 0:02:49
428500 -- (-914.328) (-906.855) [-902.872] (-911.173) * (-916.582) (-907.272) [-911.131] (-905.657) -- 0:02:50
429000 -- [-910.521] (-906.952) (-902.359) (-908.985) * (-909.914) (-915.698) [-914.430] (-917.325) -- 0:02:50
429500 -- [-911.166] (-919.451) (-916.195) (-905.969) * [-907.949] (-908.199) (-912.029) (-907.018) -- 0:02:50
430000 -- (-910.995) (-918.009) (-906.101) [-906.744] * (-916.707) (-902.906) [-904.215] (-903.260) -- 0:02:49
Average standard deviation of split frequencies: 0.015543
430500 -- (-917.194) (-908.975) (-920.322) [-910.181] * [-906.043] (-905.636) (-911.003) (-908.036) -- 0:02:49
431000 -- [-912.900] (-914.062) (-912.613) (-904.625) * (-910.314) (-907.247) [-904.808] (-912.235) -- 0:02:48
431500 -- (-931.318) [-903.291] (-913.523) (-910.024) * [-911.886] (-904.938) (-908.332) (-908.431) -- 0:02:49
432000 -- (-915.152) (-912.638) [-897.660] (-908.880) * (-906.362) [-910.980] (-907.073) (-910.061) -- 0:02:49
432500 -- (-911.778) (-912.115) [-905.084] (-914.287) * (-915.614) (-911.696) [-911.489] (-910.281) -- 0:02:49
433000 -- (-906.539) [-917.387] (-911.778) (-904.993) * (-920.036) (-908.799) (-907.688) [-914.771] -- 0:02:48
433500 -- (-926.107) (-916.309) (-909.833) [-911.442] * (-915.829) (-905.722) (-911.955) [-913.407] -- 0:02:48
434000 -- (-912.092) (-918.233) (-916.229) [-899.921] * (-909.867) (-911.410) (-912.941) [-924.673] -- 0:02:48
434500 -- (-905.475) (-909.902) (-906.394) [-906.499] * [-909.245] (-912.298) (-904.912) (-919.745) -- 0:02:47
435000 -- (-904.052) [-917.703] (-918.121) (-904.024) * [-904.652] (-915.322) (-911.667) (-909.770) -- 0:02:48
Average standard deviation of split frequencies: 0.014758
435500 -- (-921.290) (-909.109) (-910.304) [-902.511] * [-910.666] (-920.324) (-916.726) (-911.507) -- 0:02:48
436000 -- (-913.866) [-908.968] (-910.779) (-902.255) * (-910.622) (-914.627) [-907.405] (-916.485) -- 0:02:48
436500 -- (-907.729) [-901.323] (-901.832) (-912.686) * (-905.048) (-921.017) (-918.983) [-902.902] -- 0:02:47
437000 -- (-911.700) [-904.202] (-908.799) (-914.296) * (-903.666) (-913.980) (-908.909) [-903.587] -- 0:02:47
437500 -- [-903.862] (-910.816) (-904.004) (-911.305) * (-916.885) [-911.483] (-912.080) (-905.398) -- 0:02:47
438000 -- (-903.395) [-909.975] (-910.395) (-913.350) * (-912.002) (-907.726) [-903.391] (-910.422) -- 0:02:46
438500 -- (-908.274) (-915.496) (-911.110) [-907.159] * (-911.200) (-915.063) [-901.959] (-909.832) -- 0:02:47
439000 -- (-907.657) (-901.680) (-907.321) [-905.657] * (-907.758) (-927.709) [-903.328] (-915.315) -- 0:02:47
439500 -- (-908.715) (-904.984) [-912.462] (-909.488) * (-912.032) (-921.449) (-915.268) [-910.353] -- 0:02:47
440000 -- [-905.244] (-912.453) (-925.643) (-917.434) * (-910.341) (-919.484) [-911.623] (-911.703) -- 0:02:46
Average standard deviation of split frequencies: 0.015565
440500 -- [-906.487] (-909.927) (-922.398) (-911.669) * [-902.596] (-918.376) (-907.400) (-906.631) -- 0:02:46
441000 -- [-912.414] (-916.918) (-923.116) (-911.981) * [-907.799] (-924.499) (-904.005) (-911.486) -- 0:02:46
441500 -- (-922.123) (-919.594) (-902.324) [-909.277] * (-903.101) (-910.550) [-905.090] (-919.681) -- 0:02:45
442000 -- [-911.948] (-911.887) (-921.575) (-922.823) * (-917.704) (-905.113) (-905.693) [-909.468] -- 0:02:46
442500 -- (-908.356) (-913.013) [-903.481] (-916.041) * (-908.973) [-908.946] (-906.065) (-923.385) -- 0:02:46
443000 -- (-916.113) (-906.962) [-901.331] (-915.179) * (-915.516) [-904.862] (-907.217) (-908.834) -- 0:02:45
443500 -- (-916.277) (-906.463) [-904.545] (-915.295) * (-909.096) (-906.443) (-912.369) [-910.855] -- 0:02:45
444000 -- (-919.751) (-914.383) (-909.457) [-921.887] * (-917.336) (-915.998) [-917.450] (-925.925) -- 0:02:45
444500 -- (-911.220) [-907.666] (-915.219) (-922.815) * [-905.519] (-914.000) (-921.888) (-917.587) -- 0:02:44
445000 -- (-910.179) (-902.078) [-909.025] (-916.908) * (-904.871) (-915.620) [-907.918] (-913.864) -- 0:02:45
Average standard deviation of split frequencies: 0.013899
445500 -- (-913.462) (-912.010) (-912.056) [-904.509] * (-913.451) (-909.835) (-910.155) [-910.490] -- 0:02:45
446000 -- (-924.339) (-915.763) (-912.187) [-909.087] * (-914.042) (-905.656) (-911.136) [-901.934] -- 0:02:45
446500 -- [-913.122] (-921.776) (-921.821) (-905.518) * (-903.659) (-909.016) [-906.975] (-916.032) -- 0:02:44
447000 -- (-916.549) [-914.706] (-912.108) (-909.562) * (-910.775) [-908.480] (-905.512) (-921.806) -- 0:02:44
447500 -- (-935.653) (-914.810) [-910.423] (-917.038) * (-912.916) (-915.485) (-902.674) [-909.103] -- 0:02:44
448000 -- (-909.231) (-917.761) (-905.020) [-904.991] * (-913.460) (-917.642) [-909.698] (-913.619) -- 0:02:43
448500 -- (-919.606) (-912.276) (-905.484) [-907.199] * (-911.017) (-913.100) (-913.382) [-905.164] -- 0:02:44
449000 -- (-911.352) (-911.686) [-907.787] (-909.863) * (-909.193) (-900.923) [-909.277] (-914.568) -- 0:02:44
449500 -- (-904.127) (-909.383) [-898.342] (-906.105) * [-905.194] (-906.181) (-936.448) (-906.482) -- 0:02:44
450000 -- (-906.180) (-915.524) [-906.378] (-909.186) * [-910.231] (-908.171) (-909.715) (-913.227) -- 0:02:43
Average standard deviation of split frequencies: 0.013232
450500 -- (-911.021) (-915.278) (-902.400) [-910.082] * [-902.636] (-909.568) (-916.063) (-905.756) -- 0:02:43
451000 -- [-912.683] (-905.532) (-909.292) (-905.410) * (-909.347) [-908.160] (-914.967) (-916.961) -- 0:02:43
451500 -- (-918.641) [-903.220] (-916.922) (-910.245) * (-905.799) (-917.477) (-911.602) [-904.088] -- 0:02:42
452000 -- [-913.193] (-918.758) (-905.556) (-913.352) * (-904.008) (-898.034) (-916.047) [-910.031] -- 0:02:43
452500 -- (-910.333) (-905.004) [-908.045] (-904.774) * [-900.789] (-911.930) (-906.097) (-910.156) -- 0:02:43
453000 -- (-916.043) (-903.966) (-923.746) [-907.428] * (-910.363) (-913.323) [-900.521] (-902.763) -- 0:02:43
453500 -- (-919.514) (-908.576) (-926.761) [-910.673] * (-912.166) (-911.996) [-904.465] (-923.854) -- 0:02:42
454000 -- (-910.328) [-904.754] (-915.476) (-912.044) * (-910.843) (-915.879) (-911.434) [-908.081] -- 0:02:42
454500 -- (-908.812) (-905.976) [-904.711] (-912.325) * (-926.264) [-915.816] (-913.510) (-914.502) -- 0:02:42
455000 -- (-912.622) [-903.889] (-918.040) (-907.880) * (-916.261) [-904.375] (-928.944) (-913.911) -- 0:02:41
Average standard deviation of split frequencies: 0.013284
455500 -- (-917.909) [-908.097] (-906.869) (-914.687) * (-922.076) (-912.380) (-921.517) [-906.518] -- 0:02:42
456000 -- [-902.530] (-909.363) (-905.600) (-917.034) * (-906.109) [-910.347] (-907.631) (-912.868) -- 0:02:42
456500 -- (-903.115) (-908.316) (-912.795) [-905.471] * (-913.994) (-903.793) (-919.499) [-903.316] -- 0:02:41
457000 -- (-903.970) (-904.014) (-911.013) [-905.821] * (-908.655) (-914.236) [-905.564] (-908.331) -- 0:02:41
457500 -- (-913.173) [-909.147] (-910.761) (-906.823) * (-912.339) (-906.482) (-915.952) [-906.616] -- 0:02:41
458000 -- (-916.716) (-908.202) [-907.103] (-908.119) * [-906.323] (-909.110) (-914.475) (-915.549) -- 0:02:40
458500 -- (-915.840) (-910.305) (-910.163) [-904.126] * [-909.681] (-908.474) (-909.787) (-908.182) -- 0:02:40
459000 -- (-918.797) (-922.897) [-902.343] (-907.508) * [-910.267] (-917.474) (-924.094) (-908.983) -- 0:02:41
459500 -- (-910.998) [-903.328] (-921.022) (-906.902) * [-912.824] (-914.031) (-913.184) (-901.518) -- 0:02:41
460000 -- (-915.802) (-920.649) (-902.783) [-908.125] * [-904.357] (-914.074) (-910.511) (-908.711) -- 0:02:40
Average standard deviation of split frequencies: 0.013610
460500 -- [-910.120] (-911.575) (-913.428) (-905.906) * [-908.526] (-905.615) (-911.879) (-909.935) -- 0:02:40
461000 -- (-906.040) (-917.200) [-910.604] (-909.418) * (-912.582) (-915.537) (-917.071) [-907.677] -- 0:02:40
461500 -- (-911.964) (-912.204) [-908.733] (-906.649) * (-911.060) [-919.894] (-913.091) (-904.853) -- 0:02:39
462000 -- (-908.464) [-907.927] (-927.416) (-909.266) * [-904.575] (-918.143) (-911.190) (-919.997) -- 0:02:40
462500 -- (-909.739) (-906.854) [-907.251] (-910.494) * (-917.746) [-912.951] (-908.635) (-911.888) -- 0:02:40
463000 -- (-912.712) [-905.379] (-909.134) (-907.589) * [-907.659] (-906.617) (-911.261) (-910.268) -- 0:02:40
463500 -- (-907.226) [-911.908] (-914.335) (-908.251) * (-918.531) (-925.151) (-911.154) [-903.887] -- 0:02:39
464000 -- (-919.368) (-912.180) [-903.191] (-925.152) * (-917.566) (-911.941) [-900.929] (-909.447) -- 0:02:39
464500 -- [-905.621] (-919.251) (-908.090) (-915.687) * [-907.896] (-910.094) (-914.877) (-905.695) -- 0:02:39
465000 -- [-913.494] (-926.953) (-910.571) (-914.263) * (-928.696) [-918.979] (-910.954) (-910.879) -- 0:02:38
Average standard deviation of split frequencies: 0.013707
465500 -- [-904.528] (-913.806) (-912.253) (-916.559) * (-909.100) (-914.205) (-913.892) [-908.717] -- 0:02:39
466000 -- (-913.290) [-907.834] (-914.226) (-906.287) * [-914.447] (-906.234) (-908.837) (-919.547) -- 0:02:39
466500 -- [-905.599] (-917.706) (-905.595) (-915.916) * (-909.740) (-909.999) [-907.968] (-937.093) -- 0:02:38
467000 -- (-905.897) (-909.371) [-902.126] (-911.644) * [-907.623] (-913.370) (-916.912) (-924.523) -- 0:02:38
467500 -- (-904.733) [-910.931] (-916.780) (-910.583) * (-909.402) (-913.310) [-905.225] (-914.122) -- 0:02:38
468000 -- (-914.216) (-908.518) [-906.228] (-918.911) * (-909.250) [-909.705] (-909.227) (-912.989) -- 0:02:38
468500 -- (-908.719) [-906.132] (-914.160) (-911.608) * (-912.474) (-907.435) (-905.882) [-914.198] -- 0:02:37
469000 -- [-905.207] (-923.339) (-908.567) (-903.857) * (-918.932) [-904.814] (-909.866) (-915.223) -- 0:02:38
469500 -- (-916.782) (-911.120) [-914.277] (-908.758) * (-915.035) [-913.917] (-921.037) (-911.075) -- 0:02:38
470000 -- (-915.615) [-908.286] (-917.203) (-922.433) * (-911.105) [-910.057] (-914.546) (-904.539) -- 0:02:37
Average standard deviation of split frequencies: 0.013337
470500 -- (-928.633) [-919.229] (-922.193) (-908.912) * (-907.298) (-907.186) (-908.853) [-909.241] -- 0:02:37
471000 -- [-917.231] (-915.767) (-920.242) (-915.615) * (-919.135) (-917.228) [-904.192] (-907.403) -- 0:02:37
471500 -- (-913.885) (-920.178) (-916.238) [-904.245] * [-903.948] (-907.163) (-922.515) (-918.423) -- 0:02:36
472000 -- (-903.812) (-912.882) (-916.849) [-906.100] * (-904.671) (-916.193) (-905.837) [-916.921] -- 0:02:36
472500 -- (-903.934) (-913.219) (-919.277) [-902.668] * (-908.782) (-911.169) [-908.005] (-906.197) -- 0:02:37
473000 -- (-901.285) (-909.836) [-912.888] (-908.995) * (-908.168) (-917.490) (-909.278) [-908.991] -- 0:02:37
473500 -- [-915.026] (-911.657) (-914.623) (-924.823) * (-912.233) [-908.922] (-905.655) (-902.003) -- 0:02:36
474000 -- (-919.559) (-906.199) (-911.122) [-908.728] * (-909.342) (-916.480) [-909.010] (-918.266) -- 0:02:36
474500 -- (-927.899) (-917.933) [-905.900] (-912.766) * (-907.787) (-910.692) (-918.253) [-909.792] -- 0:02:36
475000 -- (-905.813) (-922.602) [-910.122] (-907.420) * (-910.699) (-920.241) [-906.012] (-906.977) -- 0:02:35
Average standard deviation of split frequencies: 0.012822
475500 -- (-912.670) (-913.704) [-905.712] (-907.753) * (-913.992) (-921.899) [-906.469] (-921.983) -- 0:02:36
476000 -- (-907.428) (-914.304) [-906.695] (-917.374) * (-912.978) (-909.931) (-914.315) [-908.511] -- 0:02:36
476500 -- (-911.914) [-907.596] (-917.564) (-924.658) * (-909.384) [-912.039] (-910.913) (-912.392) -- 0:02:36
477000 -- (-903.024) (-912.423) (-908.245) [-908.415] * (-921.176) (-924.473) (-907.365) [-909.329] -- 0:02:35
477500 -- (-904.281) [-905.322] (-916.750) (-907.587) * (-912.379) (-905.244) [-903.187] (-916.430) -- 0:02:35
478000 -- (-912.636) (-907.448) [-901.982] (-909.189) * [-916.523] (-907.160) (-903.610) (-922.213) -- 0:02:35
478500 -- (-906.092) (-909.000) [-903.393] (-916.980) * (-911.113) (-911.442) (-912.212) [-905.589] -- 0:02:34
479000 -- [-906.200] (-911.220) (-918.718) (-913.001) * (-921.672) (-912.199) [-908.687] (-909.599) -- 0:02:35
479500 -- [-906.929] (-909.710) (-906.067) (-908.474) * (-916.443) (-917.870) [-904.071] (-909.035) -- 0:02:35
480000 -- (-919.070) (-907.614) (-916.846) [-903.300] * (-915.256) (-907.505) [-905.894] (-921.600) -- 0:02:34
Average standard deviation of split frequencies: 0.011820
480500 -- (-907.322) [-905.964] (-914.910) (-900.280) * (-910.122) (-916.660) [-904.028] (-910.714) -- 0:02:34
481000 -- (-912.682) (-914.021) (-921.517) [-909.166] * (-911.737) [-908.807] (-918.175) (-919.015) -- 0:02:34
481500 -- (-904.876) (-923.288) (-911.238) [-903.722] * [-911.161] (-905.125) (-919.625) (-910.432) -- 0:02:33
482000 -- (-907.979) (-912.764) (-914.313) [-898.704] * (-910.781) (-903.788) [-907.240] (-912.438) -- 0:02:33
482500 -- (-911.200) [-914.499] (-911.040) (-907.232) * (-921.423) (-905.166) [-914.807] (-911.788) -- 0:02:34
483000 -- (-907.520) (-914.047) [-909.504] (-900.156) * [-906.847] (-913.894) (-909.106) (-916.044) -- 0:02:34
483500 -- [-912.738] (-924.288) (-907.585) (-913.403) * (-911.283) (-910.610) (-905.827) [-911.928] -- 0:02:33
484000 -- (-911.524) (-912.488) [-902.424] (-911.462) * (-918.199) (-914.267) (-919.207) [-912.108] -- 0:02:33
484500 -- (-906.186) (-908.134) [-904.204] (-918.587) * (-917.623) (-912.603) [-900.929] (-910.038) -- 0:02:33
485000 -- (-906.943) [-911.827] (-923.881) (-903.464) * (-912.352) (-919.636) [-899.249] (-918.182) -- 0:02:32
Average standard deviation of split frequencies: 0.012712
485500 -- [-913.358] (-904.192) (-904.974) (-908.734) * (-909.580) (-914.624) [-908.765] (-930.039) -- 0:02:32
486000 -- (-900.868) (-903.928) (-917.658) [-908.415] * (-910.597) (-910.460) [-908.528] (-917.378) -- 0:02:33
486500 -- (-906.186) (-911.158) (-911.400) [-906.088] * (-924.070) (-910.354) (-909.726) [-907.692] -- 0:02:33
487000 -- (-913.194) (-901.820) (-914.118) [-899.645] * (-912.817) (-916.364) (-907.978) [-906.667] -- 0:02:32
487500 -- [-911.579] (-915.630) (-908.720) (-910.945) * (-912.396) (-916.685) (-914.672) [-909.205] -- 0:02:32
488000 -- (-904.826) (-909.561) (-910.069) [-906.501] * (-909.790) [-912.298] (-915.376) (-909.745) -- 0:02:32
488500 -- [-905.810] (-907.643) (-918.507) (-905.929) * (-911.677) (-925.951) (-906.814) [-913.478] -- 0:02:31
489000 -- [-906.899] (-907.893) (-908.477) (-913.233) * (-915.272) [-908.130] (-911.604) (-910.320) -- 0:02:31
489500 -- (-912.825) (-909.350) (-916.195) [-909.002] * [-908.054] (-916.863) (-911.022) (-908.707) -- 0:02:32
490000 -- [-912.335] (-909.677) (-916.366) (-905.596) * (-909.563) [-902.794] (-910.795) (-917.522) -- 0:02:31
Average standard deviation of split frequencies: 0.011731
490500 -- (-917.979) [-906.782] (-907.804) (-903.414) * (-911.187) (-908.436) [-907.910] (-901.427) -- 0:02:31
491000 -- (-908.972) [-914.851] (-913.984) (-909.366) * [-909.464] (-909.114) (-903.767) (-911.809) -- 0:02:31
491500 -- [-907.524] (-909.495) (-913.072) (-907.099) * (-914.570) [-908.407] (-909.406) (-920.475) -- 0:02:31
492000 -- (-918.493) [-915.826] (-909.203) (-915.891) * (-915.199) (-915.430) [-906.556] (-914.889) -- 0:02:30
492500 -- (-917.605) [-906.091] (-914.449) (-915.904) * (-911.206) [-911.016] (-912.413) (-914.654) -- 0:02:31
493000 -- (-911.237) [-905.842] (-921.583) (-917.904) * (-916.151) (-913.430) (-911.841) [-912.128] -- 0:02:31
493500 -- [-906.441] (-909.206) (-921.103) (-910.573) * (-913.632) [-909.736] (-910.963) (-903.774) -- 0:02:30
494000 -- (-905.729) (-909.586) (-903.926) [-910.029] * (-913.994) [-911.719] (-913.057) (-915.025) -- 0:02:30
494500 -- (-908.399) (-921.149) [-913.375] (-902.314) * (-905.004) [-910.249] (-919.952) (-911.684) -- 0:02:30
495000 -- (-922.418) (-925.073) [-915.430] (-905.713) * (-916.849) (-910.641) (-911.867) [-904.053] -- 0:02:29
Average standard deviation of split frequencies: 0.011305
495500 -- (-906.439) [-909.994] (-909.664) (-914.315) * (-915.397) [-904.883] (-910.812) (-908.499) -- 0:02:29
496000 -- (-904.002) (-908.686) (-918.484) [-902.312] * (-903.308) (-923.172) (-914.628) [-904.518] -- 0:02:30
496500 -- (-903.604) (-909.367) (-920.903) [-908.393] * (-913.866) (-914.190) [-907.222] (-913.352) -- 0:02:30
497000 -- (-919.171) (-910.987) (-918.155) [-907.498] * (-914.179) (-911.222) [-914.220] (-909.181) -- 0:02:29
497500 -- [-905.608] (-906.844) (-912.763) (-917.057) * (-915.007) (-914.347) [-908.429] (-903.646) -- 0:02:29
498000 -- (-907.149) (-916.469) (-911.829) [-907.922] * (-902.306) (-912.588) [-909.943] (-904.359) -- 0:02:29
498500 -- (-899.917) (-912.518) [-907.399] (-910.177) * (-911.352) [-911.396] (-907.222) (-912.787) -- 0:02:28
499000 -- (-911.722) (-914.779) [-906.938] (-910.025) * (-907.347) (-911.511) [-904.011] (-918.197) -- 0:02:28
499500 -- (-908.848) [-905.166] (-910.085) (-916.645) * (-905.170) (-927.018) [-905.198] (-912.824) -- 0:02:29
500000 -- [-904.687] (-911.610) (-919.036) (-905.301) * (-914.408) [-912.906] (-905.705) (-916.933) -- 0:02:29
Average standard deviation of split frequencies: 0.011150
500500 -- (-907.370) (-914.471) [-911.399] (-911.277) * (-896.556) (-916.536) [-904.792] (-912.164) -- 0:02:28
501000 -- (-908.526) (-907.193) (-913.751) [-899.460] * (-902.385) (-916.293) [-907.828] (-921.004) -- 0:02:28
501500 -- [-911.082] (-905.748) (-914.099) (-916.553) * (-907.142) (-912.320) (-908.438) [-913.293] -- 0:02:28
502000 -- (-909.992) (-914.323) [-913.383] (-914.280) * (-917.699) [-909.463] (-913.863) (-921.244) -- 0:02:27
502500 -- (-919.374) (-909.177) [-914.212] (-908.446) * (-927.767) (-919.480) [-916.835] (-914.957) -- 0:02:27
503000 -- (-916.376) (-904.561) [-907.884] (-916.792) * (-911.532) [-907.696] (-906.783) (-911.518) -- 0:02:28
503500 -- (-916.854) [-905.780] (-919.146) (-911.385) * (-912.192) (-913.006) (-904.247) [-905.056] -- 0:02:27
504000 -- (-910.928) [-910.498] (-909.973) (-908.075) * (-909.242) [-911.112] (-913.802) (-907.712) -- 0:02:27
504500 -- [-903.616] (-909.009) (-915.037) (-906.173) * [-904.608] (-916.740) (-914.711) (-911.272) -- 0:02:27
505000 -- [-914.897] (-904.687) (-912.258) (-917.995) * (-910.118) [-914.265] (-914.278) (-912.726) -- 0:02:27
Average standard deviation of split frequencies: 0.011474
505500 -- [-905.802] (-912.488) (-914.960) (-908.697) * (-921.577) (-916.327) [-903.460] (-910.807) -- 0:02:26
506000 -- (-905.607) [-912.783] (-917.606) (-909.474) * (-913.748) (-918.184) [-901.930] (-902.663) -- 0:02:27
506500 -- (-913.907) (-902.703) [-908.126] (-913.494) * (-908.055) [-919.443] (-907.058) (-907.465) -- 0:02:27
507000 -- (-919.491) (-919.165) (-910.325) [-917.193] * (-930.646) (-917.359) [-905.732] (-909.272) -- 0:02:26
507500 -- (-908.477) (-917.389) [-911.863] (-914.983) * (-913.135) (-920.526) [-908.240] (-905.953) -- 0:02:26
508000 -- (-909.962) (-921.781) (-904.410) [-906.004] * (-915.934) (-927.640) (-914.318) [-905.395] -- 0:02:26
508500 -- [-901.426] (-912.647) (-904.178) (-908.532) * (-915.509) (-906.535) (-909.955) [-902.123] -- 0:02:25
509000 -- (-906.822) (-911.322) [-905.667] (-905.048) * (-919.358) [-910.980] (-919.621) (-904.835) -- 0:02:25
509500 -- (-908.450) [-907.301] (-913.203) (-915.110) * (-908.164) [-911.304] (-910.782) (-907.631) -- 0:02:26
510000 -- (-914.816) (-908.270) (-904.536) [-920.386] * (-909.180) (-912.981) [-905.208] (-920.568) -- 0:02:26
Average standard deviation of split frequencies: 0.010883
510500 -- (-919.035) [-908.799] (-917.120) (-911.776) * (-908.530) [-904.571] (-916.875) (-911.223) -- 0:02:25
511000 -- (-921.064) [-901.919] (-907.816) (-912.582) * [-903.975] (-901.565) (-913.344) (-913.964) -- 0:02:25
511500 -- (-911.184) (-912.117) [-910.836] (-931.272) * (-905.371) (-904.826) (-911.048) [-910.925] -- 0:02:25
512000 -- (-910.614) [-906.057] (-915.062) (-910.695) * [-906.074] (-901.883) (-909.773) (-910.160) -- 0:02:24
512500 -- [-907.935] (-907.451) (-905.803) (-912.092) * (-913.430) (-906.464) (-913.481) [-903.171] -- 0:02:24
513000 -- (-923.236) [-910.464] (-910.579) (-916.011) * (-913.421) (-910.419) [-906.754] (-913.282) -- 0:02:25
513500 -- (-920.371) [-911.277] (-911.457) (-921.796) * [-907.189] (-908.964) (-913.136) (-906.655) -- 0:02:24
514000 -- (-906.582) [-904.606] (-912.067) (-924.538) * (-906.780) (-913.786) (-903.159) [-906.780] -- 0:02:24
514500 -- (-910.925) [-909.883] (-911.205) (-920.751) * (-918.459) [-902.217] (-910.967) (-906.734) -- 0:02:24
515000 -- (-912.109) (-923.320) [-912.721] (-923.269) * (-913.889) (-903.847) [-906.211] (-909.595) -- 0:02:24
Average standard deviation of split frequencies: 0.011203
515500 -- (-907.553) [-914.087] (-909.512) (-908.398) * (-902.848) (-912.617) [-908.038] (-916.441) -- 0:02:23
516000 -- [-901.424] (-906.495) (-911.901) (-914.054) * (-909.732) (-909.238) (-909.221) [-919.541] -- 0:02:24
516500 -- (-905.204) (-908.924) [-908.725] (-909.605) * (-906.007) [-903.779] (-908.986) (-924.054) -- 0:02:24
517000 -- (-907.795) [-903.399] (-914.034) (-917.818) * (-913.680) (-908.930) (-904.543) [-910.522] -- 0:02:23
517500 -- (-907.863) (-907.866) [-905.588] (-924.084) * (-919.166) [-905.990] (-913.787) (-917.315) -- 0:02:23
518000 -- [-905.687] (-905.259) (-913.005) (-918.092) * [-910.237] (-904.782) (-928.570) (-916.914) -- 0:02:23
518500 -- [-904.206] (-918.799) (-915.564) (-909.289) * (-906.113) (-916.059) [-916.597] (-916.215) -- 0:02:23
519000 -- (-913.652) [-910.291] (-905.530) (-907.711) * (-912.422) [-905.875] (-913.857) (-913.277) -- 0:02:22
519500 -- (-906.512) (-918.430) (-902.979) [-910.168] * (-903.228) (-914.973) (-917.846) [-914.117] -- 0:02:23
520000 -- [-903.526] (-910.525) (-921.398) (-904.658) * (-902.912) (-909.970) [-910.750] (-913.040) -- 0:02:23
Average standard deviation of split frequencies: 0.010865
520500 -- (-911.231) [-909.760] (-915.601) (-913.265) * (-908.182) [-908.461] (-914.677) (-912.205) -- 0:02:22
521000 -- (-924.023) (-910.300) (-914.192) [-904.034] * (-911.845) (-911.115) [-916.425] (-900.993) -- 0:02:22
521500 -- (-925.433) (-912.135) (-912.849) [-918.530] * (-910.286) (-916.504) (-911.504) [-909.071] -- 0:02:22
522000 -- (-916.920) (-911.711) [-914.495] (-916.081) * (-908.586) (-921.956) (-913.873) [-905.037] -- 0:02:21
522500 -- [-918.487] (-909.551) (-909.472) (-918.977) * (-923.864) (-917.687) (-915.480) [-908.593] -- 0:02:21
523000 -- (-933.356) [-906.400] (-908.809) (-911.683) * [-903.889] (-909.633) (-924.529) (-913.368) -- 0:02:22
523500 -- (-910.313) (-915.887) (-910.941) [-908.006] * (-923.043) (-906.898) (-910.344) [-907.236] -- 0:02:21
524000 -- (-913.439) (-914.507) (-912.902) [-913.793] * (-910.014) (-904.240) (-917.027) [-901.856] -- 0:02:21
524500 -- (-924.378) [-901.504] (-914.409) (-910.256) * (-910.565) (-904.553) (-930.466) [-905.617] -- 0:02:21
525000 -- (-932.742) (-907.637) [-905.520] (-905.518) * [-902.485] (-912.103) (-915.187) (-916.691) -- 0:02:21
Average standard deviation of split frequencies: 0.011556
525500 -- (-914.290) [-910.327] (-918.129) (-904.827) * [-912.253] (-910.864) (-916.197) (-904.536) -- 0:02:20
526000 -- (-918.580) (-903.475) (-917.032) [-908.078] * (-917.207) (-913.004) (-919.056) [-911.312] -- 0:02:20
526500 -- (-913.788) (-910.353) (-906.908) [-913.648] * (-903.307) (-916.093) [-906.584] (-913.505) -- 0:02:21
527000 -- (-914.564) (-907.217) [-912.348] (-913.967) * (-909.786) (-940.065) [-918.177] (-902.788) -- 0:02:20
527500 -- [-909.562] (-903.119) (-909.282) (-927.815) * (-913.129) (-915.425) [-915.439] (-907.969) -- 0:02:20
528000 -- [-905.038] (-905.159) (-912.072) (-912.669) * (-909.045) (-921.159) (-907.672) [-912.366] -- 0:02:20
528500 -- (-911.921) (-919.719) [-907.350] (-908.256) * (-914.305) (-921.730) [-906.180] (-915.408) -- 0:02:20
529000 -- (-902.092) [-905.783] (-903.156) (-918.960) * [-914.836] (-934.050) (-915.198) (-918.863) -- 0:02:19
529500 -- (-915.309) (-910.767) [-907.196] (-916.008) * (-908.781) (-926.541) [-904.560] (-913.064) -- 0:02:19
530000 -- (-905.136) (-910.651) (-915.085) [-910.050] * (-909.235) (-929.502) (-913.958) [-907.334] -- 0:02:20
Average standard deviation of split frequencies: 0.012156
530500 -- [-913.939] (-904.818) (-909.096) (-925.977) * (-906.641) (-916.451) [-910.338] (-906.783) -- 0:02:19
531000 -- (-915.284) (-913.935) (-908.788) [-910.817] * (-911.653) (-911.312) [-913.039] (-913.897) -- 0:02:19
531500 -- (-911.920) [-905.921] (-907.221) (-918.525) * (-911.406) (-905.045) [-906.217] (-926.158) -- 0:02:19
532000 -- [-905.794] (-906.549) (-902.919) (-914.887) * [-908.964] (-904.268) (-913.762) (-915.930) -- 0:02:18
532500 -- (-904.536) (-909.895) [-909.223] (-910.091) * (-915.376) [-920.532] (-902.535) (-907.401) -- 0:02:18
533000 -- [-909.273] (-904.461) (-911.920) (-912.584) * (-905.191) (-904.531) [-900.586] (-910.773) -- 0:02:19
533500 -- (-916.982) [-909.062] (-912.141) (-908.228) * (-908.950) (-923.643) (-908.032) [-905.268] -- 0:02:19
534000 -- [-905.337] (-916.411) (-909.309) (-910.846) * (-913.664) (-920.326) [-909.262] (-911.098) -- 0:02:18
534500 -- (-909.036) (-922.292) [-911.470] (-923.286) * [-911.019] (-911.973) (-913.432) (-916.599) -- 0:02:18
535000 -- (-912.152) (-917.236) (-912.365) [-902.465] * [-905.836] (-904.982) (-916.061) (-908.854) -- 0:02:18
Average standard deviation of split frequencies: 0.012081
535500 -- (-915.840) (-910.625) (-925.597) [-910.290] * (-908.904) [-905.913] (-917.215) (-902.489) -- 0:02:17
536000 -- (-905.508) (-909.081) (-920.188) [-900.100] * [-908.551] (-908.520) (-906.609) (-904.219) -- 0:02:17
536500 -- [-906.100] (-922.001) (-913.563) (-925.582) * (-908.174) [-907.190] (-906.859) (-910.892) -- 0:02:18
537000 -- (-906.755) [-905.964] (-913.289) (-909.904) * (-915.683) [-906.440] (-904.426) (-907.812) -- 0:02:17
537500 -- (-913.362) (-916.775) (-916.182) [-909.337] * (-919.126) (-915.966) [-909.194] (-902.614) -- 0:02:17
538000 -- (-916.492) (-905.730) [-907.815] (-911.922) * (-909.016) [-909.236] (-910.149) (-908.624) -- 0:02:17
538500 -- (-902.147) (-911.259) [-918.015] (-921.732) * (-914.634) (-910.324) [-908.922] (-915.921) -- 0:02:17
539000 -- [-901.909] (-913.124) (-914.124) (-916.720) * (-921.336) (-913.533) (-909.013) [-905.500] -- 0:02:16
539500 -- (-907.675) [-907.489] (-914.530) (-910.482) * (-908.961) (-923.750) (-909.714) [-907.698] -- 0:02:16
540000 -- (-917.454) [-908.687] (-912.553) (-920.263) * (-905.532) (-911.192) (-909.761) [-912.895] -- 0:02:17
Average standard deviation of split frequencies: 0.011381
540500 -- (-912.299) (-916.486) (-921.327) [-906.303] * (-919.315) (-906.917) (-908.514) [-913.049] -- 0:02:16
541000 -- (-908.590) [-909.012] (-925.912) (-907.736) * (-908.584) [-913.324] (-906.974) (-914.909) -- 0:02:16
541500 -- (-909.993) (-910.971) (-919.243) [-906.628] * (-916.743) [-906.520] (-906.975) (-913.469) -- 0:02:16
542000 -- (-907.876) [-912.051] (-910.214) (-907.603) * (-910.184) (-923.743) (-916.271) [-904.673] -- 0:02:16
542500 -- (-909.513) [-903.412] (-911.895) (-914.812) * [-904.138] (-916.868) (-913.497) (-912.136) -- 0:02:15
543000 -- (-915.588) (-906.948) (-908.739) [-913.078] * [-910.719] (-913.408) (-902.983) (-923.674) -- 0:02:15
543500 -- (-910.356) (-914.591) [-909.031] (-917.228) * [-898.167] (-909.229) (-920.641) (-910.935) -- 0:02:16
544000 -- (-906.277) [-908.474] (-909.354) (-911.584) * [-906.141] (-907.346) (-916.812) (-907.338) -- 0:02:15
544500 -- [-911.691] (-908.301) (-914.362) (-918.058) * (-914.451) (-911.856) [-909.368] (-924.218) -- 0:02:15
545000 -- (-907.561) [-913.548] (-917.599) (-913.740) * (-908.056) (-917.265) (-912.931) [-913.096] -- 0:02:15
Average standard deviation of split frequencies: 0.011769
545500 -- (-914.709) (-911.401) [-910.026] (-913.487) * (-913.284) (-908.650) [-902.508] (-922.911) -- 0:02:14
546000 -- (-908.827) (-912.322) [-905.792] (-917.052) * (-908.439) (-904.688) [-903.934] (-922.454) -- 0:02:14
546500 -- (-907.407) (-908.324) [-907.726] (-918.129) * (-910.557) (-917.005) [-900.897] (-921.379) -- 0:02:14
547000 -- (-910.716) [-909.415] (-919.616) (-909.973) * (-913.519) (-914.864) [-909.924] (-916.440) -- 0:02:14
547500 -- [-903.635] (-912.394) (-915.514) (-906.681) * (-909.298) (-917.934) (-905.836) [-908.154] -- 0:02:14
548000 -- (-910.052) (-917.984) (-918.458) [-904.815] * [-917.144] (-918.766) (-908.492) (-911.647) -- 0:02:14
548500 -- (-905.002) (-907.210) [-913.091] (-923.796) * [-914.044] (-910.519) (-913.435) (-908.784) -- 0:02:14
549000 -- (-921.796) (-912.271) [-909.892] (-914.538) * (-910.207) [-916.255] (-914.223) (-911.098) -- 0:02:13
549500 -- (-917.445) (-918.732) [-905.161] (-909.839) * (-912.534) (-907.984) [-907.604] (-910.346) -- 0:02:13
550000 -- [-912.607] (-917.004) (-918.330) (-917.045) * (-914.500) (-911.278) (-912.347) [-907.162] -- 0:02:14
Average standard deviation of split frequencies: 0.010813
550500 -- [-909.373] (-924.280) (-909.974) (-910.773) * (-915.235) [-904.179] (-908.360) (-920.105) -- 0:02:13
551000 -- (-916.167) (-926.075) (-916.970) [-909.319] * [-912.145] (-902.407) (-910.099) (-915.703) -- 0:02:13
551500 -- (-913.115) [-907.179] (-908.852) (-909.019) * (-921.223) [-907.340] (-905.143) (-911.860) -- 0:02:13
552000 -- [-912.852] (-914.686) (-900.596) (-907.119) * (-914.090) [-901.157] (-917.597) (-910.087) -- 0:02:13
552500 -- (-909.762) (-907.031) [-912.867] (-923.425) * [-907.281] (-917.671) (-909.828) (-914.055) -- 0:02:12
553000 -- (-903.966) (-909.732) [-904.312] (-917.379) * (-919.175) [-905.444] (-915.555) (-914.311) -- 0:02:12
553500 -- (-907.128) [-913.018] (-914.714) (-917.236) * [-913.697] (-908.549) (-913.913) (-906.139) -- 0:02:13
554000 -- [-917.683] (-918.455) (-906.301) (-918.282) * [-909.022] (-902.562) (-914.521) (-925.624) -- 0:02:12
554500 -- (-914.772) [-911.061] (-912.235) (-910.870) * (-911.257) [-906.630] (-908.221) (-906.651) -- 0:02:12
555000 -- (-918.650) (-910.396) [-906.932] (-914.093) * (-911.481) [-900.988] (-915.839) (-916.951) -- 0:02:12
Average standard deviation of split frequencies: 0.011156
555500 -- (-922.282) (-909.275) [-905.001] (-918.137) * (-911.889) (-915.398) (-910.418) [-908.383] -- 0:02:12
556000 -- (-906.435) (-915.888) (-912.814) [-917.855] * [-905.491] (-921.087) (-906.491) (-911.996) -- 0:02:11
556500 -- [-910.184] (-912.788) (-917.572) (-913.515) * (-905.984) (-917.101) [-909.269] (-906.828) -- 0:02:12
557000 -- (-910.049) [-903.627] (-919.481) (-914.828) * [-907.491] (-911.341) (-912.658) (-907.455) -- 0:02:12
557500 -- (-921.430) [-902.282] (-908.465) (-913.707) * (-904.916) (-903.763) (-921.309) [-905.335] -- 0:02:11
558000 -- [-903.241] (-900.435) (-923.271) (-926.846) * [-905.940] (-912.364) (-919.291) (-909.522) -- 0:02:11
558500 -- (-909.797) (-907.208) [-916.586] (-914.197) * [-906.051] (-907.248) (-918.914) (-912.975) -- 0:02:11
559000 -- (-905.785) [-912.627] (-915.463) (-910.208) * [-906.838] (-907.242) (-911.150) (-910.709) -- 0:02:10
559500 -- (-919.120) (-907.726) [-912.145] (-919.379) * [-906.985] (-912.897) (-905.515) (-909.875) -- 0:02:11
560000 -- (-907.197) (-906.919) (-912.053) [-906.789] * (-915.914) (-915.038) (-908.763) [-912.693] -- 0:02:11
Average standard deviation of split frequencies: 0.011107
560500 -- (-908.964) (-909.486) (-907.034) [-903.202] * [-906.830] (-911.952) (-911.119) (-905.545) -- 0:02:10
561000 -- (-918.645) (-911.873) [-914.834] (-906.558) * [-911.781] (-918.621) (-915.097) (-914.247) -- 0:02:10
561500 -- (-910.994) (-909.296) (-909.081) [-905.382] * (-905.568) [-908.110] (-917.873) (-910.159) -- 0:02:10
562000 -- (-905.421) (-909.089) [-907.873] (-905.540) * (-911.045) [-909.655] (-914.023) (-901.862) -- 0:02:10
562500 -- [-912.663] (-913.675) (-911.339) (-920.036) * [-904.940] (-913.734) (-920.331) (-915.962) -- 0:02:10
563000 -- (-915.150) [-911.170] (-912.369) (-913.001) * (-909.442) [-907.362] (-908.905) (-911.185) -- 0:02:10
563500 -- [-901.708] (-902.273) (-919.233) (-902.064) * [-909.408] (-906.905) (-912.906) (-916.819) -- 0:02:10
564000 -- (-910.204) [-907.147] (-907.599) (-914.264) * (-903.581) [-904.270] (-906.145) (-912.813) -- 0:02:09
564500 -- (-908.695) [-905.642] (-911.050) (-910.375) * (-910.684) (-913.686) (-918.330) [-903.183] -- 0:02:09
565000 -- (-921.018) (-904.106) (-915.744) [-910.054] * (-918.857) [-906.875] (-904.917) (-900.137) -- 0:02:09
Average standard deviation of split frequencies: 0.011090
565500 -- (-912.436) [-907.925] (-906.860) (-907.437) * (-917.065) [-904.051] (-908.947) (-913.723) -- 0:02:09
566000 -- (-906.227) (-909.342) [-907.571] (-906.470) * (-908.108) [-907.349] (-921.210) (-909.576) -- 0:02:09
566500 -- (-914.885) (-907.108) [-914.626] (-916.927) * [-914.430] (-919.655) (-907.991) (-906.974) -- 0:02:09
567000 -- (-909.105) [-909.339] (-919.647) (-914.179) * (-911.630) [-907.098] (-899.755) (-910.450) -- 0:02:09
567500 -- (-906.388) [-907.756] (-902.825) (-911.367) * (-911.505) (-914.846) [-898.791] (-909.868) -- 0:02:08
568000 -- [-906.800] (-910.477) (-924.125) (-907.778) * (-914.910) [-908.021] (-900.999) (-916.341) -- 0:02:08
568500 -- (-911.322) (-917.702) (-911.384) [-902.873] * [-906.073] (-909.003) (-906.455) (-914.974) -- 0:02:08
569000 -- (-921.007) [-908.594] (-924.594) (-899.914) * [-906.128] (-915.699) (-916.294) (-914.541) -- 0:02:08
569500 -- (-923.400) (-908.941) (-925.083) [-910.304] * (-913.303) (-921.815) (-912.957) [-915.210] -- 0:02:08
570000 -- (-923.714) (-910.161) [-904.601] (-905.881) * (-907.881) [-912.557] (-914.455) (-920.166) -- 0:02:08
Average standard deviation of split frequencies: 0.010217
570500 -- (-916.558) (-914.288) [-907.278] (-907.538) * [-910.136] (-907.684) (-904.254) (-912.626) -- 0:02:07
571000 -- (-928.066) (-907.550) [-911.279] (-913.304) * (-901.828) (-907.928) [-905.953] (-901.820) -- 0:02:07
571500 -- [-904.962] (-904.055) (-915.142) (-914.902) * (-914.496) (-904.961) [-913.853] (-904.170) -- 0:02:07
572000 -- (-915.364) (-903.688) [-912.039] (-905.716) * [-910.101] (-917.454) (-906.649) (-910.929) -- 0:02:07
572500 -- (-911.471) (-904.057) (-906.686) [-908.095] * (-916.420) (-902.025) (-913.671) [-909.110] -- 0:02:07
573000 -- (-924.444) (-904.396) (-914.783) [-909.611] * (-912.796) (-912.288) [-908.725] (-903.722) -- 0:02:07
573500 -- (-907.185) (-903.498) (-926.462) [-903.281] * (-918.377) [-904.137] (-923.115) (-909.465) -- 0:02:07
574000 -- [-902.065] (-912.432) (-924.961) (-907.284) * (-913.639) [-911.919] (-913.472) (-912.239) -- 0:02:06
574500 -- (-908.236) (-911.150) [-911.157] (-915.176) * (-913.961) (-907.457) (-909.012) [-912.786] -- 0:02:06
575000 -- (-905.161) [-905.224] (-921.612) (-918.926) * (-916.095) (-905.856) [-911.401] (-906.273) -- 0:02:06
Average standard deviation of split frequencies: 0.010381
575500 -- (-910.394) (-911.257) (-912.440) [-906.348] * (-906.957) [-906.493] (-913.200) (-905.494) -- 0:02:06
576000 -- (-914.199) (-905.086) [-903.662] (-918.286) * (-917.123) (-917.584) (-907.081) [-911.326] -- 0:02:06
576500 -- [-912.268] (-909.746) (-915.324) (-907.232) * [-914.241] (-907.373) (-903.827) (-905.100) -- 0:02:06
577000 -- (-915.044) [-902.835] (-911.842) (-903.285) * [-908.148] (-906.776) (-906.180) (-911.232) -- 0:02:06
577500 -- (-918.651) [-898.421] (-910.984) (-906.219) * (-916.449) (-903.853) [-906.292] (-913.050) -- 0:02:05
578000 -- (-904.879) [-902.840] (-916.969) (-912.254) * (-904.357) [-901.350] (-912.430) (-919.885) -- 0:02:05
578500 -- (-907.809) (-912.462) [-904.978] (-910.751) * (-918.765) (-905.724) [-904.630] (-912.462) -- 0:02:05
579000 -- [-909.762] (-915.457) (-907.588) (-914.482) * [-911.830] (-906.888) (-903.824) (-908.993) -- 0:02:05
579500 -- (-911.318) (-902.329) (-915.055) [-906.353] * (-905.645) [-906.279] (-911.826) (-911.154) -- 0:02:05
580000 -- (-920.268) [-911.897] (-917.033) (-917.779) * (-914.344) (-913.743) (-907.224) [-916.663] -- 0:02:05
Average standard deviation of split frequencies: 0.010896
580500 -- (-929.315) [-905.636] (-909.025) (-911.011) * (-906.675) (-914.559) [-907.876] (-922.447) -- 0:02:05
581000 -- (-923.763) (-906.608) (-912.033) [-911.137] * (-916.522) [-902.695] (-907.667) (-925.958) -- 0:02:04
581500 -- (-911.278) [-909.446] (-918.153) (-910.331) * (-908.160) (-908.465) (-911.414) [-912.348] -- 0:02:04
582000 -- (-912.863) [-912.453] (-906.960) (-908.168) * (-908.124) [-907.209] (-911.946) (-905.381) -- 0:02:04
582500 -- (-907.495) (-914.369) [-903.717] (-907.674) * (-909.508) (-911.142) (-924.334) [-906.601] -- 0:02:04
583000 -- [-908.025] (-903.126) (-908.537) (-903.844) * (-904.616) (-905.346) (-920.636) [-906.330] -- 0:02:04
583500 -- [-920.511] (-918.775) (-901.108) (-908.780) * (-905.462) (-914.316) (-910.009) [-917.231] -- 0:02:04
584000 -- (-908.048) [-912.040] (-911.437) (-912.090) * (-915.544) [-914.555] (-908.668) (-911.172) -- 0:02:03
584500 -- (-907.658) (-919.964) (-911.291) [-902.682] * (-912.052) (-914.862) [-907.843] (-912.723) -- 0:02:03
585000 -- (-914.142) (-925.190) [-906.309] (-908.704) * (-912.325) (-921.889) (-917.100) [-911.790] -- 0:02:03
Average standard deviation of split frequencies: 0.010415
585500 -- (-902.679) (-902.712) (-922.685) [-910.678] * (-910.381) [-909.753] (-905.252) (-911.841) -- 0:02:03
586000 -- (-910.128) [-906.626] (-917.522) (-904.837) * (-916.229) (-914.424) [-907.281] (-904.684) -- 0:02:03
586500 -- (-912.280) (-913.822) [-908.915] (-906.191) * (-916.459) [-900.970] (-908.193) (-910.725) -- 0:02:03
587000 -- (-905.156) [-901.427] (-909.953) (-913.253) * (-912.976) (-907.345) [-907.579] (-912.691) -- 0:02:03
587500 -- (-914.243) (-912.193) [-911.210] (-915.308) * (-910.093) [-911.522] (-909.335) (-905.101) -- 0:02:02
588000 -- (-911.875) (-911.112) [-909.432] (-903.097) * (-907.588) [-903.982] (-908.276) (-920.596) -- 0:02:02
588500 -- [-905.468] (-904.161) (-907.173) (-912.643) * (-914.053) (-918.516) (-917.997) [-902.169] -- 0:02:02
589000 -- (-912.340) (-907.986) (-922.342) [-902.860] * (-910.316) (-910.819) (-909.452) [-910.737] -- 0:02:02
589500 -- (-924.991) [-904.321] (-901.127) (-918.448) * (-910.783) (-906.303) (-920.862) [-909.505] -- 0:02:02
590000 -- (-916.414) (-910.879) [-903.149] (-905.660) * (-907.049) [-910.224] (-906.883) (-926.099) -- 0:02:02
Average standard deviation of split frequencies: 0.010249
590500 -- (-915.007) (-913.293) [-902.298] (-904.955) * [-911.031] (-906.609) (-904.694) (-912.117) -- 0:02:02
591000 -- (-914.852) (-913.818) [-907.958] (-910.279) * (-921.328) [-911.745] (-907.215) (-907.436) -- 0:02:01
591500 -- [-910.273] (-919.095) (-908.788) (-912.560) * (-920.056) [-903.426] (-915.432) (-918.021) -- 0:02:01
592000 -- [-913.477] (-916.078) (-908.742) (-911.844) * [-911.379] (-912.733) (-908.382) (-906.660) -- 0:02:01
592500 -- (-914.120) (-927.167) [-905.164] (-906.171) * (-912.623) (-904.388) (-910.755) [-906.788] -- 0:02:01
593000 -- [-906.268] (-916.117) (-915.801) (-910.409) * [-906.155] (-914.434) (-923.471) (-910.831) -- 0:02:01
593500 -- (-919.821) (-917.122) [-902.876] (-918.252) * [-911.664] (-915.094) (-904.611) (-914.021) -- 0:02:01
594000 -- [-903.722] (-919.960) (-918.601) (-911.629) * (-917.269) (-910.889) [-903.761] (-912.517) -- 0:02:00
594500 -- [-909.696] (-922.049) (-909.907) (-916.200) * (-923.224) (-918.118) (-908.057) [-910.883] -- 0:02:00
595000 -- (-904.510) [-917.051] (-908.774) (-916.391) * (-913.693) [-909.638] (-909.931) (-910.639) -- 0:02:00
Average standard deviation of split frequencies: 0.010282
595500 -- (-911.444) [-907.792] (-908.372) (-905.923) * (-917.490) (-911.499) [-904.096] (-908.205) -- 0:02:00
596000 -- (-912.410) (-924.720) (-907.477) [-905.124] * (-915.981) (-916.974) [-904.885] (-924.172) -- 0:02:00
596500 -- (-916.291) (-908.175) (-915.028) [-908.275] * [-905.190] (-922.620) (-911.711) (-913.173) -- 0:02:00
597000 -- (-905.542) (-920.446) [-908.938] (-914.161) * (-910.760) (-925.545) (-910.470) [-914.169] -- 0:02:00
597500 -- [-908.484] (-909.220) (-914.927) (-923.561) * [-906.986] (-925.053) (-908.698) (-909.859) -- 0:01:59
598000 -- [-914.749] (-912.081) (-918.455) (-918.844) * (-915.258) (-912.914) (-904.934) [-902.101] -- 0:01:59
598500 -- [-912.818] (-921.272) (-913.849) (-904.446) * [-912.422] (-911.132) (-907.842) (-909.215) -- 0:02:00
599000 -- [-902.186] (-919.677) (-901.591) (-909.003) * [-912.590] (-903.089) (-915.365) (-915.038) -- 0:01:59
599500 -- (-913.545) [-910.143] (-918.265) (-918.726) * (-912.039) (-904.520) (-913.727) [-920.844] -- 0:01:59
600000 -- [-902.403] (-910.825) (-903.739) (-916.055) * (-906.581) [-909.041] (-917.046) (-919.981) -- 0:01:59
Average standard deviation of split frequencies: 0.010946
600500 -- (-907.525) (-905.805) (-909.217) [-911.353] * [-899.310] (-916.698) (-914.416) (-908.262) -- 0:01:59
601000 -- (-919.168) (-917.503) [-909.575] (-918.276) * [-917.114] (-912.741) (-919.150) (-909.783) -- 0:01:58
601500 -- (-915.771) (-913.254) (-911.298) [-912.508] * [-907.915] (-924.786) (-912.957) (-913.147) -- 0:01:58
602000 -- (-919.922) (-906.664) (-909.867) [-907.415] * (-905.858) (-915.071) [-904.693] (-928.799) -- 0:01:59
602500 -- [-908.178] (-907.800) (-907.198) (-909.696) * (-921.672) (-901.124) [-902.979] (-917.191) -- 0:01:58
603000 -- (-913.339) [-905.533] (-911.783) (-908.690) * (-905.199) [-906.538] (-908.373) (-909.266) -- 0:01:58
603500 -- (-913.472) (-914.381) [-912.281] (-924.493) * (-906.130) (-927.120) (-913.038) [-912.619] -- 0:01:58
604000 -- [-908.320] (-920.413) (-927.821) (-915.601) * (-914.915) (-920.529) [-908.083] (-909.542) -- 0:01:58
604500 -- (-905.798) [-908.949] (-913.968) (-918.993) * [-906.488] (-914.046) (-910.802) (-915.818) -- 0:01:57
605000 -- [-908.891] (-908.705) (-913.113) (-918.326) * (-917.809) (-914.497) (-917.947) [-912.758] -- 0:01:57
Average standard deviation of split frequencies: 0.011505
605500 -- [-911.420] (-915.237) (-910.004) (-912.706) * [-914.584] (-908.862) (-919.812) (-911.909) -- 0:01:57
606000 -- (-911.962) [-907.237] (-907.208) (-916.528) * (-905.958) (-921.523) (-916.689) [-904.543] -- 0:01:57
606500 -- (-911.204) (-913.964) [-904.737] (-920.997) * [-907.824] (-911.640) (-909.820) (-913.853) -- 0:01:57
607000 -- (-908.193) (-908.819) (-926.450) [-912.290] * (-909.121) (-906.618) [-916.742] (-912.210) -- 0:01:57
607500 -- [-911.802] (-914.479) (-917.760) (-916.544) * [-907.454] (-905.749) (-926.359) (-910.734) -- 0:01:56
608000 -- (-925.221) [-911.911] (-925.074) (-913.955) * (-907.528) (-915.097) [-913.383] (-904.634) -- 0:01:56
608500 -- (-917.911) [-917.973] (-912.389) (-919.640) * (-908.177) (-924.537) [-907.090] (-920.030) -- 0:01:56
609000 -- (-907.688) (-910.339) [-904.829] (-916.446) * (-925.454) (-917.510) (-911.995) [-903.499] -- 0:01:56
609500 -- (-905.018) [-908.965] (-905.926) (-919.428) * (-911.837) (-924.625) [-906.814] (-907.365) -- 0:01:56
610000 -- (-904.668) [-899.297] (-902.445) (-916.145) * (-915.264) (-916.027) (-909.952) [-901.248] -- 0:01:56
Average standard deviation of split frequencies: 0.011498
610500 -- [-904.531] (-904.430) (-907.079) (-918.038) * (-908.929) (-926.268) [-909.922] (-909.492) -- 0:01:56
611000 -- (-910.093) (-906.303) [-904.477] (-905.920) * (-904.562) (-922.336) (-915.116) [-912.753] -- 0:01:55
611500 -- (-901.762) (-904.626) (-915.932) [-904.662] * [-908.203] (-915.492) (-927.738) (-916.465) -- 0:01:55
612000 -- (-909.438) (-912.241) (-906.559) [-906.988] * (-915.172) (-918.747) (-915.702) [-904.076] -- 0:01:56
612500 -- [-909.721] (-908.064) (-902.747) (-909.467) * (-910.992) [-910.576] (-905.498) (-905.933) -- 0:01:55
613000 -- (-913.383) (-910.548) [-902.561] (-907.687) * (-906.094) (-917.709) [-912.696] (-914.733) -- 0:01:55
613500 -- (-915.558) (-910.352) [-900.196] (-912.116) * (-913.176) (-917.774) [-908.740] (-913.429) -- 0:01:55
614000 -- (-911.971) [-906.938] (-915.159) (-900.029) * (-909.235) (-906.310) (-903.543) [-897.685] -- 0:01:55
614500 -- (-911.711) [-906.247] (-912.107) (-914.568) * (-918.498) (-914.946) (-911.171) [-906.042] -- 0:01:54
615000 -- (-913.379) (-907.586) (-908.563) [-904.495] * (-915.414) (-906.653) (-913.424) [-904.470] -- 0:01:54
Average standard deviation of split frequencies: 0.012244
615500 -- (-910.708) (-920.228) (-904.577) [-909.557] * (-909.957) [-897.860] (-916.460) (-915.309) -- 0:01:54
616000 -- [-905.803] (-914.969) (-908.171) (-904.744) * (-917.381) (-910.462) (-907.842) [-905.495] -- 0:01:54
616500 -- (-914.797) (-923.012) [-911.561] (-909.816) * [-913.477] (-908.658) (-907.404) (-907.384) -- 0:01:54
617000 -- (-907.064) (-913.094) [-911.864] (-909.340) * [-907.022] (-900.345) (-923.631) (-915.238) -- 0:01:54
617500 -- (-915.120) (-918.694) (-917.891) [-905.472] * (-909.110) [-910.201] (-910.078) (-907.312) -- 0:01:53
618000 -- (-908.328) [-910.162] (-922.602) (-907.579) * [-903.753] (-910.579) (-912.453) (-906.429) -- 0:01:53
618500 -- (-910.902) (-916.661) [-908.661] (-904.262) * (-903.361) (-909.803) [-905.510] (-908.906) -- 0:01:53
619000 -- [-906.602] (-913.623) (-907.928) (-914.099) * (-914.472) [-910.213] (-912.665) (-914.499) -- 0:01:53
619500 -- [-909.154] (-911.284) (-913.823) (-912.685) * (-903.758) (-915.531) [-911.388] (-913.902) -- 0:01:53
620000 -- (-920.747) [-902.650] (-915.363) (-911.753) * (-907.869) (-909.016) (-917.831) [-912.677] -- 0:01:53
Average standard deviation of split frequencies: 0.012832
620500 -- (-917.590) [-911.901] (-904.896) (-907.734) * (-911.791) [-911.321] (-910.787) (-908.634) -- 0:01:53
621000 -- (-922.108) [-905.175] (-912.537) (-920.713) * [-908.237] (-916.321) (-909.249) (-905.086) -- 0:01:52
621500 -- (-919.537) (-914.745) (-916.112) [-913.981] * (-909.931) (-915.410) (-917.255) [-907.180] -- 0:01:52
622000 -- (-916.188) [-907.370] (-922.851) (-907.226) * (-907.018) (-906.645) [-901.402] (-914.924) -- 0:01:53
622500 -- (-917.681) (-902.066) (-918.563) [-904.554] * [-907.753] (-906.811) (-913.064) (-913.870) -- 0:01:52
623000 -- (-910.985) (-900.035) [-905.765] (-912.822) * (-901.541) (-911.222) [-917.846] (-915.080) -- 0:01:52
623500 -- (-909.921) (-905.159) (-909.902) [-910.498] * (-909.855) (-912.946) (-919.338) [-913.941] -- 0:01:52
624000 -- [-913.736] (-912.493) (-915.609) (-924.249) * (-908.836) [-911.540] (-933.411) (-918.884) -- 0:01:52
624500 -- (-920.160) [-910.283] (-923.132) (-906.681) * [-918.519] (-916.407) (-913.944) (-912.904) -- 0:01:51
625000 -- (-907.663) [-907.876] (-915.234) (-907.377) * (-903.792) (-920.027) [-910.849] (-908.908) -- 0:01:51
Average standard deviation of split frequencies: 0.011890
625500 -- (-900.228) [-905.999] (-913.275) (-909.125) * (-906.351) (-914.600) (-917.396) [-905.932] -- 0:01:51
626000 -- (-902.484) (-913.473) [-905.772] (-915.537) * (-912.292) [-908.762] (-917.826) (-917.483) -- 0:01:51
626500 -- (-916.738) [-917.413] (-910.153) (-905.872) * (-909.153) [-917.166] (-934.078) (-923.330) -- 0:01:51
627000 -- (-907.630) (-912.715) (-909.482) [-904.335] * [-911.003] (-903.581) (-910.352) (-916.205) -- 0:01:51
627500 -- (-914.168) (-923.384) [-909.159] (-903.656) * [-910.341] (-913.473) (-922.204) (-908.922) -- 0:01:51
628000 -- (-904.754) (-920.673) (-911.746) [-912.772] * (-911.177) (-915.232) (-911.331) [-900.707] -- 0:01:50
628500 -- [-916.543] (-918.352) (-904.348) (-927.026) * [-921.077] (-921.343) (-906.992) (-908.040) -- 0:01:50
629000 -- (-912.177) (-905.109) [-900.185] (-911.224) * (-912.580) (-912.850) (-901.740) [-903.389] -- 0:01:50
629500 -- (-908.627) [-919.766] (-905.922) (-911.010) * [-908.178] (-910.238) (-921.325) (-908.718) -- 0:01:50
630000 -- (-902.078) (-915.982) [-910.474] (-911.624) * (-913.621) (-909.704) (-913.918) [-898.486] -- 0:01:50
Average standard deviation of split frequencies: 0.012668
630500 -- (-912.669) [-912.507] (-910.434) (-915.096) * (-910.034) [-915.134] (-913.391) (-910.906) -- 0:01:50
631000 -- (-913.038) (-917.532) (-908.352) [-912.345] * (-920.142) (-921.668) (-908.058) [-902.933] -- 0:01:49
631500 -- [-903.152] (-915.974) (-913.616) (-915.208) * (-927.014) (-910.493) [-906.984] (-910.888) -- 0:01:49
632000 -- (-909.465) [-905.149] (-921.087) (-921.038) * (-914.685) (-922.775) (-906.733) [-907.787] -- 0:01:49
632500 -- (-912.614) (-907.624) [-904.536] (-917.324) * (-922.094) [-907.140] (-914.236) (-910.849) -- 0:01:49
633000 -- [-917.488] (-919.443) (-914.369) (-907.670) * (-916.180) [-909.511] (-911.499) (-911.715) -- 0:01:49
633500 -- (-916.839) (-907.997) (-914.719) [-905.038] * (-910.096) (-910.591) (-908.513) [-913.479] -- 0:01:49
634000 -- [-906.013] (-910.729) (-912.462) (-904.674) * (-904.567) (-908.972) [-908.054] (-910.608) -- 0:01:49
634500 -- (-914.408) [-908.223] (-911.697) (-910.391) * (-917.608) (-915.901) [-909.596] (-911.937) -- 0:01:48
635000 -- (-915.052) [-907.936] (-907.974) (-915.925) * (-925.221) [-905.430] (-913.304) (-916.654) -- 0:01:48
Average standard deviation of split frequencies: 0.012952
635500 -- (-902.580) [-907.068] (-913.562) (-902.320) * (-918.074) (-905.382) [-911.617] (-908.344) -- 0:01:48
636000 -- (-906.181) (-908.551) [-913.367] (-922.888) * [-906.027] (-911.767) (-905.836) (-914.529) -- 0:01:48
636500 -- (-902.534) [-906.205] (-912.701) (-913.300) * (-907.231) (-918.880) (-906.537) [-905.721] -- 0:01:48
637000 -- [-907.785] (-908.565) (-914.177) (-906.194) * (-910.131) (-913.899) [-905.860] (-914.582) -- 0:01:48
637500 -- [-905.714] (-923.521) (-916.129) (-905.519) * (-913.845) [-909.949] (-903.643) (-907.920) -- 0:01:48
638000 -- (-903.235) (-915.580) [-905.443] (-911.142) * (-916.205) (-902.966) (-912.753) [-908.931] -- 0:01:47
638500 -- (-909.364) (-915.673) [-909.676] (-915.505) * (-903.855) [-901.784] (-911.610) (-909.810) -- 0:01:47
639000 -- (-904.116) (-915.136) (-928.289) [-910.019] * (-903.788) (-923.637) (-911.705) [-907.960] -- 0:01:47
639500 -- (-904.030) [-911.264] (-912.450) (-917.914) * (-902.913) [-908.061] (-918.533) (-910.804) -- 0:01:47
640000 -- (-910.045) (-925.915) (-908.657) [-907.111] * (-910.496) (-909.833) (-909.183) [-913.107] -- 0:01:47
Average standard deviation of split frequencies: 0.012121
640500 -- (-911.075) (-915.402) [-903.702] (-907.644) * (-906.180) (-911.291) (-918.820) [-906.404] -- 0:01:47
641000 -- [-906.758] (-912.769) (-907.013) (-918.615) * (-913.734) [-905.413] (-919.800) (-915.754) -- 0:01:46
641500 -- (-916.748) (-911.765) [-909.196] (-911.416) * (-923.214) [-910.646] (-906.687) (-909.653) -- 0:01:46
642000 -- (-907.094) [-911.141] (-911.082) (-911.687) * (-903.814) (-917.012) (-908.661) [-917.625] -- 0:01:46
642500 -- (-912.047) [-900.728] (-909.289) (-907.338) * (-911.369) (-906.601) (-919.025) [-909.423] -- 0:01:46
643000 -- (-917.018) (-913.188) [-907.091] (-909.330) * (-914.295) (-910.750) (-917.594) [-911.325] -- 0:01:46
643500 -- (-917.165) [-913.723] (-906.842) (-919.512) * (-926.003) (-907.812) (-906.672) [-915.439] -- 0:01:46
644000 -- [-910.501] (-908.682) (-917.015) (-911.145) * (-913.571) [-911.402] (-907.716) (-914.625) -- 0:01:46
644500 -- (-918.899) (-922.878) (-919.218) [-908.206] * (-906.412) [-909.389] (-921.622) (-911.368) -- 0:01:45
645000 -- (-917.681) [-905.780] (-915.588) (-913.551) * [-904.294] (-914.096) (-910.331) (-914.492) -- 0:01:45
Average standard deviation of split frequencies: 0.012444
645500 -- (-921.960) (-910.195) [-902.072] (-910.873) * (-906.149) (-925.122) [-908.767] (-910.375) -- 0:01:45
646000 -- (-925.001) (-906.848) [-900.326] (-902.688) * (-911.374) (-907.657) (-908.554) [-915.973] -- 0:01:45
646500 -- (-918.001) (-921.674) (-912.597) [-907.306] * (-915.490) [-901.111] (-908.585) (-920.062) -- 0:01:45
647000 -- (-913.315) (-914.037) [-905.341] (-913.904) * (-904.430) (-902.128) [-916.779] (-913.734) -- 0:01:45
647500 -- (-914.809) (-919.577) (-906.136) [-904.975] * [-907.963] (-914.542) (-910.727) (-913.836) -- 0:01:45
648000 -- (-908.281) [-907.093] (-920.313) (-910.362) * (-913.085) [-906.247] (-902.553) (-910.936) -- 0:01:44
648500 -- (-919.193) (-911.929) [-897.078] (-910.986) * (-909.766) (-913.810) [-900.587] (-915.671) -- 0:01:44
649000 -- [-905.551] (-918.483) (-904.681) (-918.553) * (-906.628) (-921.624) [-903.235] (-915.939) -- 0:01:44
649500 -- (-902.258) (-913.068) [-904.808] (-900.758) * (-913.129) (-909.096) [-913.205] (-910.551) -- 0:01:44
650000 -- [-905.693] (-918.403) (-919.779) (-905.657) * (-907.691) (-915.352) (-913.271) [-908.217] -- 0:01:44
Average standard deviation of split frequencies: 0.012011
650500 -- (-908.646) [-906.060] (-916.110) (-912.337) * [-913.047] (-913.838) (-909.345) (-905.049) -- 0:01:44
651000 -- (-911.061) (-914.004) (-909.617) [-902.280] * (-902.341) (-909.139) [-910.129] (-908.503) -- 0:01:44
651500 -- (-909.469) [-899.992] (-918.134) (-909.941) * [-913.362] (-912.466) (-905.390) (-906.290) -- 0:01:43
652000 -- [-911.678] (-909.474) (-915.846) (-912.897) * (-914.277) (-909.760) (-905.673) [-906.281] -- 0:01:43
652500 -- (-919.172) (-914.587) [-909.657] (-912.867) * (-910.337) (-910.254) (-905.271) [-907.854] -- 0:01:43
653000 -- (-932.710) (-915.569) (-910.229) [-902.899] * (-907.277) (-908.500) (-910.104) [-900.451] -- 0:01:43
653500 -- (-916.683) (-906.799) [-911.100] (-902.461) * (-919.344) (-905.733) [-908.283] (-929.602) -- 0:01:43
654000 -- (-917.311) (-917.591) (-918.807) [-902.697] * (-907.290) (-914.535) [-904.639] (-904.814) -- 0:01:43
654500 -- (-913.378) (-914.839) (-912.903) [-908.576] * (-906.321) [-918.046] (-905.726) (-906.209) -- 0:01:42
655000 -- (-919.643) (-909.672) (-928.992) [-908.691] * (-910.737) (-925.994) [-908.446] (-908.443) -- 0:01:42
Average standard deviation of split frequencies: 0.011914
655500 -- (-922.777) (-925.296) [-917.368] (-910.003) * (-908.855) (-909.089) [-907.595] (-907.592) -- 0:01:42
656000 -- (-913.970) (-917.434) (-914.240) [-904.364] * (-904.497) (-906.733) (-904.447) [-905.706] -- 0:01:42
656500 -- (-910.729) [-909.122] (-927.580) (-907.749) * (-926.531) [-908.848] (-913.140) (-921.035) -- 0:01:42
657000 -- (-912.120) (-909.434) (-919.424) [-906.853] * (-913.022) (-916.521) (-907.185) [-899.357] -- 0:01:42
657500 -- [-902.825] (-907.251) (-910.811) (-908.380) * (-911.320) (-925.217) [-912.079] (-915.120) -- 0:01:42
658000 -- [-903.802] (-914.757) (-910.445) (-905.620) * [-916.885] (-907.263) (-920.808) (-908.059) -- 0:01:41
658500 -- (-903.949) [-910.979] (-913.461) (-913.116) * [-918.964] (-916.994) (-906.499) (-910.633) -- 0:01:41
659000 -- [-903.490] (-913.699) (-904.705) (-913.057) * (-917.582) (-913.748) [-903.797] (-909.281) -- 0:01:41
659500 -- (-903.128) (-913.941) [-909.196] (-912.761) * (-915.117) [-909.905] (-906.426) (-913.172) -- 0:01:41
660000 -- [-908.453] (-912.636) (-909.259) (-910.448) * (-914.115) [-905.637] (-915.943) (-913.634) -- 0:01:41
Average standard deviation of split frequencies: 0.011604
660500 -- (-924.958) (-919.553) [-913.991] (-912.005) * (-909.627) [-910.060] (-908.997) (-916.802) -- 0:01:41
661000 -- (-910.400) (-910.876) (-912.072) [-913.642] * (-907.094) (-913.579) (-908.157) [-909.544] -- 0:01:41
661500 -- (-913.220) (-916.940) (-906.360) [-909.244] * (-913.696) (-905.669) [-900.975] (-910.518) -- 0:01:40
662000 -- (-910.015) (-902.498) [-909.133] (-912.769) * (-915.393) (-908.541) [-904.693] (-908.328) -- 0:01:40
662500 -- (-921.956) (-902.661) (-911.798) [-906.520] * (-907.161) (-907.600) [-913.719] (-912.138) -- 0:01:40
663000 -- [-909.921] (-913.759) (-926.600) (-910.902) * (-913.884) (-917.408) [-903.781] (-906.089) -- 0:01:40
663500 -- (-916.333) [-913.959] (-918.420) (-908.490) * (-907.044) (-906.909) [-920.138] (-909.044) -- 0:01:40
664000 -- (-906.386) (-900.877) [-904.786] (-904.994) * (-913.962) (-906.715) (-917.857) [-911.135] -- 0:01:40
664500 -- [-907.497] (-920.617) (-913.844) (-907.738) * (-920.365) (-912.845) [-904.084] (-915.473) -- 0:01:39
665000 -- [-913.358] (-931.770) (-905.788) (-915.931) * (-908.297) [-907.124] (-911.321) (-913.509) -- 0:01:39
Average standard deviation of split frequencies: 0.011623
665500 -- (-908.702) [-908.293] (-910.394) (-912.083) * [-901.355] (-906.945) (-910.673) (-905.095) -- 0:01:39
666000 -- (-904.861) [-901.915] (-915.950) (-914.164) * (-907.133) (-911.397) [-908.363] (-909.716) -- 0:01:39
666500 -- (-905.810) [-903.091] (-919.308) (-907.156) * (-909.930) [-911.227] (-906.654) (-918.627) -- 0:01:39
667000 -- (-907.973) [-907.862] (-915.719) (-911.241) * (-905.346) (-906.353) (-909.974) [-910.872] -- 0:01:39
667500 -- (-912.435) (-908.919) (-903.482) [-903.874] * [-909.304] (-908.046) (-907.813) (-906.995) -- 0:01:39
668000 -- (-910.127) (-916.344) (-920.458) [-906.059] * (-905.489) (-911.139) [-907.216] (-915.561) -- 0:01:38
668500 -- (-917.418) [-908.564] (-913.898) (-909.570) * (-912.951) (-902.649) (-923.902) [-914.553] -- 0:01:38
669000 -- (-908.288) (-917.667) (-909.721) [-909.185] * (-907.677) (-910.926) (-900.996) [-901.944] -- 0:01:38
669500 -- (-904.081) (-909.912) (-908.978) [-900.605] * (-913.827) (-906.477) (-901.001) [-900.207] -- 0:01:38
670000 -- (-901.503) (-912.269) (-904.256) [-906.305] * (-910.662) (-906.976) [-904.449] (-913.714) -- 0:01:38
Average standard deviation of split frequencies: 0.011653
670500 -- (-907.960) [-908.100] (-912.249) (-902.805) * [-907.595] (-912.718) (-907.290) (-916.952) -- 0:01:38
671000 -- [-918.777] (-908.710) (-912.380) (-903.543) * [-912.150] (-908.955) (-908.786) (-916.454) -- 0:01:38
671500 -- (-912.605) (-913.976) [-909.346] (-916.751) * (-912.604) (-912.670) [-912.834] (-930.435) -- 0:01:37
672000 -- (-913.692) (-921.412) (-912.300) [-909.569] * (-916.920) (-903.667) [-908.441] (-920.542) -- 0:01:37
672500 -- [-906.638] (-911.441) (-907.268) (-911.869) * (-919.705) [-913.021] (-905.535) (-914.317) -- 0:01:37
673000 -- (-905.926) (-916.110) [-907.919] (-911.469) * (-911.649) (-917.689) [-913.258] (-914.355) -- 0:01:37
673500 -- (-904.110) (-918.749) (-909.730) [-903.541] * (-910.638) (-904.211) [-914.640] (-913.395) -- 0:01:37
674000 -- (-923.690) [-909.192] (-905.281) (-906.569) * (-912.029) [-905.964] (-914.111) (-915.741) -- 0:01:37
674500 -- (-911.252) [-917.355] (-917.324) (-907.327) * (-911.661) (-908.985) [-916.296] (-911.101) -- 0:01:36
675000 -- (-915.983) (-907.592) [-907.468] (-903.307) * (-914.964) [-904.906] (-918.070) (-911.194) -- 0:01:36
Average standard deviation of split frequencies: 0.011671
675500 -- (-907.560) (-924.342) [-900.823] (-914.922) * [-913.350] (-908.586) (-901.261) (-906.074) -- 0:01:36
676000 -- (-909.134) (-918.668) (-914.518) [-910.523] * (-913.497) (-908.469) (-906.833) [-904.500] -- 0:01:36
676500 -- [-906.797] (-915.616) (-913.944) (-918.403) * (-909.501) (-914.151) (-910.393) [-901.699] -- 0:01:36
677000 -- [-904.642] (-928.321) (-910.846) (-905.224) * (-911.229) (-913.012) [-904.911] (-919.778) -- 0:01:36
677500 -- [-902.381] (-919.393) (-908.992) (-916.714) * [-909.115] (-906.582) (-906.533) (-908.812) -- 0:01:36
678000 -- (-914.411) [-911.325] (-908.662) (-910.836) * [-908.888] (-903.884) (-906.559) (-909.646) -- 0:01:35
678500 -- (-913.912) (-911.957) (-913.109) [-907.066] * (-910.316) (-913.955) [-909.018] (-907.380) -- 0:01:35
679000 -- (-913.144) (-920.294) (-905.115) [-906.322] * (-916.720) (-914.075) [-908.609] (-919.487) -- 0:01:35
679500 -- [-913.983] (-904.900) (-908.550) (-911.910) * (-906.785) [-911.509] (-913.696) (-911.364) -- 0:01:35
680000 -- (-912.340) (-912.230) [-903.194] (-917.585) * (-911.498) (-902.741) [-907.849] (-918.550) -- 0:01:35
Average standard deviation of split frequencies: 0.011591
680500 -- (-903.738) [-905.783] (-904.353) (-910.894) * (-913.984) [-905.807] (-917.191) (-903.011) -- 0:01:35
681000 -- (-906.002) [-912.340] (-911.943) (-912.922) * (-923.056) (-913.476) (-913.336) [-912.268] -- 0:01:35
681500 -- (-916.132) (-915.929) [-909.863] (-915.162) * (-911.110) [-910.519] (-912.997) (-917.509) -- 0:01:34
682000 -- (-912.396) [-910.700] (-917.887) (-918.855) * [-912.097] (-918.942) (-908.631) (-916.883) -- 0:01:34
682500 -- (-909.663) (-908.753) [-902.799] (-931.065) * (-906.033) [-908.208] (-918.989) (-918.047) -- 0:01:34
683000 -- (-906.439) (-913.629) [-910.291] (-921.089) * (-913.604) (-911.909) [-906.466] (-908.835) -- 0:01:34
683500 -- (-905.277) (-909.611) [-908.838] (-924.301) * (-909.914) (-915.612) (-909.193) [-910.345] -- 0:01:34
684000 -- (-915.243) [-907.960] (-928.481) (-915.342) * (-915.676) (-909.954) (-914.177) [-906.471] -- 0:01:34
684500 -- (-912.620) [-907.330] (-914.208) (-917.541) * (-923.541) (-918.268) (-912.805) [-904.734] -- 0:01:34
685000 -- [-914.479] (-918.134) (-913.752) (-904.626) * (-926.269) (-920.718) (-906.294) [-903.320] -- 0:01:33
Average standard deviation of split frequencies: 0.012405
685500 -- (-916.058) (-914.344) (-913.763) [-913.990] * [-914.388] (-915.643) (-909.460) (-913.385) -- 0:01:33
686000 -- (-917.601) [-909.618] (-914.971) (-909.198) * (-911.673) (-917.654) [-909.058] (-905.484) -- 0:01:33
686500 -- [-913.172] (-913.246) (-929.403) (-906.279) * [-905.838] (-928.844) (-917.258) (-917.548) -- 0:01:33
687000 -- (-916.660) (-915.250) (-911.857) [-911.033] * [-906.170] (-916.617) (-917.642) (-902.230) -- 0:01:33
687500 -- [-903.946] (-915.146) (-924.669) (-919.155) * (-911.180) (-920.190) (-910.443) [-901.745] -- 0:01:33
688000 -- (-906.476) (-912.391) (-918.760) [-908.930] * [-909.561] (-916.585) (-912.150) (-904.738) -- 0:01:32
688500 -- (-917.335) (-906.571) (-918.678) [-906.096] * [-907.421] (-916.853) (-915.384) (-908.698) -- 0:01:32
689000 -- [-907.850] (-916.619) (-917.028) (-914.955) * (-912.873) (-912.246) (-915.563) [-906.363] -- 0:01:32
689500 -- (-916.808) (-905.469) (-911.129) [-909.825] * [-907.326] (-910.195) (-903.850) (-914.124) -- 0:01:32
690000 -- (-914.168) (-912.855) [-906.475] (-916.155) * [-900.155] (-912.915) (-913.251) (-913.404) -- 0:01:32
Average standard deviation of split frequencies: 0.012106
690500 -- (-911.577) (-920.154) (-914.455) [-899.185] * [-901.889] (-910.058) (-922.732) (-910.088) -- 0:01:32
691000 -- (-910.197) (-906.555) (-906.700) [-899.367] * (-901.900) (-909.042) [-904.692] (-915.928) -- 0:01:32
691500 -- (-905.734) [-908.715] (-912.119) (-908.679) * (-913.976) (-906.797) [-900.564] (-919.116) -- 0:01:31
692000 -- (-913.930) (-914.164) (-909.924) [-908.950] * (-911.775) (-909.927) [-908.359] (-908.958) -- 0:01:31
692500 -- (-910.027) (-917.437) [-907.949] (-909.907) * (-903.680) (-916.282) [-912.638] (-918.328) -- 0:01:31
693000 -- (-909.175) (-913.054) [-911.529] (-909.472) * (-907.879) [-906.538] (-912.713) (-912.561) -- 0:01:31
693500 -- (-912.176) [-907.791] (-914.411) (-917.246) * [-911.148] (-922.244) (-912.040) (-913.277) -- 0:01:31
694000 -- (-916.772) (-907.020) [-905.804] (-920.666) * (-911.893) [-908.648] (-922.180) (-903.272) -- 0:01:31
694500 -- (-906.617) (-911.509) (-913.984) [-910.480] * [-901.983] (-911.282) (-909.844) (-906.261) -- 0:01:31
695000 -- [-909.537] (-910.554) (-909.334) (-907.864) * (-906.818) [-903.616] (-909.809) (-908.603) -- 0:01:30
Average standard deviation of split frequencies: 0.012120
695500 -- (-916.859) [-903.639] (-907.228) (-916.110) * [-905.922] (-908.234) (-909.133) (-910.703) -- 0:01:30
696000 -- (-921.514) (-912.555) (-915.009) [-907.797] * [-911.374] (-902.737) (-912.785) (-917.996) -- 0:01:30
696500 -- [-912.852] (-915.718) (-931.843) (-904.496) * (-914.707) [-901.751] (-912.377) (-914.114) -- 0:01:30
697000 -- [-911.756] (-907.395) (-911.768) (-922.232) * (-916.953) (-913.624) [-906.138] (-905.167) -- 0:01:30
697500 -- (-923.677) [-903.866] (-910.613) (-904.991) * (-909.117) [-907.900] (-907.186) (-916.043) -- 0:01:30
698000 -- [-908.149] (-917.340) (-912.138) (-911.935) * (-905.539) [-909.793] (-904.746) (-910.286) -- 0:01:29
698500 -- (-913.477) (-912.073) (-912.722) [-904.979] * [-904.073] (-908.950) (-907.781) (-918.806) -- 0:01:29
699000 -- (-907.381) (-908.173) (-905.378) [-911.596] * (-912.542) (-910.012) (-912.085) [-903.734] -- 0:01:29
699500 -- (-919.060) [-901.268] (-905.988) (-913.793) * (-916.371) [-905.734] (-919.005) (-907.927) -- 0:01:29
700000 -- (-912.154) (-904.672) (-903.949) [-897.996] * [-913.505] (-905.584) (-919.015) (-906.143) -- 0:01:29
Average standard deviation of split frequencies: 0.012075
700500 -- (-919.615) (-921.283) [-902.541] (-913.928) * (-908.933) (-912.012) [-905.168] (-906.261) -- 0:01:29
701000 -- (-913.113) [-911.486] (-914.895) (-918.178) * (-909.055) (-924.885) [-909.878] (-904.522) -- 0:01:29
701500 -- (-914.845) (-913.710) [-909.209] (-910.939) * (-913.846) [-913.639] (-905.859) (-910.470) -- 0:01:28
702000 -- (-901.383) (-912.161) [-908.522] (-914.722) * [-903.471] (-903.964) (-916.751) (-919.426) -- 0:01:28
702500 -- [-909.765] (-916.534) (-910.962) (-911.405) * (-909.126) (-905.596) [-912.599] (-910.505) -- 0:01:28
703000 -- [-904.420] (-919.746) (-915.050) (-906.691) * (-908.301) (-904.966) (-913.828) [-911.835] -- 0:01:28
703500 -- (-910.909) (-907.318) [-906.310] (-904.010) * (-912.126) (-907.357) [-915.917] (-908.073) -- 0:01:28
704000 -- (-910.971) (-914.545) (-908.888) [-906.540] * (-917.020) [-904.462] (-910.531) (-914.193) -- 0:01:28
704500 -- (-916.594) (-924.143) [-908.219] (-900.130) * (-907.822) (-904.677) [-907.588] (-909.496) -- 0:01:28
705000 -- (-908.296) (-907.416) (-915.911) [-913.740] * (-905.307) (-909.724) (-918.390) [-905.427] -- 0:01:27
Average standard deviation of split frequencies: 0.011597
705500 -- (-921.280) [-917.220] (-915.100) (-908.683) * [-904.082] (-912.339) (-917.937) (-907.361) -- 0:01:27
706000 -- [-907.192] (-907.639) (-903.375) (-909.430) * (-913.321) [-908.988] (-915.078) (-920.594) -- 0:01:27
706500 -- [-904.930] (-913.372) (-907.709) (-908.362) * [-906.403] (-915.020) (-915.942) (-908.362) -- 0:01:27
707000 -- (-911.089) (-914.369) (-912.192) [-908.629] * [-913.018] (-904.752) (-916.818) (-909.979) -- 0:01:27
707500 -- [-902.680] (-906.628) (-907.598) (-910.790) * (-919.466) (-912.447) [-913.906] (-908.001) -- 0:01:27
708000 -- (-913.463) (-904.283) [-906.970] (-920.526) * (-907.873) (-909.605) [-905.522] (-918.788) -- 0:01:27
708500 -- (-909.303) [-905.797] (-915.331) (-923.137) * (-919.298) (-911.691) (-918.476) [-907.373] -- 0:01:26
709000 -- (-911.957) (-913.452) (-904.149) [-911.234] * (-930.922) [-910.641] (-915.062) (-910.376) -- 0:01:26
709500 -- (-912.297) (-912.912) (-904.820) [-906.262] * [-909.495] (-905.828) (-917.657) (-910.800) -- 0:01:26
710000 -- (-921.509) (-908.653) (-920.691) [-910.679] * (-909.209) (-904.017) (-906.611) [-905.917] -- 0:01:26
Average standard deviation of split frequencies: 0.011277
710500 -- [-901.959] (-899.203) (-931.552) (-911.986) * (-913.124) (-909.938) [-907.381] (-919.189) -- 0:01:26
711000 -- [-908.622] (-906.104) (-917.534) (-917.052) * [-912.886] (-917.690) (-909.732) (-908.379) -- 0:01:26
711500 -- (-907.478) [-902.370] (-914.754) (-913.361) * (-900.935) (-919.515) (-929.870) [-902.272] -- 0:01:25
712000 -- [-907.574] (-912.797) (-924.886) (-915.563) * [-905.440] (-923.355) (-919.424) (-907.613) -- 0:01:25
712500 -- (-915.397) (-915.446) (-912.969) [-913.044] * [-906.190] (-914.806) (-922.209) (-905.591) -- 0:01:25
713000 -- (-910.963) [-902.024] (-907.472) (-909.199) * (-903.858) (-917.255) (-920.284) [-908.385] -- 0:01:25
713500 -- (-913.337) [-910.320] (-916.408) (-924.857) * (-910.896) [-918.469] (-921.067) (-911.706) -- 0:01:25
714000 -- (-920.619) [-913.555] (-906.561) (-911.733) * (-914.028) [-911.859] (-924.293) (-935.893) -- 0:01:25
714500 -- (-919.668) (-916.386) (-907.850) [-909.456] * [-908.066] (-917.680) (-915.779) (-910.564) -- 0:01:25
715000 -- (-909.385) (-917.751) [-909.626] (-907.118) * (-921.997) (-915.939) [-915.987] (-909.876) -- 0:01:24
Average standard deviation of split frequencies: 0.011297
715500 -- (-912.559) (-909.170) (-906.618) [-905.216] * (-916.821) [-910.472] (-921.568) (-903.073) -- 0:01:24
716000 -- (-918.612) [-904.164] (-908.698) (-918.127) * [-921.472] (-911.528) (-914.702) (-916.457) -- 0:01:24
716500 -- (-922.150) (-923.841) [-916.082] (-911.060) * (-917.800) [-909.456] (-910.400) (-914.788) -- 0:01:24
717000 -- (-916.280) (-917.578) (-909.882) [-904.807] * [-914.140] (-908.558) (-915.951) (-912.727) -- 0:01:24
717500 -- [-908.800] (-930.709) (-917.980) (-911.817) * [-910.998] (-906.547) (-905.389) (-922.552) -- 0:01:24
718000 -- [-912.173] (-912.505) (-911.603) (-913.633) * (-909.246) (-908.196) (-908.941) [-908.019] -- 0:01:24
718500 -- (-907.718) (-916.301) [-921.746] (-920.320) * (-910.102) [-907.268] (-915.971) (-919.810) -- 0:01:23
719000 -- (-915.176) [-913.800] (-905.346) (-914.382) * (-909.634) [-909.309] (-919.660) (-911.799) -- 0:01:24
719500 -- [-908.909] (-916.909) (-929.735) (-906.240) * (-903.049) (-913.086) [-908.894] (-909.775) -- 0:01:23
720000 -- (-911.523) (-916.488) [-911.114] (-917.615) * [-909.963] (-914.666) (-907.378) (-913.412) -- 0:01:23
Average standard deviation of split frequencies: 0.011361
720500 -- (-909.098) [-907.170] (-912.683) (-910.060) * [-906.277] (-912.273) (-908.014) (-910.228) -- 0:01:23
721000 -- (-907.243) (-918.088) (-915.300) [-907.485] * (-906.611) (-915.553) (-906.850) [-909.624] -- 0:01:23
721500 -- [-909.586] (-916.979) (-906.123) (-929.215) * (-911.497) [-904.614] (-916.316) (-903.501) -- 0:01:22
722000 -- (-904.309) (-912.819) [-912.031] (-915.412) * [-911.950] (-909.338) (-916.620) (-917.939) -- 0:01:22
722500 -- (-907.178) (-921.425) [-913.646] (-911.778) * (-907.729) (-903.323) [-903.598] (-911.795) -- 0:01:22
723000 -- [-909.769] (-908.890) (-912.552) (-914.564) * (-908.536) (-913.264) [-907.904] (-908.216) -- 0:01:22
723500 -- (-916.322) (-910.505) (-915.857) [-914.908] * [-909.985] (-913.347) (-913.053) (-924.215) -- 0:01:22
724000 -- (-923.203) [-903.519] (-923.409) (-901.127) * [-910.696] (-911.303) (-906.999) (-916.970) -- 0:01:22
724500 -- [-909.701] (-906.781) (-931.834) (-909.371) * [-906.774] (-922.322) (-908.181) (-912.683) -- 0:01:22
725000 -- [-910.363] (-908.699) (-917.535) (-911.342) * [-912.003] (-906.534) (-912.305) (-906.615) -- 0:01:21
Average standard deviation of split frequencies: 0.011278
725500 -- (-921.895) [-912.627] (-918.491) (-909.449) * (-911.886) [-908.841] (-907.670) (-911.292) -- 0:01:21
726000 -- (-913.755) (-910.760) (-918.087) [-906.854] * (-909.023) (-914.609) [-907.717] (-903.203) -- 0:01:21
726500 -- (-902.966) (-906.618) [-904.216] (-913.097) * (-913.899) (-917.462) [-899.212] (-908.779) -- 0:01:21
727000 -- (-909.140) (-915.886) (-915.528) [-898.143] * (-915.748) (-914.893) (-906.069) [-902.434] -- 0:01:21
727500 -- [-917.684] (-912.476) (-919.261) (-904.294) * (-911.297) (-907.589) [-901.145] (-905.455) -- 0:01:21
728000 -- (-907.526) [-905.563] (-910.925) (-925.575) * (-924.572) [-919.798] (-911.088) (-912.161) -- 0:01:21
728500 -- [-907.625] (-907.295) (-912.957) (-915.924) * (-906.241) (-907.813) (-912.173) [-904.831] -- 0:01:20
729000 -- (-908.213) [-902.732] (-922.481) (-910.615) * [-915.161] (-908.206) (-913.441) (-904.920) -- 0:01:20
729500 -- (-911.347) [-907.487] (-912.757) (-903.493) * (-906.137) (-923.379) (-923.309) [-906.732] -- 0:01:20
730000 -- [-909.032] (-902.258) (-914.168) (-912.853) * [-910.893] (-912.260) (-902.341) (-904.929) -- 0:01:20
Average standard deviation of split frequencies: 0.011409
730500 -- [-902.395] (-904.489) (-907.884) (-912.178) * (-901.526) [-911.066] (-906.765) (-907.890) -- 0:01:20
731000 -- [-911.585] (-911.026) (-904.827) (-922.255) * (-902.270) (-917.500) [-903.584] (-906.910) -- 0:01:20
731500 -- [-908.144] (-916.368) (-918.261) (-908.477) * [-902.680] (-906.337) (-909.323) (-911.243) -- 0:01:20
732000 -- (-913.606) [-908.835] (-913.407) (-912.007) * (-903.437) [-901.029] (-905.219) (-910.661) -- 0:01:19
732500 -- (-914.779) [-902.907] (-911.481) (-909.023) * [-904.082] (-910.880) (-903.482) (-914.464) -- 0:01:19
733000 -- (-915.448) [-912.110] (-917.921) (-915.228) * (-909.497) (-918.266) [-903.978] (-904.967) -- 0:01:19
733500 -- (-920.529) (-917.092) (-903.405) [-905.380] * (-902.122) (-914.016) [-900.114] (-909.560) -- 0:01:19
734000 -- (-920.796) [-902.810] (-908.407) (-908.667) * (-912.387) (-905.859) (-913.788) [-910.806] -- 0:01:19
734500 -- (-912.859) (-911.528) (-911.763) [-911.717] * (-911.716) (-915.734) (-932.110) [-904.462] -- 0:01:19
735000 -- (-916.017) (-914.556) (-913.082) [-913.571] * (-908.650) [-904.716] (-911.039) (-912.956) -- 0:01:18
Average standard deviation of split frequencies: 0.011327
735500 -- (-913.860) [-906.042] (-900.879) (-921.886) * [-917.231] (-910.812) (-910.685) (-910.003) -- 0:01:18
736000 -- (-915.961) (-912.427) (-911.930) [-907.258] * [-906.619] (-902.804) (-916.415) (-906.162) -- 0:01:18
736500 -- (-913.058) (-912.118) [-908.637] (-911.006) * [-907.516] (-911.728) (-913.045) (-910.960) -- 0:01:18
737000 -- (-911.413) (-927.539) [-909.152] (-920.941) * (-911.212) [-902.093] (-913.612) (-905.698) -- 0:01:18
737500 -- [-905.668] (-917.259) (-912.943) (-917.455) * (-915.062) (-910.672) [-910.575] (-905.266) -- 0:01:18
738000 -- (-912.583) (-906.927) (-903.752) [-905.155] * (-909.317) (-917.444) (-906.923) [-906.571] -- 0:01:18
738500 -- (-912.595) (-912.283) [-909.079] (-910.985) * (-925.109) [-905.918] (-911.390) (-908.524) -- 0:01:17
739000 -- (-914.166) (-917.270) [-910.241] (-905.181) * (-928.183) [-912.606] (-913.149) (-916.772) -- 0:01:17
739500 -- [-907.410] (-918.664) (-902.785) (-920.337) * (-910.823) (-911.012) (-917.138) [-902.538] -- 0:01:17
740000 -- (-920.717) [-906.096] (-908.365) (-911.525) * (-908.885) [-904.175] (-916.424) (-915.218) -- 0:01:17
Average standard deviation of split frequencies: 0.011155
740500 -- (-915.641) [-904.760] (-917.207) (-910.210) * (-919.321) (-902.049) (-910.652) [-900.017] -- 0:01:17
741000 -- [-911.506] (-914.513) (-934.878) (-908.024) * (-915.895) [-904.192] (-911.086) (-910.244) -- 0:01:17
741500 -- (-913.433) (-906.113) [-907.550] (-916.053) * (-919.809) (-907.118) (-906.661) [-907.997] -- 0:01:17
742000 -- (-909.695) (-907.861) (-909.313) [-902.182] * [-902.510] (-916.847) (-908.399) (-906.272) -- 0:01:16
742500 -- (-911.387) (-903.522) (-908.715) [-904.548] * [-904.111] (-906.654) (-914.064) (-905.596) -- 0:01:16
743000 -- [-906.341] (-919.746) (-914.470) (-908.982) * (-910.995) (-914.545) (-912.299) [-911.792] -- 0:01:16
743500 -- (-920.361) [-907.439] (-913.822) (-906.827) * [-898.337] (-910.774) (-924.547) (-904.692) -- 0:01:16
744000 -- (-920.588) (-906.705) [-912.821] (-906.890) * [-906.905] (-907.208) (-912.093) (-913.287) -- 0:01:16
744500 -- (-914.159) (-908.141) (-914.980) [-904.336] * (-911.934) [-907.793] (-908.535) (-907.483) -- 0:01:16
745000 -- (-913.262) [-910.665] (-908.564) (-904.711) * (-923.024) (-916.672) [-905.226] (-907.066) -- 0:01:15
Average standard deviation of split frequencies: 0.010909
745500 -- [-908.425] (-906.797) (-909.679) (-903.938) * [-903.741] (-923.046) (-913.040) (-912.010) -- 0:01:15
746000 -- (-915.007) [-908.631] (-917.096) (-910.198) * (-913.662) (-919.117) [-907.667] (-925.058) -- 0:01:15
746500 -- (-915.256) [-910.773] (-910.033) (-916.642) * (-915.003) (-914.601) (-906.594) [-911.918] -- 0:01:15
747000 -- (-908.391) (-909.703) (-917.563) [-904.144] * (-906.065) (-920.075) [-903.797] (-907.789) -- 0:01:15
747500 -- (-915.051) [-910.788] (-911.600) (-914.525) * (-908.927) (-908.888) [-905.726] (-911.493) -- 0:01:15
748000 -- (-913.118) (-915.095) [-916.217] (-912.891) * (-901.242) [-911.009] (-911.825) (-907.605) -- 0:01:15
748500 -- (-910.549) [-905.501] (-918.678) (-904.957) * (-906.495) (-908.054) (-911.056) [-906.993] -- 0:01:14
749000 -- (-913.742) (-906.471) (-910.248) [-914.852] * [-913.430] (-909.506) (-920.195) (-913.089) -- 0:01:14
749500 -- (-922.338) (-909.032) (-911.542) [-909.544] * (-914.983) (-910.498) [-906.634] (-909.492) -- 0:01:14
750000 -- (-925.290) (-915.006) [-908.551] (-915.746) * (-906.171) (-908.027) [-910.929] (-911.801) -- 0:01:14
Average standard deviation of split frequencies: 0.010543
750500 -- [-899.589] (-910.778) (-913.169) (-913.658) * (-908.996) [-909.429] (-908.117) (-906.443) -- 0:01:14
751000 -- [-901.852] (-923.040) (-915.675) (-910.776) * (-911.468) (-915.712) [-911.353] (-906.471) -- 0:01:14
751500 -- [-917.770] (-917.588) (-912.730) (-917.590) * (-922.640) (-911.249) [-904.688] (-911.509) -- 0:01:14
752000 -- (-909.393) (-929.797) [-906.258] (-910.456) * (-911.765) (-916.193) [-904.555] (-910.839) -- 0:01:13
752500 -- (-909.804) [-905.022] (-920.059) (-914.726) * (-914.364) (-908.990) [-903.350] (-915.556) -- 0:01:13
753000 -- (-906.431) (-915.017) (-917.269) [-903.732] * (-913.096) [-913.809] (-904.709) (-918.569) -- 0:01:13
753500 -- (-909.602) (-911.528) [-904.636] (-903.819) * (-905.807) [-907.187] (-910.131) (-914.990) -- 0:01:13
754000 -- (-904.372) [-908.204] (-909.300) (-913.809) * (-911.539) [-905.194] (-913.742) (-913.187) -- 0:01:13
754500 -- (-899.557) (-912.674) [-906.905] (-918.267) * (-911.703) [-901.830] (-917.304) (-921.337) -- 0:01:13
755000 -- [-905.153] (-914.069) (-909.989) (-909.716) * (-904.631) [-902.606] (-910.301) (-915.468) -- 0:01:13
Average standard deviation of split frequencies: 0.010633
755500 -- (-925.045) (-920.286) [-911.027] (-906.192) * [-905.480] (-919.010) (-908.098) (-919.586) -- 0:01:12
756000 -- (-911.099) (-911.970) (-909.744) [-906.661] * (-902.039) (-911.182) [-911.728] (-919.895) -- 0:01:12
756500 -- (-919.052) [-913.806] (-912.294) (-909.731) * [-905.629] (-919.905) (-904.989) (-925.135) -- 0:01:12
757000 -- (-910.621) (-914.544) [-911.169] (-909.584) * [-910.443] (-916.373) (-910.795) (-914.437) -- 0:01:12
757500 -- (-922.382) [-908.303] (-908.673) (-906.360) * [-904.224] (-907.217) (-918.669) (-908.976) -- 0:01:12
758000 -- (-918.289) (-913.529) [-907.573] (-910.022) * [-905.367] (-917.840) (-908.031) (-907.943) -- 0:01:12
758500 -- (-913.001) (-911.962) [-905.124] (-909.367) * (-908.080) (-913.112) (-912.016) [-906.529] -- 0:01:11
759000 -- (-908.798) (-941.097) [-904.142] (-908.788) * [-905.453] (-916.687) (-903.583) (-916.451) -- 0:01:11
759500 -- (-907.990) (-917.814) [-909.221] (-908.899) * (-915.576) [-911.989] (-909.371) (-907.191) -- 0:01:11
760000 -- (-904.103) (-911.043) [-903.953] (-908.209) * (-925.374) [-913.136] (-906.881) (-905.697) -- 0:01:11
Average standard deviation of split frequencies: 0.010829
760500 -- (-909.541) (-925.784) [-914.452] (-918.653) * (-912.181) (-913.559) [-905.551] (-912.209) -- 0:01:11
761000 -- [-912.515] (-914.328) (-913.242) (-906.264) * [-899.978] (-911.220) (-910.355) (-903.417) -- 0:01:11
761500 -- [-903.438] (-919.636) (-905.326) (-908.706) * (-902.518) (-908.645) [-908.561] (-910.643) -- 0:01:11
762000 -- [-908.724] (-920.645) (-910.164) (-916.847) * (-904.446) [-919.390] (-910.677) (-911.773) -- 0:01:10
762500 -- (-904.795) (-910.341) (-910.726) [-904.120] * [-907.927] (-912.685) (-904.680) (-905.801) -- 0:01:10
763000 -- (-918.648) (-917.216) (-918.087) [-907.492] * (-906.104) [-912.226] (-903.804) (-921.438) -- 0:01:10
763500 -- [-904.725] (-908.687) (-915.458) (-907.000) * (-916.187) (-931.059) (-915.838) [-905.808] -- 0:01:10
764000 -- [-914.637] (-915.311) (-911.209) (-910.132) * (-908.891) (-916.261) (-908.388) [-911.779] -- 0:01:10
764500 -- [-911.490] (-935.591) (-910.774) (-911.649) * (-909.017) (-908.299) (-906.356) [-905.499] -- 0:01:10
765000 -- [-909.507] (-914.151) (-912.945) (-911.896) * (-902.239) (-914.714) [-900.643] (-911.896) -- 0:01:10
Average standard deviation of split frequencies: 0.010527
765500 -- [-906.214] (-917.368) (-917.745) (-901.046) * (-910.620) (-903.389) [-906.044] (-905.796) -- 0:01:09
766000 -- [-901.270] (-908.789) (-916.308) (-910.568) * (-909.991) [-904.284] (-910.564) (-911.005) -- 0:01:09
766500 -- [-907.355] (-914.506) (-907.523) (-907.732) * (-909.400) [-905.653] (-910.344) (-921.854) -- 0:01:09
767000 -- (-909.521) (-915.739) (-905.779) [-911.526] * (-926.267) (-912.253) (-907.068) [-906.544] -- 0:01:09
767500 -- [-909.879] (-913.581) (-909.908) (-923.041) * (-910.314) [-918.042] (-914.294) (-914.874) -- 0:01:09
768000 -- (-912.485) [-907.710] (-910.610) (-913.903) * (-916.719) (-922.273) (-907.385) [-904.080] -- 0:01:09
768500 -- (-905.097) [-907.785] (-906.884) (-915.389) * (-913.121) (-916.541) [-915.548] (-912.861) -- 0:01:08
769000 -- (-913.578) [-908.285] (-908.557) (-915.023) * [-909.008] (-913.695) (-915.857) (-911.504) -- 0:01:08
769500 -- (-904.454) (-903.645) [-910.778] (-915.206) * (-911.933) [-909.387] (-898.899) (-912.408) -- 0:01:08
770000 -- [-903.665] (-908.307) (-922.436) (-919.514) * (-915.338) [-908.030] (-901.270) (-917.041) -- 0:01:08
Average standard deviation of split frequencies: 0.010817
770500 -- (-916.374) [-905.133] (-900.570) (-900.973) * (-917.963) (-916.180) [-909.071] (-913.240) -- 0:01:08
771000 -- [-910.553] (-904.510) (-910.864) (-908.259) * [-923.821] (-907.521) (-908.216) (-929.287) -- 0:01:08
771500 -- [-908.710] (-907.501) (-928.614) (-917.614) * (-906.998) [-911.005] (-900.898) (-940.444) -- 0:01:08
772000 -- (-911.780) (-917.020) [-906.331] (-905.903) * (-909.705) (-913.210) [-908.779] (-918.852) -- 0:01:07
772500 -- (-914.634) [-908.743] (-906.064) (-912.441) * (-904.506) (-908.098) [-905.506] (-920.394) -- 0:01:07
773000 -- [-910.136] (-906.374) (-907.959) (-915.944) * [-903.869] (-912.036) (-906.779) (-918.210) -- 0:01:07
773500 -- (-915.305) [-907.497] (-912.383) (-905.144) * (-904.124) [-909.223] (-910.215) (-903.688) -- 0:01:07
774000 -- (-906.137) [-908.505] (-912.081) (-921.343) * (-916.731) (-913.421) (-913.648) [-916.972] -- 0:01:07
774500 -- (-913.055) [-909.576] (-908.139) (-906.474) * (-908.755) (-905.304) (-917.001) [-919.553] -- 0:01:07
775000 -- (-907.148) (-904.063) (-917.879) [-918.821] * (-911.943) [-905.572] (-918.725) (-910.161) -- 0:01:07
Average standard deviation of split frequencies: 0.010615
775500 -- (-906.394) [-910.829] (-904.431) (-912.352) * (-909.783) [-905.448] (-908.079) (-914.508) -- 0:01:06
776000 -- (-910.688) (-914.200) [-908.719] (-924.783) * (-904.900) [-906.611] (-912.716) (-916.980) -- 0:01:06
776500 -- (-907.676) [-904.724] (-904.768) (-907.152) * [-903.465] (-911.554) (-920.535) (-917.722) -- 0:01:06
777000 -- [-907.621] (-904.870) (-913.356) (-903.878) * [-911.420] (-904.995) (-916.199) (-910.494) -- 0:01:06
777500 -- (-907.987) (-913.131) (-919.019) [-907.266] * [-914.110] (-918.841) (-912.468) (-917.704) -- 0:01:06
778000 -- (-917.899) (-906.388) (-915.587) [-906.493] * (-908.651) (-908.785) [-905.960] (-912.786) -- 0:01:06
778500 -- (-910.424) (-902.122) (-914.336) [-907.674] * (-908.716) (-910.853) [-905.339] (-912.186) -- 0:01:06
779000 -- [-906.749] (-905.254) (-922.554) (-914.980) * (-904.637) (-907.641) [-905.109] (-913.713) -- 0:01:05
779500 -- (-912.306) [-913.282] (-921.577) (-919.159) * (-909.100) (-908.977) (-908.114) [-909.978] -- 0:01:05
780000 -- (-921.988) [-900.042] (-911.604) (-913.809) * (-904.667) (-907.681) (-909.206) [-906.047] -- 0:01:05
Average standard deviation of split frequencies: 0.010424
780500 -- (-920.052) [-906.147] (-908.947) (-917.815) * [-906.475] (-913.537) (-904.447) (-913.290) -- 0:01:05
781000 -- (-922.668) (-905.991) (-913.986) [-903.828] * (-907.753) (-910.893) [-899.009] (-909.220) -- 0:01:05
781500 -- (-921.721) (-906.996) (-914.526) [-902.458] * [-903.279] (-918.410) (-907.276) (-916.292) -- 0:01:05
782000 -- (-916.584) (-911.484) [-905.277] (-914.078) * (-908.948) (-907.904) (-910.822) [-906.786] -- 0:01:04
782500 -- [-914.030] (-912.397) (-918.338) (-905.021) * (-915.118) [-907.407] (-916.291) (-916.787) -- 0:01:04
783000 -- (-922.095) [-904.501] (-915.054) (-909.184) * [-908.553] (-916.921) (-914.358) (-910.874) -- 0:01:04
783500 -- (-915.043) [-907.737] (-913.025) (-906.440) * (-915.667) [-913.953] (-919.819) (-909.452) -- 0:01:04
784000 -- (-914.230) [-916.346] (-908.662) (-910.289) * (-906.637) [-908.601] (-918.149) (-909.345) -- 0:01:04
784500 -- [-918.125] (-907.789) (-914.875) (-905.176) * (-903.381) [-909.327] (-917.938) (-915.240) -- 0:01:04
785000 -- [-908.065] (-912.425) (-910.718) (-909.673) * (-904.743) (-922.302) (-917.528) [-905.336] -- 0:01:04
Average standard deviation of split frequencies: 0.010764
785500 -- (-911.562) (-916.130) (-908.151) [-912.259] * [-902.453] (-912.089) (-910.532) (-907.156) -- 0:01:03
786000 -- (-912.422) [-912.027] (-907.308) (-922.073) * (-906.489) (-914.800) [-914.449] (-920.230) -- 0:01:03
786500 -- (-908.880) (-913.375) [-907.562] (-918.894) * [-905.740] (-910.059) (-911.345) (-911.179) -- 0:01:03
787000 -- (-911.661) (-932.006) [-912.828] (-917.826) * [-903.830] (-909.364) (-913.151) (-905.116) -- 0:01:03
787500 -- [-906.319] (-907.087) (-902.711) (-925.628) * (-905.349) (-916.401) [-908.137] (-909.183) -- 0:01:03
788000 -- (-915.396) (-911.648) [-907.183] (-911.528) * [-909.485] (-912.514) (-910.840) (-925.457) -- 0:01:03
788500 -- (-909.493) (-908.370) [-903.625] (-914.662) * (-918.614) (-912.288) (-914.743) [-913.631] -- 0:01:03
789000 -- (-925.590) (-908.793) (-900.788) [-906.696] * [-910.423] (-914.064) (-912.745) (-911.582) -- 0:01:02
789500 -- (-909.751) [-913.602] (-912.513) (-909.808) * (-910.705) [-911.231] (-910.168) (-913.179) -- 0:01:02
790000 -- [-903.494] (-912.471) (-909.401) (-913.605) * [-903.420] (-913.229) (-907.493) (-914.098) -- 0:01:02
Average standard deviation of split frequencies: 0.010826
790500 -- (-910.897) [-905.042] (-903.183) (-920.680) * (-909.605) (-910.285) (-916.450) [-910.873] -- 0:01:02
791000 -- (-920.171) [-905.250] (-911.456) (-912.051) * [-909.016] (-907.502) (-906.900) (-918.646) -- 0:01:02
791500 -- (-918.799) [-906.423] (-903.492) (-906.250) * [-900.762] (-917.561) (-918.899) (-921.616) -- 0:01:02
792000 -- (-916.409) (-920.771) [-912.191] (-906.331) * (-912.217) (-906.294) (-909.750) [-913.329] -- 0:01:01
792500 -- [-911.259] (-918.794) (-915.690) (-908.877) * (-909.053) (-907.038) [-918.781] (-917.088) -- 0:01:01
793000 -- (-911.181) (-911.052) [-906.417] (-906.780) * (-914.867) (-912.537) [-901.699] (-900.312) -- 0:01:01
793500 -- (-911.626) (-908.646) (-920.217) [-913.243] * (-910.959) [-913.120] (-906.455) (-918.470) -- 0:01:01
794000 -- (-906.923) (-911.502) (-910.020) [-908.825] * (-912.974) [-917.072] (-908.782) (-907.520) -- 0:01:01
794500 -- (-906.452) [-917.764] (-924.384) (-913.694) * [-915.391] (-907.681) (-907.987) (-901.703) -- 0:01:01
795000 -- [-903.577] (-908.902) (-915.502) (-910.045) * (-917.300) (-921.601) (-909.620) [-902.934] -- 0:01:01
Average standard deviation of split frequencies: 0.010411
795500 -- (-914.004) (-906.534) [-914.827] (-913.963) * [-909.834] (-908.903) (-910.501) (-908.380) -- 0:01:00
796000 -- (-915.592) (-910.491) (-919.321) [-905.114] * (-904.296) (-909.538) [-907.979] (-907.888) -- 0:01:00
796500 -- (-915.627) [-904.665] (-904.999) (-903.861) * (-914.991) (-911.150) [-905.852] (-916.894) -- 0:01:00
797000 -- (-917.845) [-908.465] (-909.545) (-916.025) * (-904.662) [-902.391] (-912.141) (-916.545) -- 0:01:00
797500 -- [-906.105] (-904.286) (-921.784) (-910.499) * (-905.737) (-912.669) (-905.014) [-906.741] -- 0:01:00
798000 -- (-909.051) [-903.498] (-921.836) (-905.868) * (-909.040) [-912.176] (-901.764) (-921.077) -- 0:01:00
798500 -- (-918.267) (-910.466) (-909.507) [-908.771] * (-924.268) (-904.927) [-902.189] (-913.808) -- 0:01:00
799000 -- (-917.091) (-906.011) [-907.183] (-919.338) * [-904.748] (-918.828) (-907.385) (-907.961) -- 0:00:59
799500 -- [-909.524] (-902.635) (-906.667) (-914.394) * (-902.027) (-911.645) (-908.986) [-906.979] -- 0:00:59
800000 -- (-911.412) (-907.659) [-903.635] (-907.823) * (-909.952) [-912.905] (-912.132) (-905.152) -- 0:00:59
Average standard deviation of split frequencies: 0.010319
800500 -- (-925.016) (-924.366) [-903.544] (-904.455) * (-904.270) (-911.980) [-912.653] (-913.647) -- 0:00:59
801000 -- (-912.048) [-919.701] (-911.020) (-914.656) * [-905.071] (-912.597) (-906.300) (-909.606) -- 0:00:59
801500 -- [-909.902] (-910.712) (-906.014) (-918.062) * (-915.947) [-912.749] (-911.123) (-909.465) -- 0:00:59
802000 -- (-929.818) (-912.787) [-906.695] (-911.634) * (-913.341) (-917.387) (-911.602) [-899.325] -- 0:00:59
802500 -- [-905.808] (-918.748) (-906.994) (-911.548) * [-904.861] (-911.989) (-909.852) (-911.678) -- 0:00:58
803000 -- (-914.052) [-905.497] (-906.451) (-908.660) * [-901.121] (-923.562) (-908.291) (-909.124) -- 0:00:58
803500 -- (-908.813) (-904.613) [-905.146] (-915.453) * (-901.759) [-903.805] (-912.866) (-915.144) -- 0:00:58
804000 -- (-904.775) (-910.222) (-909.788) [-903.702] * [-908.727] (-902.666) (-920.676) (-905.599) -- 0:00:58
804500 -- [-905.239] (-915.035) (-915.238) (-906.241) * (-914.910) (-906.930) (-914.076) [-905.218] -- 0:00:58
805000 -- (-907.149) [-912.830] (-920.459) (-903.256) * [-914.267] (-906.071) (-915.227) (-912.332) -- 0:00:58
Average standard deviation of split frequencies: 0.010497
805500 -- (-912.435) (-916.631) [-904.148] (-913.910) * [-903.349] (-910.313) (-912.831) (-905.191) -- 0:00:57
806000 -- [-902.939] (-910.203) (-913.357) (-908.676) * (-912.972) [-916.004] (-914.355) (-914.810) -- 0:00:57
806500 -- (-921.455) (-908.463) [-909.645] (-908.377) * (-914.283) (-913.207) (-913.669) [-901.886] -- 0:00:57
807000 -- (-907.748) [-907.391] (-901.123) (-922.567) * (-917.223) (-914.025) (-913.698) [-903.685] -- 0:00:57
807500 -- (-909.836) (-904.124) (-902.159) [-907.369] * (-904.369) (-907.131) (-906.542) [-904.041] -- 0:00:57
808000 -- (-922.067) (-911.624) [-904.410] (-914.422) * (-906.702) [-907.824] (-909.939) (-906.202) -- 0:00:57
808500 -- (-914.058) (-910.100) [-907.569] (-917.030) * (-910.428) (-906.776) [-909.412] (-918.035) -- 0:00:57
809000 -- [-909.751] (-906.310) (-912.889) (-909.267) * [-900.135] (-911.075) (-901.087) (-913.310) -- 0:00:56
809500 -- (-918.010) (-909.888) [-905.651] (-912.371) * (-901.776) (-910.608) [-903.676] (-909.832) -- 0:00:56
810000 -- (-908.048) [-908.411] (-922.279) (-911.874) * (-919.284) (-907.635) [-907.597] (-913.604) -- 0:00:56
Average standard deviation of split frequencies: 0.010406
810500 -- (-914.675) (-908.987) (-909.781) [-909.494] * (-907.673) [-904.659] (-937.426) (-908.648) -- 0:00:56
811000 -- (-907.667) (-929.029) (-926.197) [-915.246] * (-910.259) [-908.834] (-916.246) (-906.147) -- 0:00:56
811500 -- [-903.404] (-915.204) (-908.923) (-909.980) * (-909.035) (-911.129) (-914.575) [-901.495] -- 0:00:56
812000 -- (-914.059) [-907.509] (-908.171) (-909.683) * (-910.608) (-912.496) [-909.660] (-909.928) -- 0:00:56
812500 -- (-922.084) [-908.794] (-911.117) (-914.620) * [-910.156] (-916.701) (-904.554) (-905.571) -- 0:00:55
813000 -- (-927.046) [-905.563] (-908.260) (-914.434) * (-925.100) [-907.773] (-909.780) (-915.916) -- 0:00:55
813500 -- (-920.798) (-914.810) (-910.491) [-927.875] * (-904.971) [-896.943] (-921.476) (-911.424) -- 0:00:55
814000 -- [-910.592] (-920.207) (-915.582) (-921.622) * (-908.428) (-910.429) [-905.453] (-919.071) -- 0:00:55
814500 -- [-912.960] (-906.759) (-915.648) (-913.708) * (-911.471) [-911.614] (-907.582) (-924.286) -- 0:00:55
815000 -- (-911.230) (-914.059) (-920.616) [-909.071] * [-904.646] (-905.016) (-907.691) (-910.221) -- 0:00:55
Average standard deviation of split frequencies: 0.010277
815500 -- [-906.719] (-910.889) (-906.462) (-916.370) * (-909.308) (-905.046) [-911.777] (-912.556) -- 0:00:54
816000 -- [-913.476] (-916.862) (-914.664) (-901.879) * (-923.301) [-905.116] (-907.971) (-913.787) -- 0:00:54
816500 -- (-909.889) (-910.395) (-908.914) [-907.098] * (-919.025) (-905.164) [-910.668] (-912.346) -- 0:00:54
817000 -- [-911.455] (-919.105) (-916.811) (-919.808) * [-901.639] (-914.845) (-910.022) (-912.456) -- 0:00:54
817500 -- (-910.784) (-911.291) [-904.399] (-910.747) * (-912.073) [-907.985] (-901.852) (-921.687) -- 0:00:54
818000 -- [-906.036] (-906.608) (-915.986) (-909.122) * [-917.624] (-913.211) (-910.393) (-913.216) -- 0:00:54
818500 -- (-914.192) [-915.487] (-908.092) (-916.114) * (-906.045) (-922.209) [-915.963] (-918.449) -- 0:00:54
819000 -- [-917.083] (-915.315) (-905.034) (-905.684) * (-908.431) (-906.659) (-921.419) [-905.946] -- 0:00:53
819500 -- (-912.607) (-915.644) (-911.908) [-904.685] * (-909.275) (-920.243) [-907.040] (-913.443) -- 0:00:53
820000 -- (-909.844) (-916.940) (-911.263) [-910.269] * [-912.029] (-911.554) (-910.098) (-919.285) -- 0:00:53
Average standard deviation of split frequencies: 0.010311
820500 -- [-905.984] (-920.144) (-910.947) (-915.776) * (-908.156) [-911.696] (-915.941) (-904.785) -- 0:00:53
821000 -- [-906.848] (-912.428) (-918.790) (-914.074) * (-915.653) (-919.385) (-907.262) [-912.006] -- 0:00:53
821500 -- (-922.733) (-909.064) (-915.275) [-907.174] * (-913.263) [-909.056] (-904.610) (-918.574) -- 0:00:53
822000 -- (-917.460) (-910.832) [-908.426] (-923.012) * (-904.747) (-914.627) (-911.851) [-903.617] -- 0:00:53
822500 -- (-910.213) (-911.551) (-907.484) [-912.240] * (-909.471) [-912.806] (-914.548) (-908.581) -- 0:00:52
823000 -- (-921.415) (-919.963) [-906.744] (-906.306) * (-909.971) (-922.122) [-902.756] (-910.574) -- 0:00:52
823500 -- (-921.661) (-912.316) [-908.050] (-909.308) * [-906.949] (-922.942) (-909.792) (-902.158) -- 0:00:52
824000 -- (-922.806) (-916.721) (-909.247) [-907.475] * [-906.723] (-921.038) (-913.875) (-902.804) -- 0:00:52
824500 -- [-914.349] (-924.787) (-912.453) (-907.371) * (-907.536) (-916.247) (-914.486) [-906.693] -- 0:00:52
825000 -- (-911.659) (-916.869) [-904.585] (-915.481) * [-901.043] (-917.292) (-911.836) (-920.844) -- 0:00:52
Average standard deviation of split frequencies: 0.010044
825500 -- (-923.087) (-910.897) (-915.195) [-908.639] * (-907.973) [-919.650] (-912.664) (-910.677) -- 0:00:52
826000 -- (-913.272) (-914.813) [-900.448] (-905.988) * [-903.268] (-909.665) (-915.844) (-910.336) -- 0:00:51
826500 -- (-921.331) (-912.585) [-901.639] (-908.620) * (-911.765) [-908.227] (-904.511) (-915.922) -- 0:00:51
827000 -- (-910.484) (-912.194) [-902.814] (-907.667) * (-919.256) (-923.977) [-913.410] (-908.789) -- 0:00:51
827500 -- [-908.678] (-910.425) (-913.454) (-913.188) * (-913.325) (-904.438) (-905.824) [-907.182] -- 0:00:51
828000 -- [-906.387] (-922.833) (-910.073) (-909.963) * (-924.736) (-909.937) [-906.929] (-910.483) -- 0:00:51
828500 -- [-909.607] (-911.629) (-913.960) (-915.480) * (-912.500) (-909.079) (-905.647) [-908.069] -- 0:00:51
829000 -- [-915.194] (-922.561) (-909.768) (-911.962) * (-915.636) [-902.411] (-907.974) (-921.136) -- 0:00:50
829500 -- (-904.514) (-907.488) [-904.951] (-914.157) * (-908.143) (-919.509) [-909.784] (-916.976) -- 0:00:50
830000 -- (-915.899) [-902.102] (-912.481) (-914.678) * [-902.414] (-908.334) (-914.202) (-913.907) -- 0:00:50
Average standard deviation of split frequencies: 0.009676
830500 -- (-929.466) [-912.212] (-910.086) (-909.538) * (-904.423) (-915.863) (-909.203) [-905.186] -- 0:00:50
831000 -- (-917.073) (-908.424) [-911.242] (-911.318) * [-912.904] (-909.056) (-906.998) (-903.305) -- 0:00:50
831500 -- (-912.065) [-907.134] (-914.924) (-911.053) * (-915.527) (-918.620) [-901.913] (-912.631) -- 0:00:50
832000 -- (-915.250) [-907.185] (-912.751) (-913.396) * (-918.468) (-910.949) [-910.534] (-911.203) -- 0:00:50
832500 -- [-905.238] (-902.846) (-907.518) (-921.885) * (-918.437) (-913.717) (-912.317) [-910.473] -- 0:00:49
833000 -- (-909.675) [-900.895] (-903.198) (-925.039) * (-909.155) [-902.750] (-913.119) (-911.454) -- 0:00:49
833500 -- (-911.984) [-906.869] (-917.940) (-909.204) * [-901.398] (-912.607) (-908.468) (-906.753) -- 0:00:49
834000 -- (-917.406) [-910.284] (-913.964) (-901.622) * (-908.586) (-900.625) [-911.856] (-924.574) -- 0:00:49
834500 -- (-916.223) [-908.577] (-916.308) (-907.374) * [-909.576] (-914.545) (-910.820) (-914.929) -- 0:00:49
835000 -- (-917.411) (-909.661) [-907.042] (-911.493) * [-910.107] (-913.288) (-908.604) (-916.250) -- 0:00:49
Average standard deviation of split frequencies: 0.009755
835500 -- (-913.352) [-902.772] (-911.045) (-912.762) * (-922.584) [-904.937] (-915.623) (-918.975) -- 0:00:49
836000 -- (-915.060) [-904.238] (-912.629) (-920.385) * (-926.743) [-903.504] (-911.599) (-929.966) -- 0:00:48
836500 -- (-901.721) [-906.427] (-911.567) (-916.426) * [-908.687] (-910.584) (-905.498) (-913.223) -- 0:00:48
837000 -- (-906.592) (-907.070) (-922.392) [-902.560] * [-907.692] (-915.321) (-919.331) (-911.563) -- 0:00:48
837500 -- (-904.900) [-908.623] (-912.300) (-911.425) * (-910.451) (-913.757) [-903.518] (-910.288) -- 0:00:48
838000 -- (-921.138) (-904.319) (-903.165) [-905.648] * (-907.507) [-905.281] (-900.960) (-925.888) -- 0:00:48
838500 -- (-915.994) [-907.564] (-900.764) (-914.181) * [-901.806] (-910.554) (-917.643) (-908.843) -- 0:00:48
839000 -- [-906.108] (-906.316) (-916.053) (-910.169) * (-904.458) (-913.956) (-904.349) [-903.778] -- 0:00:47
839500 -- (-903.793) (-905.951) (-915.804) [-906.944] * (-916.104) (-903.867) [-905.897] (-906.344) -- 0:00:47
840000 -- (-903.649) [-902.631] (-908.683) (-911.282) * (-918.790) (-920.818) [-900.247] (-913.421) -- 0:00:47
Average standard deviation of split frequencies: 0.009589
840500 -- (-905.861) [-905.597] (-921.228) (-913.016) * (-906.857) (-912.610) [-911.798] (-911.349) -- 0:00:47
841000 -- [-909.591] (-905.666) (-926.659) (-916.954) * (-913.689) [-906.423] (-911.705) (-917.600) -- 0:00:47
841500 -- (-912.911) (-909.393) (-916.211) [-914.348] * (-907.215) [-910.698] (-912.580) (-911.026) -- 0:00:47
842000 -- (-914.035) (-911.008) (-920.170) [-905.560] * (-904.828) [-909.436] (-905.064) (-911.094) -- 0:00:47
842500 -- [-905.184] (-918.269) (-920.930) (-903.478) * (-902.186) [-908.428] (-908.865) (-908.983) -- 0:00:46
843000 -- (-912.884) (-910.745) (-926.810) [-907.784] * (-925.169) (-903.235) [-906.571] (-908.346) -- 0:00:46
843500 -- (-913.249) [-906.357] (-911.514) (-914.240) * (-907.369) [-904.353] (-909.965) (-910.949) -- 0:00:46
844000 -- (-916.966) (-911.397) (-909.154) [-902.272] * (-903.015) [-904.985] (-913.396) (-911.863) -- 0:00:46
844500 -- (-923.839) [-912.893] (-903.677) (-908.607) * (-909.314) (-916.321) (-915.924) [-901.999] -- 0:00:46
845000 -- (-910.428) (-916.570) (-919.552) [-904.988] * (-915.336) (-911.592) (-903.919) [-906.070] -- 0:00:46
Average standard deviation of split frequencies: 0.009528
845500 -- (-913.628) (-915.292) (-909.229) [-907.735] * (-912.919) (-910.698) (-918.697) [-907.508] -- 0:00:46
846000 -- (-906.608) (-909.547) [-906.968] (-910.885) * [-897.696] (-917.244) (-914.443) (-913.094) -- 0:00:45
846500 -- [-908.603] (-919.765) (-910.507) (-909.626) * (-906.763) (-912.665) (-918.316) [-909.214] -- 0:00:45
847000 -- (-911.663) (-902.991) [-908.556] (-908.575) * (-915.849) [-911.310] (-914.325) (-912.466) -- 0:00:45
847500 -- (-906.560) (-907.030) (-903.161) [-901.657] * [-906.945] (-907.439) (-905.991) (-914.588) -- 0:00:45
848000 -- (-900.556) (-908.627) (-912.295) [-910.991] * (-906.062) (-910.908) [-902.836] (-911.690) -- 0:00:45
848500 -- (-903.013) [-902.280] (-904.574) (-910.588) * (-910.426) [-905.521] (-906.126) (-916.176) -- 0:00:45
849000 -- [-903.859] (-907.506) (-906.681) (-906.133) * (-906.790) [-910.261] (-911.431) (-907.444) -- 0:00:44
849500 -- (-919.021) [-898.792] (-908.151) (-913.889) * (-917.629) (-917.134) [-914.477] (-912.228) -- 0:00:44
850000 -- (-906.983) (-910.730) (-902.269) [-903.440] * [-910.791] (-909.636) (-918.990) (-906.561) -- 0:00:44
Average standard deviation of split frequencies: 0.009310
850500 -- (-910.111) (-902.913) [-901.537] (-914.336) * (-912.139) [-915.005] (-905.795) (-905.794) -- 0:00:44
851000 -- (-903.455) (-916.513) [-906.512] (-907.509) * (-912.465) (-919.936) (-910.431) [-911.434] -- 0:00:44
851500 -- (-914.443) [-905.625] (-910.867) (-914.943) * (-912.995) (-910.621) [-907.239] (-907.367) -- 0:00:44
852000 -- (-912.349) [-905.418] (-906.564) (-906.350) * (-914.661) (-914.264) [-910.544] (-903.332) -- 0:00:44
852500 -- (-909.567) (-914.151) [-903.493] (-914.093) * (-913.222) (-914.371) (-905.710) [-903.906] -- 0:00:43
853000 -- (-911.477) [-909.774] (-913.056) (-918.708) * (-913.798) (-913.785) (-900.288) [-913.108] -- 0:00:43
853500 -- (-915.963) (-909.527) (-913.059) [-914.348] * [-918.255] (-908.936) (-912.475) (-907.560) -- 0:00:43
854000 -- (-915.880) (-909.934) (-903.380) [-905.758] * (-904.199) (-913.059) [-911.822] (-912.128) -- 0:00:43
854500 -- (-911.461) [-906.967] (-914.902) (-914.849) * [-911.505] (-905.561) (-910.826) (-907.017) -- 0:00:43
855000 -- (-916.400) (-916.655) [-905.366] (-908.151) * [-908.896] (-904.681) (-911.025) (-908.543) -- 0:00:43
Average standard deviation of split frequencies: 0.009555
855500 -- [-908.162] (-914.294) (-915.761) (-914.190) * (-913.978) (-913.325) (-920.559) [-903.027] -- 0:00:43
856000 -- (-926.036) [-911.307] (-919.646) (-907.277) * (-921.212) (-909.855) (-912.186) [-909.738] -- 0:00:43
856500 -- (-913.093) [-917.883] (-918.891) (-909.485) * (-906.030) (-913.389) (-911.802) [-903.924] -- 0:00:42
857000 -- (-915.898) [-910.335] (-921.137) (-904.475) * (-904.925) (-909.800) [-902.667] (-910.997) -- 0:00:42
857500 -- (-913.715) (-910.690) (-924.753) [-905.088] * (-909.101) (-907.461) [-903.766] (-912.394) -- 0:00:42
858000 -- (-910.065) (-907.552) [-908.136] (-909.876) * (-908.068) (-907.622) [-904.893] (-917.631) -- 0:00:42
858500 -- (-919.002) (-910.024) [-903.245] (-903.082) * (-905.428) (-916.807) [-909.562] (-906.656) -- 0:00:42
859000 -- (-915.136) (-907.420) (-914.095) [-908.399] * (-919.247) (-918.431) (-906.097) [-907.392] -- 0:00:42
859500 -- (-918.013) (-917.232) (-921.989) [-899.596] * (-909.781) (-912.173) [-906.528] (-922.530) -- 0:00:42
860000 -- (-921.912) (-913.935) [-910.167] (-905.830) * [-903.106] (-908.167) (-913.963) (-916.040) -- 0:00:41
Average standard deviation of split frequencies: 0.009777
860500 -- (-923.865) (-906.755) (-914.313) [-909.805] * (-901.670) (-917.753) [-911.729] (-916.123) -- 0:00:41
861000 -- (-921.239) (-907.812) (-926.828) [-912.534] * (-910.159) (-918.789) [-902.217] (-916.655) -- 0:00:41
861500 -- [-915.518] (-901.452) (-909.060) (-910.585) * [-910.378] (-916.602) (-908.708) (-918.562) -- 0:00:41
862000 -- (-912.064) [-915.165] (-913.183) (-904.005) * (-912.403) (-922.716) [-902.780] (-902.931) -- 0:00:41
862500 -- (-911.818) (-911.393) (-908.241) [-908.691] * [-903.134] (-910.382) (-909.110) (-906.158) -- 0:00:41
863000 -- (-914.220) [-905.193] (-911.594) (-915.853) * (-905.646) (-915.932) (-915.260) [-910.024] -- 0:00:40
863500 -- [-906.069] (-910.193) (-908.371) (-918.304) * (-908.022) (-929.742) (-911.385) [-906.633] -- 0:00:40
864000 -- (-914.917) (-910.084) (-915.154) [-906.393] * (-911.292) (-912.759) [-907.137] (-916.258) -- 0:00:40
864500 -- (-910.490) [-908.815] (-915.442) (-912.671) * (-920.141) (-917.576) (-914.944) [-903.645] -- 0:00:40
865000 -- [-911.574] (-914.560) (-910.198) (-918.464) * (-913.316) (-907.594) (-904.909) [-911.827] -- 0:00:40
Average standard deviation of split frequencies: 0.009118
865500 -- (-913.459) (-905.967) [-902.849] (-910.376) * (-923.599) [-910.647] (-916.708) (-907.594) -- 0:00:40
866000 -- (-921.734) [-904.778] (-924.588) (-908.759) * (-909.966) (-909.029) (-925.576) [-904.524] -- 0:00:40
866500 -- [-910.966] (-904.561) (-914.048) (-911.228) * (-917.863) (-905.023) [-913.399] (-911.644) -- 0:00:39
867000 -- [-908.850] (-904.854) (-910.782) (-919.257) * (-900.424) (-912.890) (-908.139) [-918.273] -- 0:00:39
867500 -- (-914.758) (-910.485) [-907.360] (-912.710) * (-917.308) (-907.080) (-907.753) [-909.148] -- 0:00:39
868000 -- (-907.431) [-910.326] (-905.451) (-907.868) * (-911.280) (-913.515) (-912.218) [-906.493] -- 0:00:39
868500 -- (-911.230) (-910.920) [-905.864] (-910.618) * (-910.111) (-915.442) (-924.101) [-903.428] -- 0:00:39
869000 -- (-910.110) (-914.026) (-903.342) [-907.197] * (-917.409) (-926.898) (-906.734) [-908.381] -- 0:00:39
869500 -- (-910.941) (-913.578) (-910.598) [-907.593] * (-917.397) (-911.172) [-910.635] (-912.046) -- 0:00:39
870000 -- (-918.387) (-913.872) [-921.554] (-912.743) * (-917.816) (-904.380) (-921.325) [-908.707] -- 0:00:38
Average standard deviation of split frequencies: 0.009204
870500 -- [-903.815] (-921.544) (-902.521) (-914.716) * (-906.038) [-904.665] (-908.168) (-917.708) -- 0:00:38
871000 -- (-911.896) (-927.104) (-929.075) [-903.676] * (-915.528) [-907.455] (-910.036) (-915.656) -- 0:00:38
871500 -- [-914.319] (-927.787) (-916.112) (-904.533) * (-911.475) (-919.177) [-899.102] (-918.632) -- 0:00:38
872000 -- (-918.769) (-913.320) [-903.463] (-910.017) * (-911.830) (-921.609) [-909.333] (-916.134) -- 0:00:38
872500 -- (-909.304) [-903.623] (-907.368) (-909.200) * (-911.105) (-912.329) (-913.665) [-910.328] -- 0:00:37
873000 -- (-918.312) (-905.290) [-908.888] (-909.604) * [-908.771] (-911.796) (-911.842) (-923.594) -- 0:00:37
873500 -- (-924.466) (-906.407) [-906.935] (-922.091) * (-916.410) (-914.198) [-908.759] (-911.459) -- 0:00:37
874000 -- (-918.754) [-901.648] (-906.453) (-922.994) * [-918.360] (-915.832) (-907.762) (-918.619) -- 0:00:37
874500 -- [-913.802] (-908.485) (-914.466) (-916.834) * (-928.621) [-909.265] (-913.354) (-906.488) -- 0:00:37
875000 -- (-918.675) [-909.006] (-915.238) (-928.471) * (-910.839) (-910.091) (-916.153) [-907.523] -- 0:00:37
Average standard deviation of split frequencies: 0.009417
875500 -- (-920.382) [-908.091] (-904.833) (-903.414) * (-913.108) (-909.684) (-912.997) [-906.908] -- 0:00:37
876000 -- (-904.431) (-904.463) [-906.880] (-918.434) * (-912.927) [-901.924] (-909.921) (-907.411) -- 0:00:37
876500 -- (-916.221) (-905.753) (-912.655) [-912.034] * (-913.699) [-906.804] (-908.175) (-919.442) -- 0:00:36
877000 -- [-907.273] (-910.846) (-908.249) (-906.660) * (-920.230) [-903.692] (-915.195) (-918.229) -- 0:00:36
877500 -- (-908.498) (-906.873) (-908.756) [-903.247] * (-906.704) [-909.454] (-922.021) (-908.688) -- 0:00:36
878000 -- [-913.223] (-915.466) (-911.830) (-906.915) * (-907.007) (-918.584) [-905.535] (-909.343) -- 0:00:36
878500 -- (-917.486) (-920.805) (-901.564) [-907.737] * (-907.370) (-910.438) (-905.060) [-908.119] -- 0:00:36
879000 -- (-916.560) [-906.293] (-921.438) (-915.165) * (-915.654) [-905.900] (-900.950) (-923.213) -- 0:00:36
879500 -- (-917.536) (-914.986) (-917.190) [-906.979] * (-907.533) (-919.016) (-911.912) [-905.055] -- 0:00:36
880000 -- (-932.811) (-905.045) [-910.694] (-918.041) * (-921.114) (-906.940) (-909.082) [-910.212] -- 0:00:35
Average standard deviation of split frequencies: 0.009394
880500 -- (-919.806) (-908.552) [-901.331] (-906.944) * (-909.899) (-918.099) (-914.663) [-903.794] -- 0:00:35
881000 -- (-907.847) [-910.147] (-912.923) (-915.423) * (-912.029) [-913.628] (-913.953) (-908.032) -- 0:00:35
881500 -- (-907.101) (-912.248) (-908.704) [-905.939] * [-912.679] (-906.146) (-913.334) (-924.572) -- 0:00:35
882000 -- (-905.976) (-914.886) [-905.212] (-907.169) * (-907.844) [-905.737] (-911.504) (-909.023) -- 0:00:35
882500 -- (-908.565) (-922.401) (-906.617) [-913.824] * (-909.608) [-902.661] (-909.016) (-910.927) -- 0:00:35
883000 -- (-911.372) (-913.310) [-910.485] (-911.997) * (-904.163) (-905.450) (-924.253) [-912.465] -- 0:00:34
883500 -- (-915.132) (-907.742) (-908.306) [-906.996] * [-904.597] (-908.778) (-925.382) (-913.781) -- 0:00:34
884000 -- (-914.641) [-911.940] (-907.076) (-907.619) * [-909.488] (-917.645) (-924.957) (-909.396) -- 0:00:34
884500 -- [-909.593] (-910.404) (-909.564) (-905.918) * (-920.957) (-912.739) [-912.686] (-917.908) -- 0:00:34
885000 -- (-910.596) (-917.983) [-909.166] (-915.031) * (-919.330) [-903.851] (-913.160) (-907.582) -- 0:00:34
Average standard deviation of split frequencies: 0.009444
885500 -- [-903.162] (-916.658) (-914.677) (-913.585) * (-912.852) (-909.879) (-909.292) [-901.597] -- 0:00:34
886000 -- [-908.173] (-908.533) (-911.774) (-908.938) * [-911.648] (-906.792) (-923.237) (-906.364) -- 0:00:34
886500 -- [-901.125] (-906.301) (-917.936) (-912.339) * (-914.124) [-914.180] (-911.066) (-905.415) -- 0:00:33
887000 -- (-925.507) (-916.078) (-908.422) [-913.560] * [-910.513] (-906.784) (-920.505) (-906.744) -- 0:00:33
887500 -- (-908.311) [-908.050] (-909.177) (-905.356) * (-909.669) (-916.262) [-913.615] (-910.921) -- 0:00:33
888000 -- [-905.481] (-915.097) (-917.875) (-907.710) * [-907.084] (-910.714) (-920.088) (-913.948) -- 0:00:33
888500 -- (-912.130) (-911.044) (-919.704) [-903.153] * (-923.048) [-912.825] (-911.743) (-908.573) -- 0:00:33
889000 -- (-913.775) (-910.699) [-900.028] (-906.612) * (-910.291) (-916.284) [-910.097] (-910.835) -- 0:00:33
889500 -- (-916.052) (-915.317) (-922.798) [-905.151] * (-923.507) (-910.326) [-907.247] (-911.126) -- 0:00:33
890000 -- (-913.400) (-912.449) (-925.471) [-904.488] * (-911.663) [-908.248] (-916.241) (-906.537) -- 0:00:32
Average standard deviation of split frequencies: 0.009421
890500 -- (-909.577) (-914.391) [-909.109] (-906.718) * (-909.336) (-909.229) (-915.184) [-904.823] -- 0:00:32
891000 -- (-907.927) (-915.634) [-906.700] (-921.055) * (-915.504) (-919.168) [-916.935] (-911.753) -- 0:00:32
891500 -- (-909.398) [-905.649] (-906.273) (-931.435) * (-921.923) (-909.517) (-910.092) [-903.345] -- 0:00:32
892000 -- (-909.032) (-914.438) [-908.807] (-911.147) * (-900.262) (-906.095) (-911.257) [-906.461] -- 0:00:32
892500 -- [-906.694] (-913.018) (-908.454) (-914.921) * (-910.033) (-908.201) (-911.462) [-910.858] -- 0:00:32
893000 -- (-901.560) (-920.180) [-905.067] (-915.889) * (-918.989) [-903.645] (-916.966) (-902.433) -- 0:00:31
893500 -- (-911.332) (-914.944) (-925.337) [-908.840] * (-925.806) [-912.356] (-921.984) (-920.512) -- 0:00:31
894000 -- (-907.519) (-906.931) (-923.049) [-904.120] * [-915.598] (-922.041) (-917.371) (-910.679) -- 0:00:31
894500 -- (-911.601) (-916.122) [-910.095] (-923.548) * (-910.594) [-905.024] (-907.649) (-911.923) -- 0:00:31
895000 -- (-926.140) [-910.488] (-909.358) (-916.436) * (-915.026) [-907.503] (-917.737) (-910.666) -- 0:00:31
Average standard deviation of split frequencies: 0.009102
895500 -- (-912.762) (-919.200) (-906.217) [-913.648] * (-908.031) [-905.548] (-924.239) (-906.283) -- 0:00:31
896000 -- (-910.074) (-911.436) (-910.188) [-904.268] * [-908.032] (-911.508) (-914.139) (-908.536) -- 0:00:31
896500 -- (-911.717) (-918.122) [-901.338] (-908.600) * (-924.817) (-918.644) [-913.341] (-911.732) -- 0:00:30
897000 -- (-911.491) (-908.758) [-908.172] (-926.631) * [-910.105] (-918.364) (-920.749) (-916.426) -- 0:00:30
897500 -- (-914.672) (-917.741) [-906.088] (-905.036) * (-906.412) (-913.364) (-912.469) [-903.667] -- 0:00:30
898000 -- (-908.233) (-923.587) (-907.540) [-908.983] * (-915.099) (-903.482) (-911.027) [-908.520] -- 0:00:30
898500 -- (-907.134) (-914.390) (-916.241) [-904.872] * (-917.614) (-905.327) (-905.522) [-908.801] -- 0:00:30
899000 -- [-911.354] (-913.970) (-901.687) (-912.631) * [-902.688] (-904.105) (-907.204) (-909.829) -- 0:00:30
899500 -- [-910.407] (-920.168) (-905.185) (-913.749) * (-925.683) [-912.320] (-903.918) (-927.226) -- 0:00:30
900000 -- (-906.906) (-915.458) [-909.901] (-916.510) * [-909.485] (-909.209) (-906.823) (-911.310) -- 0:00:29
Average standard deviation of split frequencies: 0.009264
900500 -- (-908.431) (-906.410) (-903.287) [-907.118] * (-914.374) (-901.009) [-903.524] (-909.591) -- 0:00:29
901000 -- (-905.151) (-912.049) [-899.859] (-912.395) * (-908.867) (-909.718) [-906.944] (-910.740) -- 0:00:29
901500 -- [-906.006] (-917.577) (-911.462) (-908.232) * [-907.368] (-905.914) (-907.788) (-918.780) -- 0:00:29
902000 -- [-904.699] (-914.826) (-919.950) (-913.047) * [-903.628] (-919.779) (-915.824) (-914.295) -- 0:00:29
902500 -- [-904.730] (-904.894) (-915.106) (-908.102) * (-909.691) (-916.853) (-914.266) [-915.104] -- 0:00:29
903000 -- (-903.681) (-916.623) [-911.401] (-912.480) * (-909.616) [-905.305] (-907.623) (-918.816) -- 0:00:29
903500 -- [-908.296] (-915.233) (-915.738) (-916.138) * (-918.567) (-918.496) (-912.407) [-906.155] -- 0:00:28
904000 -- (-912.843) (-904.575) [-906.065] (-915.329) * (-914.719) [-908.990] (-914.814) (-911.753) -- 0:00:28
904500 -- (-907.346) [-907.628] (-913.156) (-912.316) * (-907.528) (-914.921) (-915.129) [-911.997] -- 0:00:28
905000 -- (-916.433) (-912.764) (-909.791) [-907.028] * [-907.189] (-910.295) (-907.983) (-914.907) -- 0:00:28
Average standard deviation of split frequencies: 0.008871
905500 -- (-902.565) [-909.893] (-912.321) (-904.485) * [-902.778] (-911.583) (-903.390) (-919.835) -- 0:00:28
906000 -- (-920.126) (-920.233) (-900.727) [-906.664] * (-909.155) (-911.548) [-908.273] (-912.800) -- 0:00:28
906500 -- (-914.995) [-913.422] (-908.386) (-910.470) * [-909.948] (-909.802) (-910.334) (-911.405) -- 0:00:27
907000 -- [-911.102] (-902.964) (-913.898) (-913.797) * (-906.481) (-912.267) [-910.514] (-911.542) -- 0:00:27
907500 -- (-911.101) [-911.568] (-922.604) (-908.863) * [-909.455] (-916.035) (-908.016) (-917.786) -- 0:00:27
908000 -- [-911.371] (-929.740) (-913.185) (-908.992) * (-916.555) (-901.327) [-913.384] (-912.742) -- 0:00:27
908500 -- (-905.044) [-906.370] (-919.980) (-902.385) * (-914.341) [-906.749] (-910.832) (-910.194) -- 0:00:27
909000 -- (-918.071) [-904.576] (-904.637) (-907.554) * (-913.661) (-910.271) [-904.064] (-905.099) -- 0:00:27
909500 -- (-921.199) (-907.487) (-912.295) [-904.493] * (-907.123) (-909.095) [-916.069] (-911.622) -- 0:00:27
910000 -- (-925.434) (-918.179) (-914.757) [-908.317] * [-910.983] (-907.695) (-908.668) (-919.507) -- 0:00:26
Average standard deviation of split frequencies: 0.008929
910500 -- (-919.914) (-915.460) [-909.616] (-909.465) * (-915.355) (-913.695) [-903.951] (-906.694) -- 0:00:26
911000 -- [-904.457] (-912.671) (-916.635) (-907.750) * (-913.920) (-906.337) [-908.905] (-913.600) -- 0:00:26
911500 -- [-909.780] (-912.363) (-911.718) (-912.037) * (-911.311) (-914.193) [-901.022] (-911.726) -- 0:00:26
912000 -- (-913.663) [-906.805] (-914.757) (-911.375) * (-911.881) (-905.722) (-917.749) [-903.463] -- 0:00:26
912500 -- [-911.093] (-913.044) (-912.941) (-908.541) * (-916.771) [-906.517] (-906.359) (-905.322) -- 0:00:26
913000 -- (-914.459) (-914.042) [-911.346] (-907.074) * (-906.424) [-902.259] (-908.822) (-917.478) -- 0:00:26
913500 -- (-914.099) [-911.203] (-918.078) (-908.679) * (-912.049) (-910.993) (-916.846) [-904.432] -- 0:00:25
914000 -- [-916.188] (-911.032) (-915.776) (-906.818) * (-916.937) (-913.371) [-907.639] (-917.922) -- 0:00:25
914500 -- [-909.408] (-922.395) (-915.728) (-916.033) * (-914.084) (-910.844) [-907.478] (-921.402) -- 0:00:25
915000 -- (-915.608) [-908.584] (-913.375) (-915.958) * (-911.147) [-900.788] (-907.313) (-910.945) -- 0:00:25
Average standard deviation of split frequencies: 0.008749
915500 -- [-905.755] (-916.742) (-907.145) (-919.738) * [-904.344] (-909.546) (-912.105) (-908.629) -- 0:00:25
916000 -- [-905.375] (-917.646) (-911.689) (-910.523) * (-906.909) (-915.664) [-913.226] (-924.302) -- 0:00:25
916500 -- (-906.090) [-904.817] (-925.662) (-900.384) * (-914.019) [-922.003] (-915.319) (-915.327) -- 0:00:24
917000 -- (-919.100) (-914.740) (-925.320) [-911.285] * (-916.319) (-912.407) [-903.119] (-905.762) -- 0:00:24
917500 -- (-909.741) (-909.968) [-916.451] (-910.140) * (-921.044) (-911.671) [-904.939] (-900.010) -- 0:00:24
918000 -- (-913.203) (-912.689) (-916.034) [-913.235] * (-913.697) [-906.152] (-911.094) (-913.665) -- 0:00:24
918500 -- (-906.392) [-912.274] (-912.608) (-907.031) * (-908.368) [-906.445] (-910.042) (-912.055) -- 0:00:24
919000 -- (-911.007) [-905.771] (-909.659) (-923.288) * [-912.651] (-915.717) (-912.575) (-905.302) -- 0:00:24
919500 -- (-908.624) (-908.412) [-909.046] (-911.036) * (-913.790) (-906.130) [-900.432] (-918.651) -- 0:00:23
920000 -- (-905.681) (-903.941) (-913.387) [-914.397] * (-919.572) (-905.161) [-910.777] (-910.617) -- 0:00:23
Average standard deviation of split frequencies: 0.008320
920500 -- (-906.556) (-921.291) (-907.732) [-908.805] * (-914.463) [-908.996] (-904.197) (-918.127) -- 0:00:23
921000 -- (-905.307) (-907.259) (-909.328) [-912.637] * (-926.556) (-906.245) (-905.861) [-911.856] -- 0:00:23
921500 -- (-903.206) (-909.280) (-914.793) [-909.921] * [-914.287] (-915.314) (-906.819) (-907.992) -- 0:00:23
922000 -- (-900.552) (-915.380) [-906.497] (-915.429) * (-902.158) (-910.297) [-905.037] (-913.003) -- 0:00:23
922500 -- (-900.619) [-906.700] (-907.617) (-918.029) * (-912.516) (-902.822) [-907.393] (-915.534) -- 0:00:23
923000 -- (-906.599) (-917.434) [-907.816] (-924.147) * (-907.935) [-903.339] (-905.088) (-917.851) -- 0:00:22
923500 -- (-910.190) (-927.627) (-901.772) [-908.641] * (-920.352) (-912.191) [-903.720] (-921.364) -- 0:00:22
924000 -- [-908.213] (-911.942) (-916.099) (-912.846) * (-910.748) (-907.336) [-912.268] (-913.026) -- 0:00:22
924500 -- [-910.995] (-911.297) (-902.014) (-902.296) * (-910.877) (-909.993) (-903.735) [-916.548] -- 0:00:22
925000 -- (-919.579) (-913.827) (-904.923) [-907.634] * [-906.502] (-916.799) (-911.708) (-904.419) -- 0:00:22
Average standard deviation of split frequencies: 0.007891
925500 -- (-913.693) (-917.351) [-907.262] (-913.511) * (-901.473) (-918.931) [-912.502] (-911.214) -- 0:00:22
926000 -- [-906.650] (-913.379) (-913.889) (-906.144) * [-904.209] (-927.229) (-908.937) (-906.966) -- 0:00:22
926500 -- [-911.611] (-910.742) (-913.260) (-904.228) * (-916.893) (-916.552) (-909.513) [-906.961] -- 0:00:21
927000 -- (-922.065) (-916.215) (-914.937) [-906.603] * (-909.203) (-912.812) [-906.312] (-907.919) -- 0:00:21
927500 -- (-914.091) (-907.586) (-910.782) [-907.457] * (-908.876) [-902.452] (-911.556) (-908.006) -- 0:00:21
928000 -- [-912.397] (-909.092) (-909.318) (-911.310) * (-908.123) [-915.290] (-903.571) (-919.906) -- 0:00:21
928500 -- (-918.402) (-921.677) (-908.074) [-905.386] * (-915.532) [-908.033] (-909.954) (-918.124) -- 0:00:21
929000 -- [-909.162] (-910.512) (-907.935) (-909.366) * (-919.366) (-910.488) [-903.721] (-917.319) -- 0:00:21
929500 -- (-917.342) (-912.284) (-902.808) [-905.081] * (-913.537) (-913.076) [-904.423] (-914.346) -- 0:00:21
930000 -- (-921.768) (-905.188) [-904.029] (-909.415) * (-914.141) [-906.473] (-899.568) (-902.830) -- 0:00:20
Average standard deviation of split frequencies: 0.008155
930500 -- (-905.457) (-917.329) (-912.732) [-905.727] * (-915.864) (-910.086) [-907.997] (-919.660) -- 0:00:20
931000 -- (-905.462) (-910.027) (-909.788) [-907.730] * (-908.648) (-919.518) [-909.047] (-911.737) -- 0:00:20
931500 -- (-911.165) (-915.934) [-907.739] (-907.203) * (-920.658) [-909.407] (-928.897) (-916.978) -- 0:00:20
932000 -- (-929.343) [-900.415] (-917.432) (-920.367) * (-918.698) [-910.687] (-909.304) (-912.531) -- 0:00:20
932500 -- (-905.982) (-913.399) (-907.763) [-907.911] * [-904.219] (-910.836) (-909.064) (-903.766) -- 0:00:20
933000 -- (-914.929) (-905.651) (-916.907) [-904.646] * (-911.561) (-907.278) (-912.689) [-904.447] -- 0:00:19
933500 -- (-916.541) [-909.658] (-912.811) (-917.408) * (-914.385) [-904.365] (-908.079) (-900.507) -- 0:00:19
934000 -- (-913.565) (-907.598) (-911.907) [-913.577] * [-907.674] (-906.596) (-905.800) (-906.794) -- 0:00:19
934500 -- (-918.473) [-903.436] (-906.364) (-908.272) * [-907.047] (-913.731) (-911.731) (-916.325) -- 0:00:19
935000 -- (-914.362) (-906.009) [-905.541] (-914.731) * (-917.063) (-916.739) (-908.727) [-905.014] -- 0:00:19
Average standard deviation of split frequencies: 0.008587
935500 -- (-904.352) (-907.247) (-907.326) [-914.124] * (-916.376) (-911.647) [-907.779] (-906.558) -- 0:00:19
936000 -- (-909.575) [-903.603] (-912.091) (-917.544) * (-926.003) (-906.824) (-914.796) [-908.209] -- 0:00:19
936500 -- [-908.833] (-909.854) (-904.542) (-906.543) * [-905.413] (-917.622) (-910.338) (-908.494) -- 0:00:18
937000 -- (-909.728) (-926.194) (-917.071) [-912.472] * (-907.833) (-915.194) [-905.040] (-912.678) -- 0:00:18
937500 -- (-904.041) (-917.440) (-917.879) [-908.778] * (-907.388) (-921.254) [-906.347] (-910.564) -- 0:00:18
938000 -- [-904.523] (-918.240) (-907.898) (-914.171) * (-911.468) (-907.207) (-910.636) [-907.067] -- 0:00:18
938500 -- (-911.493) [-913.871] (-911.505) (-909.706) * (-902.734) (-913.967) (-907.298) [-903.078] -- 0:00:18
939000 -- (-910.287) (-906.801) (-913.920) [-920.425] * [-905.994] (-912.419) (-918.884) (-918.877) -- 0:00:18
939500 -- [-907.947] (-904.222) (-918.156) (-912.674) * (-916.480) (-921.785) (-917.565) [-911.528] -- 0:00:18
940000 -- [-908.012] (-903.553) (-907.514) (-912.300) * (-914.236) [-914.306] (-915.698) (-913.491) -- 0:00:17
Average standard deviation of split frequencies: 0.008770
940500 -- [-904.738] (-905.844) (-908.864) (-911.448) * (-905.945) (-907.276) [-907.379] (-922.181) -- 0:00:17
941000 -- (-907.513) (-912.548) (-916.300) [-909.061] * (-907.479) (-910.448) [-909.539] (-904.614) -- 0:00:17
941500 -- (-913.717) (-907.796) [-907.879] (-904.771) * (-903.592) (-921.279) [-908.008] (-916.377) -- 0:00:17
942000 -- (-917.233) [-908.828] (-906.382) (-914.363) * (-906.420) [-908.293] (-912.467) (-911.217) -- 0:00:17
942500 -- (-912.509) [-912.999] (-904.481) (-913.539) * [-907.435] (-914.183) (-917.706) (-907.423) -- 0:00:17
943000 -- (-909.352) (-913.989) [-902.637] (-917.613) * (-912.568) (-906.738) [-907.629] (-914.082) -- 0:00:16
943500 -- [-901.437] (-921.040) (-910.682) (-907.887) * (-904.628) (-901.633) [-908.052] (-908.440) -- 0:00:16
944000 -- (-911.748) [-903.205] (-914.693) (-905.612) * (-909.002) (-901.083) [-906.507] (-913.476) -- 0:00:16
944500 -- (-912.945) [-911.800] (-914.249) (-907.332) * (-913.792) (-913.135) [-911.241] (-906.371) -- 0:00:16
945000 -- [-909.795] (-906.109) (-912.870) (-913.125) * (-911.390) [-914.502] (-910.045) (-905.826) -- 0:00:16
Average standard deviation of split frequencies: 0.008671
945500 -- (-917.730) (-906.336) (-907.816) [-907.625] * [-902.066] (-907.939) (-907.860) (-905.248) -- 0:00:16
946000 -- (-915.451) [-906.353] (-913.306) (-911.324) * [-906.944] (-917.655) (-915.060) (-909.390) -- 0:00:16
946500 -- (-909.754) [-909.086] (-917.888) (-914.972) * (-922.536) [-909.702] (-909.340) (-907.702) -- 0:00:15
947000 -- [-904.213] (-906.179) (-916.955) (-910.980) * (-908.979) (-910.423) (-907.401) [-914.264] -- 0:00:15
947500 -- (-912.995) [-905.451] (-910.730) (-922.245) * (-914.826) [-905.248] (-908.166) (-907.891) -- 0:00:15
948000 -- (-905.967) (-914.515) [-908.383] (-915.100) * (-906.781) (-918.700) (-908.955) [-907.327] -- 0:00:15
948500 -- [-908.838] (-909.862) (-916.619) (-915.608) * (-908.678) [-904.736] (-913.800) (-908.515) -- 0:00:15
949000 -- (-918.465) (-917.261) (-930.268) [-908.822] * (-909.824) (-916.147) (-909.199) [-910.914] -- 0:00:15
949500 -- (-908.832) (-915.294) [-915.547] (-903.949) * (-917.221) (-912.184) (-910.687) [-908.423] -- 0:00:15
950000 -- (-917.428) (-908.081) (-924.026) [-911.060] * (-907.072) (-910.579) [-908.080] (-912.397) -- 0:00:14
Average standard deviation of split frequencies: 0.008256
950500 -- (-916.604) (-911.295) (-915.276) [-900.494] * (-911.029) (-916.178) [-905.855] (-920.939) -- 0:00:14
951000 -- [-908.541] (-909.557) (-906.294) (-911.024) * (-912.386) (-907.823) (-901.524) [-913.696] -- 0:00:14
951500 -- [-899.560] (-914.198) (-912.013) (-906.422) * (-917.021) [-911.919] (-916.117) (-922.500) -- 0:00:14
952000 -- (-914.653) (-909.909) [-907.846] (-908.856) * (-922.257) [-909.363] (-904.949) (-928.589) -- 0:00:14
952500 -- (-918.035) (-922.620) (-904.855) [-910.722] * (-910.266) [-909.983] (-909.884) (-905.297) -- 0:00:14
953000 -- (-924.099) (-913.060) (-904.361) [-910.197] * (-912.767) [-910.612] (-911.818) (-903.357) -- 0:00:14
953500 -- (-905.317) [-905.962] (-919.647) (-908.625) * (-919.996) [-912.442] (-907.147) (-908.224) -- 0:00:13
954000 -- (-909.003) (-931.268) (-909.078) [-910.551] * (-907.331) [-902.493] (-907.506) (-907.419) -- 0:00:13
954500 -- [-905.083] (-913.629) (-909.562) (-918.908) * [-904.327] (-913.292) (-903.496) (-928.301) -- 0:00:13
955000 -- (-911.493) (-921.676) (-909.598) [-910.890] * (-909.280) (-906.527) [-906.578] (-922.642) -- 0:00:13
Average standard deviation of split frequencies: 0.008038
955500 -- (-915.673) (-929.590) [-909.181] (-915.175) * (-901.067) [-918.117] (-911.971) (-925.835) -- 0:00:13
956000 -- (-914.368) (-913.240) (-904.675) [-902.314] * [-911.217] (-919.395) (-903.204) (-911.382) -- 0:00:13
956500 -- [-915.464] (-927.678) (-919.237) (-910.580) * (-908.613) (-914.334) (-916.508) [-912.859] -- 0:00:12
957000 -- [-904.285] (-905.109) (-913.348) (-921.708) * (-912.094) (-913.290) (-916.717) [-903.681] -- 0:00:12
957500 -- (-913.108) (-903.188) (-912.483) [-903.161] * (-911.255) (-928.127) (-920.390) [-904.634] -- 0:00:12
958000 -- [-900.491] (-900.416) (-907.473) (-916.646) * (-918.118) (-927.602) [-918.329] (-906.272) -- 0:00:12
958500 -- (-910.228) (-917.251) (-904.103) [-907.392] * (-909.733) (-928.070) (-918.806) [-901.540] -- 0:00:12
959000 -- (-915.283) (-908.193) [-900.781] (-913.675) * [-908.760] (-912.841) (-919.904) (-924.717) -- 0:00:12
959500 -- (-912.644) [-911.017] (-905.623) (-907.492) * [-920.454] (-904.584) (-920.188) (-916.070) -- 0:00:12
960000 -- (-906.120) [-902.352] (-921.805) (-912.156) * [-905.300] (-917.878) (-911.186) (-911.323) -- 0:00:11
Average standard deviation of split frequencies: 0.008023
960500 -- (-921.377) (-904.513) [-910.991] (-922.187) * (-917.062) [-919.138] (-915.653) (-908.748) -- 0:00:11
961000 -- (-912.806) (-916.031) [-910.850] (-911.008) * [-909.218] (-912.675) (-909.309) (-912.457) -- 0:00:11
961500 -- (-911.671) [-909.413] (-920.024) (-922.074) * [-909.592] (-915.435) (-904.910) (-905.525) -- 0:00:11
962000 -- (-912.103) [-910.876] (-912.282) (-910.782) * (-905.791) [-908.342] (-917.173) (-912.503) -- 0:00:11
962500 -- (-906.194) (-914.371) [-907.755] (-914.213) * [-910.086] (-903.277) (-910.855) (-913.898) -- 0:00:11
963000 -- (-904.819) [-917.459] (-922.673) (-908.036) * [-907.714] (-924.642) (-917.512) (-909.192) -- 0:00:11
963500 -- (-919.617) (-907.073) (-907.718) [-913.851] * (-909.883) (-915.459) (-910.229) [-907.949] -- 0:00:10
964000 -- (-913.216) (-908.242) [-906.627] (-914.013) * (-912.735) [-906.544] (-908.208) (-911.733) -- 0:00:10
964500 -- (-905.724) (-918.068) [-906.484] (-912.496) * (-912.747) (-908.188) (-918.555) [-902.504] -- 0:00:10
965000 -- [-906.699] (-915.116) (-914.784) (-910.601) * (-910.077) (-907.329) [-907.512] (-909.926) -- 0:00:10
Average standard deviation of split frequencies: 0.007808
965500 -- (-908.192) (-920.558) [-915.435] (-905.522) * [-907.915] (-910.543) (-920.454) (-908.981) -- 0:00:10
966000 -- [-917.029] (-905.012) (-902.991) (-908.695) * (-910.293) [-907.212] (-912.812) (-912.562) -- 0:00:10
966500 -- (-914.739) [-897.035] (-916.632) (-909.979) * [-912.390] (-908.548) (-913.040) (-913.036) -- 0:00:09
967000 -- (-912.309) [-908.484] (-916.627) (-922.405) * (-913.172) (-911.173) (-911.860) [-915.036] -- 0:00:09
967500 -- (-913.625) [-904.408] (-914.914) (-909.172) * (-918.447) (-917.321) [-904.748] (-912.041) -- 0:00:09
968000 -- (-918.436) (-908.726) [-921.944] (-925.803) * (-912.180) (-912.470) [-906.235] (-912.006) -- 0:00:09
968500 -- (-920.777) (-913.735) (-916.097) [-908.405] * [-908.765] (-922.824) (-915.008) (-908.090) -- 0:00:09
969000 -- (-935.475) [-911.640] (-907.733) (-908.544) * (-913.884) (-920.266) [-914.344] (-917.635) -- 0:00:09
969500 -- (-909.146) (-914.786) (-913.889) [-907.168] * (-911.271) [-909.159] (-924.136) (-906.545) -- 0:00:09
970000 -- (-910.888) [-908.934] (-909.559) (-905.040) * (-917.931) (-917.637) [-911.310] (-922.764) -- 0:00:08
Average standard deviation of split frequencies: 0.007576
970500 -- [-906.742] (-916.524) (-915.107) (-914.697) * (-909.435) [-911.837] (-917.377) (-912.197) -- 0:00:08
971000 -- [-904.382] (-910.193) (-911.468) (-918.144) * [-903.720] (-907.972) (-922.407) (-923.446) -- 0:00:08
971500 -- (-907.341) [-907.423] (-912.206) (-909.825) * (-907.637) (-915.105) [-903.363] (-914.615) -- 0:00:08
972000 -- (-914.235) [-909.091] (-910.220) (-910.012) * (-909.481) (-912.892) (-908.050) [-909.556] -- 0:00:08
972500 -- (-910.441) (-917.681) (-912.691) [-917.668] * [-914.035] (-912.075) (-919.720) (-907.705) -- 0:00:08
973000 -- (-911.190) [-909.173] (-910.586) (-916.372) * (-904.967) (-898.012) [-904.037] (-912.690) -- 0:00:08
973500 -- (-906.103) (-912.625) (-918.902) [-907.472] * [-914.127] (-907.578) (-917.220) (-909.138) -- 0:00:07
974000 -- (-909.793) (-919.382) [-907.469] (-905.691) * [-908.898] (-917.937) (-911.558) (-926.731) -- 0:00:07
974500 -- [-910.428] (-913.825) (-906.937) (-922.242) * (-913.532) [-906.060] (-905.055) (-908.809) -- 0:00:07
975000 -- (-904.336) [-910.590] (-919.823) (-919.945) * (-903.102) [-903.190] (-916.821) (-908.296) -- 0:00:07
Average standard deviation of split frequencies: 0.007486
975500 -- [-908.633] (-915.355) (-908.828) (-906.036) * (-910.203) (-915.832) [-914.022] (-914.190) -- 0:00:07
976000 -- [-900.379] (-901.744) (-909.672) (-907.388) * [-905.366] (-907.948) (-916.687) (-910.995) -- 0:00:07
976500 -- (-908.891) (-913.951) (-911.186) [-912.786] * (-912.365) [-908.449] (-907.472) (-906.733) -- 0:00:07
977000 -- (-919.075) (-907.773) (-911.533) [-910.870] * (-917.196) (-909.144) [-902.768] (-908.985) -- 0:00:06
977500 -- (-910.916) [-909.296] (-919.110) (-902.554) * (-917.248) (-904.980) (-908.770) [-913.581] -- 0:00:06
978000 -- (-901.944) (-904.085) (-908.612) [-908.110] * (-917.479) [-902.529] (-915.598) (-914.824) -- 0:00:06
978500 -- (-910.501) (-915.860) [-907.534] (-912.188) * (-910.361) [-910.651] (-914.574) (-911.019) -- 0:00:06
979000 -- (-915.839) (-912.139) [-911.840] (-918.837) * (-909.291) [-918.811] (-915.783) (-909.567) -- 0:00:06
979500 -- (-913.437) (-917.061) [-901.397] (-909.099) * (-913.099) (-916.946) [-910.599] (-907.281) -- 0:00:06
980000 -- [-910.089] (-910.346) (-908.037) (-908.837) * (-912.963) (-908.882) [-911.262] (-903.408) -- 0:00:05
Average standard deviation of split frequencies: 0.007595
980500 -- (-903.615) (-921.110) [-905.791] (-906.103) * (-926.669) (-915.382) (-913.413) [-907.243] -- 0:00:05
981000 -- (-902.992) (-913.690) (-918.762) [-911.325] * (-914.150) [-907.435] (-904.383) (-911.645) -- 0:00:05
981500 -- (-910.264) [-903.500] (-911.365) (-913.239) * (-908.619) [-907.190] (-916.779) (-916.725) -- 0:00:05
982000 -- (-910.433) [-904.087] (-921.761) (-909.468) * (-907.781) [-912.613] (-906.198) (-911.138) -- 0:00:05
982500 -- (-908.650) (-908.466) (-915.516) [-913.731] * (-921.733) (-904.719) (-915.351) [-905.920] -- 0:00:05
983000 -- [-902.346] (-913.865) (-910.205) (-914.941) * (-918.495) (-910.383) (-914.595) [-900.931] -- 0:00:05
983500 -- (-906.412) (-909.481) [-908.014] (-908.265) * (-926.502) [-914.993] (-911.213) (-906.113) -- 0:00:04
984000 -- (-904.988) [-908.079] (-917.838) (-901.943) * (-916.891) (-913.609) (-922.017) [-906.733] -- 0:00:04
984500 -- (-910.677) (-910.878) (-917.060) [-914.254] * (-914.461) (-909.185) [-904.672] (-924.923) -- 0:00:04
985000 -- (-903.450) (-906.467) (-916.287) [-908.357] * (-920.470) (-912.122) (-901.845) [-912.920] -- 0:00:04
Average standard deviation of split frequencies: 0.008247
985500 -- (-914.968) [-903.398] (-912.730) (-910.769) * (-908.229) [-913.603] (-912.693) (-914.126) -- 0:00:04
986000 -- (-907.618) [-908.829] (-908.299) (-915.019) * [-903.837] (-907.997) (-918.865) (-914.081) -- 0:00:04
986500 -- (-915.893) (-915.222) (-909.332) [-913.054] * (-920.904) [-909.245] (-905.385) (-922.932) -- 0:00:04
987000 -- (-906.792) (-907.440) (-917.839) [-912.296] * (-912.341) (-905.240) [-911.775] (-926.821) -- 0:00:03
987500 -- (-906.712) [-907.920] (-915.325) (-911.990) * (-907.386) [-903.434] (-913.717) (-917.200) -- 0:00:03
988000 -- [-906.535] (-913.949) (-917.038) (-909.498) * (-915.215) (-914.243) (-905.560) [-905.916] -- 0:00:03
988500 -- (-914.871) [-907.953] (-922.994) (-923.548) * [-912.090] (-908.250) (-903.042) (-909.224) -- 0:00:03
989000 -- (-921.019) [-907.276] (-923.553) (-911.981) * (-919.273) [-904.364] (-916.187) (-914.777) -- 0:00:03
989500 -- [-909.844] (-906.892) (-911.204) (-909.198) * [-906.982] (-917.903) (-912.016) (-916.263) -- 0:00:03
990000 -- (-908.948) [-907.713] (-909.977) (-916.433) * (-922.624) (-909.348) (-919.810) [-901.643] -- 0:00:02
Average standard deviation of split frequencies: 0.007851
990500 -- (-911.132) [-907.318] (-933.079) (-915.323) * (-909.983) (-911.004) [-906.308] (-912.153) -- 0:00:02
991000 -- (-903.418) (-902.938) (-916.320) [-909.342] * (-910.127) [-909.709] (-918.022) (-904.572) -- 0:00:02
991500 -- [-913.044] (-917.067) (-914.884) (-923.429) * (-913.380) (-919.295) [-911.378] (-899.934) -- 0:00:02
992000 -- [-910.787] (-901.853) (-917.663) (-928.462) * (-915.585) (-904.498) (-924.048) [-902.614] -- 0:00:02
992500 -- [-906.408] (-905.665) (-915.179) (-926.693) * (-919.676) (-913.381) (-910.014) [-905.948] -- 0:00:02
993000 -- (-905.898) (-905.225) (-925.592) [-920.563] * (-918.309) (-912.563) (-909.555) [-906.862] -- 0:00:02
993500 -- [-908.668] (-908.679) (-908.619) (-907.250) * (-911.932) (-917.575) [-916.498] (-915.780) -- 0:00:01
994000 -- (-912.661) (-919.892) (-919.159) [-902.929] * (-918.161) [-916.515] (-905.549) (-910.024) -- 0:00:01
994500 -- (-910.511) (-917.908) (-920.108) [-907.717] * (-916.083) [-903.828] (-919.433) (-914.586) -- 0:00:01
995000 -- (-916.863) (-908.600) (-914.015) [-906.476] * (-906.134) [-902.904] (-913.782) (-916.413) -- 0:00:01
Average standard deviation of split frequencies: 0.007691
995500 -- [-905.107] (-909.170) (-907.875) (-913.395) * (-903.901) [-903.586] (-916.970) (-920.773) -- 0:00:01
996000 -- (-916.886) (-909.223) (-912.400) [-910.545] * (-906.167) (-909.716) (-907.308) [-908.652] -- 0:00:01
996500 -- (-916.533) [-906.439] (-911.426) (-925.425) * [-902.484] (-912.384) (-916.145) (-908.596) -- 0:00:01
997000 -- (-917.892) [-913.665] (-908.332) (-925.269) * (-910.123) (-923.015) [-913.322] (-907.698) -- 0:00:00
997500 -- [-906.100] (-906.887) (-912.531) (-917.950) * [-904.293] (-915.502) (-904.149) (-909.940) -- 0:00:00
998000 -- [-905.268] (-907.867) (-909.640) (-911.431) * [-904.250] (-903.942) (-914.129) (-910.890) -- 0:00:00
998500 -- (-906.302) (-931.051) [-905.459] (-919.511) * (-901.892) (-911.141) [-907.606] (-916.185) -- 0:00:00
999000 -- [-903.872] (-915.939) (-914.481) (-907.515) * (-923.782) (-906.061) (-915.606) [-902.361] -- 0:00:00
999500 -- (-904.732) (-916.368) [-902.830] (-905.664) * (-910.250) (-913.419) (-920.205) [-913.087] -- 0:00:00
1000000 -- (-906.467) (-912.897) [-903.370] (-914.343) * [-906.472] (-923.313) (-906.956) (-902.966) -- 0:00:00
Average standard deviation of split frequencies: 0.007773
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -906.466551 -- 19.071761
Chain 1 -- -906.466558 -- 19.071761
Chain 2 -- -912.897171 -- 17.724316
Chain 2 -- -912.897166 -- 17.724316
Chain 3 -- -903.369788 -- 15.844116
Chain 3 -- -903.369792 -- 15.844116
Chain 4 -- -914.343246 -- 14.056906
Chain 4 -- -914.343243 -- 14.056906
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -906.471674 -- 16.065411
Chain 1 -- -906.471661 -- 16.065411
Chain 2 -- -923.313276 -- 11.216630
Chain 2 -- -923.313276 -- 11.216630
Chain 3 -- -906.956296 -- 13.724015
Chain 3 -- -906.956296 -- 13.724015
Chain 4 -- -902.966219 -- 16.068980
Chain 4 -- -902.966220 -- 16.068980
Analysis completed in 4 mins 58 seconds
Analysis used 297.49 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -894.46
Likelihood of best state for "cold" chain of run 2 was -894.48
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.1 % ( 48 %) Dirichlet(Revmat{all})
73.8 % ( 59 %) Slider(Revmat{all})
33.8 % ( 25 %) Dirichlet(Pi{all})
34.7 % ( 21 %) Slider(Pi{all})
37.0 % ( 32 %) Multiplier(Alpha{1,2})
46.0 % ( 20 %) Multiplier(Alpha{3})
52.5 % ( 28 %) Slider(Pinvar{all})
33.3 % ( 40 %) ExtSPR(Tau{all},V{all})
12.5 % ( 13 %) ExtTBR(Tau{all},V{all})
41.9 % ( 46 %) NNI(Tau{all},V{all})
27.0 % ( 30 %) ParsSPR(Tau{all},V{all})
27.1 % ( 25 %) Multiplier(V{all})
51.1 % ( 55 %) Nodeslider(V{all})
26.3 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.6 % ( 48 %) Dirichlet(Revmat{all})
73.6 % ( 64 %) Slider(Revmat{all})
34.6 % ( 29 %) Dirichlet(Pi{all})
34.2 % ( 29 %) Slider(Pi{all})
37.0 % ( 25 %) Multiplier(Alpha{1,2})
46.3 % ( 26 %) Multiplier(Alpha{3})
52.1 % ( 29 %) Slider(Pinvar{all})
33.0 % ( 32 %) ExtSPR(Tau{all},V{all})
12.3 % ( 7 %) ExtTBR(Tau{all},V{all})
42.2 % ( 53 %) NNI(Tau{all},V{all})
27.0 % ( 28 %) ParsSPR(Tau{all},V{all})
27.1 % ( 26 %) Multiplier(V{all})
51.1 % ( 49 %) Nodeslider(V{all})
25.9 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.72 0.49 0.32
2 | 166155 0.74 0.52
3 | 166600 167181 0.75
4 | 166893 166996 166175
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.72 0.50 0.33
2 | 166225 0.74 0.53
3 | 166748 167382 0.76
4 | 166356 166617 166672
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -905.96
| 2 2 |
| 12 1 1 1 2 2 11 |
|2 121 2 2 1 2 |
| 1 1 11 1 2|
| 1 22 2 1 * 1 2 2 1 1 |
| * 2 1 1 1 1 1 1 1 22 1|
| 2 1 2 11 1 221 2 * 12 1 1 2 * 1 2 |
| 22 2 1 * * 22 2 1 2 1 21 |
| 2 1 2 11 22 2 12 2 2 |
|1 2 2 2 2 2 12 |
| 2 1 2 2 1 |
| 1 1 2 |
| 1 1 * |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -911.03
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.05 -920.58
2 -902.42 -917.98
--------------------------------------
TOTAL -902.22 -919.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.268821 0.052009 0.853714 1.730708 1.249277 1252.22 1376.61 1.001
r(A<->C){all} 0.062076 0.000805 0.013374 0.117128 0.058357 648.52 766.71 1.000
r(A<->G){all} 0.309898 0.006325 0.167056 0.473700 0.302486 649.60 699.33 1.001
r(A<->T){all} 0.048614 0.001635 0.000004 0.126531 0.038888 635.20 667.13 1.002
r(C<->G){all} 0.060836 0.000568 0.019268 0.107490 0.058402 972.84 1016.37 1.000
r(C<->T){all} 0.447272 0.007439 0.277694 0.605797 0.446625 468.21 533.35 1.000
r(G<->T){all} 0.071304 0.001282 0.009186 0.140505 0.065774 547.54 575.34 1.000
pi(A){all} 0.199817 0.000429 0.158778 0.240747 0.199497 1100.68 1107.35 1.000
pi(C){all} 0.293292 0.000574 0.245764 0.338201 0.293025 1204.01 1210.33 1.000
pi(G){all} 0.303565 0.000591 0.257447 0.349787 0.303071 989.78 1044.92 1.000
pi(T){all} 0.203325 0.000464 0.162366 0.247852 0.203335 935.18 979.95 1.000
alpha{1,2} 0.076717 0.000451 0.027168 0.120270 0.077426 1017.23 1104.00 1.001
alpha{3} 2.168964 0.613283 0.930709 3.843801 2.042884 1244.39 1275.74 1.001
pinvar{all} 0.513680 0.003394 0.399276 0.624896 0.517660 1183.53 1205.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- .........**
13 -- ...********
14 -- .....******
15 -- .......**..
16 -- .**........
17 -- ......*..**
18 -- ....*******
19 -- ...**......
20 -- .....*..*..
21 -- ..*********
22 -- ...*.******
23 -- .*.********
24 -- .....*.**..
25 -- .....**..**
26 -- .....**....
27 -- .....**.***
28 -- .....*.****
29 -- .....*...**
30 -- .....****..
31 -- ...*****.**
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2983 0.993671 0.004240 0.990673 0.996669 2
13 2691 0.896402 0.006124 0.892072 0.900733 2
14 2391 0.796469 0.003298 0.794137 0.798801 2
15 1542 0.513658 0.008480 0.507662 0.519654 2
16 1302 0.433711 0.004711 0.430380 0.437042 2
17 1132 0.377082 0.015075 0.366422 0.387742 2
18 909 0.302798 0.013662 0.293138 0.312458 2
19 899 0.299467 0.008009 0.293804 0.305130 2
20 884 0.294470 0.007537 0.289141 0.299800 2
21 785 0.261492 0.005182 0.257828 0.265157 2
22 777 0.258827 0.002355 0.257162 0.260493 2
23 734 0.244504 0.000942 0.243837 0.245170 2
24 672 0.223851 0.015075 0.213191 0.234510 2
25 653 0.217522 0.011777 0.209194 0.225849 2
26 502 0.167222 0.014133 0.157229 0.177215 2
27 461 0.153564 0.013662 0.143904 0.163225 2
28 392 0.130580 0.003769 0.127915 0.133245 2
29 349 0.116256 0.008009 0.110593 0.121919 2
30 327 0.108927 0.005182 0.105263 0.112592 2
31 303 0.100933 0.004240 0.097935 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.043746 0.000455 0.007404 0.085336 0.040325 1.000 2
length{all}[2] 0.015617 0.000134 0.000523 0.039147 0.012943 1.000 2
length{all}[3] 0.014918 0.000127 0.000032 0.036180 0.012061 1.000 2
length{all}[4] 0.021058 0.000225 0.000343 0.049650 0.017881 1.000 2
length{all}[5] 0.057820 0.000776 0.010491 0.112682 0.053606 1.000 2
length{all}[6] 0.067262 0.001495 0.002088 0.139815 0.062369 1.000 2
length{all}[7] 0.105165 0.001889 0.036386 0.193226 0.098425 1.000 2
length{all}[8] 0.179088 0.005470 0.035214 0.318553 0.171556 1.000 2
length{all}[9] 0.336028 0.010995 0.155359 0.547794 0.320145 1.000 2
length{all}[10] 0.085871 0.001469 0.021840 0.162800 0.079607 1.001 2
length{all}[11] 0.058389 0.001090 0.000428 0.121123 0.052713 1.001 2
length{all}[12] 0.079007 0.001624 0.013627 0.159744 0.071043 1.000 2
length{all}[13] 0.032092 0.000360 0.003791 0.072119 0.028275 1.002 2
length{all}[14] 0.039407 0.000587 0.003481 0.087125 0.034451 1.000 2
length{all}[15] 0.099629 0.003878 0.002448 0.220462 0.089755 1.000 2
length{all}[16] 0.012274 0.000138 0.000003 0.035092 0.009504 1.002 2
length{all}[17] 0.025260 0.000477 0.000163 0.066202 0.020042 1.004 2
length{all}[18] 0.011521 0.000139 0.000025 0.035023 0.008074 0.999 2
length{all}[19] 0.010793 0.000125 0.000013 0.033344 0.007416 0.999 2
length{all}[20] 0.045142 0.000873 0.000022 0.102100 0.039530 1.000 2
length{all}[21] 0.008284 0.000068 0.000014 0.025757 0.005800 0.999 2
length{all}[22] 0.009834 0.000106 0.000002 0.030202 0.006836 0.999 2
length{all}[23] 0.008356 0.000083 0.000012 0.026339 0.005293 0.999 2
length{all}[24] 0.024271 0.000517 0.000101 0.069826 0.018311 0.999 2
length{all}[25] 0.027538 0.000610 0.000027 0.073132 0.020540 1.000 2
length{all}[26] 0.024371 0.000555 0.000064 0.067533 0.017039 0.998 2
length{all}[27] 0.029090 0.000647 0.000067 0.075136 0.021840 1.002 2
length{all}[28] 0.020813 0.000406 0.000014 0.058429 0.014770 0.998 2
length{all}[29] 0.021914 0.000381 0.000027 0.059865 0.016825 0.999 2
length{all}[30] 0.017552 0.000385 0.000117 0.051433 0.011177 0.999 2
length{all}[31] 0.031762 0.000379 0.002156 0.066902 0.027601 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007773
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
+ /---------------------------------------------------- C4 (4)
| |
| |---------------------------------------------------- C5 (5)
| |
| | /----------------------------------- C6 (6)
\--------90-------+ |
| |----------------------------------- C7 (7)
| |
| | /----------------- C8 (8)
\-------80-------+--------51-------+
| \----------------- C9 (9)
|
| /----------------- C10 (10)
\--------99-------+
\----------------- C11 (11)
Phylogram (based on average branch lengths):
/------ C1 (1)
|
|-- C2 (2)
|
|-- C3 (3)
|
+ /--- C4 (4)
| |
| |-------- C5 (5)
| |
| | /--------- C6 (6)
\---+ |
| |--------------- C7 (7)
| |
| | /-------------------------- C8 (8)
\-----+------------+
| \------------------------------------------------- C9 (9)
|
| /------------- C10 (10)
\---------+
\-------- C11 (11)
|--------------| 0.100 expected changes per site
Calculating tree probabilities...
Credible sets of trees (890 trees sampled):
50 % credible set contains 102 trees
90 % credible set contains 590 trees
95 % credible set contains 740 trees
99 % credible set contains 860 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 321
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
6 ambiguity characters in seq. 2
6 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
6 ambiguity characters in seq. 6
6 ambiguity characters in seq. 7
6 ambiguity characters in seq. 8
6 ambiguity characters in seq. 9
12 ambiguity characters in seq. 10
12 ambiguity characters in seq. 11
4 sites are removed. 24 25 106 107
Sequences read..
Counting site patterns.. 0:00
80 patterns at 103 / 103 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
78080 bytes for conP
10880 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
195200 bytes for conP, adjusted
0.047644 0.013796 0.010633 0.013675 0.034188 0.070808 0.028952 0.071287 0.116128 0.079830 0.157428 0.260076 0.062240 0.075691 0.071203 0.300000 1.300000
ntime & nrate & np: 15 2 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 17
lnL0 = -1071.248084
Iterating by ming2
Initial: fx= 1071.248084
x= 0.04764 0.01380 0.01063 0.01368 0.03419 0.07081 0.02895 0.07129 0.11613 0.07983 0.15743 0.26008 0.06224 0.07569 0.07120 0.30000 1.30000
1 h-m-p 0.0000 0.0005 221.9164 +++ 1065.177816 m 0.0005 23 | 0/17
2 h-m-p 0.0000 0.0000 11535.0615 +YYYCCC 1060.263534 5 0.0000 51 | 0/17
3 h-m-p 0.0001 0.0011 959.4437 +YYCCC 1045.379369 4 0.0004 78 | 0/17
4 h-m-p 0.0001 0.0007 233.5375 +CYCYYYCC 1029.629491 7 0.0007 109 | 0/17
5 h-m-p 0.0000 0.0001 1703.6598 +YYCYYYCCC 1012.941139 8 0.0001 141 | 0/17
6 h-m-p 0.0001 0.0004 1680.8325 +CYCYYCCC 968.906184 7 0.0003 173 | 0/17
7 h-m-p 0.0000 0.0001 621.3909 +YCYCCC 966.968671 5 0.0000 202 | 0/17
8 h-m-p 0.0001 0.0012 537.0224 +++ 855.415181 m 0.0012 223 | 0/17
9 h-m-p 0.0127 0.2337 52.1209 -YYYCCC 851.577432 5 0.0009 251 | 0/17
10 h-m-p 0.0003 0.0015 63.0742 +YYCCCC 848.523800 5 0.0010 280 | 0/17
11 h-m-p 0.0003 0.0015 41.1173 +YCCCC 847.811880 4 0.0008 308 | 0/17
12 h-m-p 0.0009 0.0060 36.0744 +YCYCCC 846.305605 5 0.0025 337 | 0/17
13 h-m-p 0.0026 0.0129 21.2363 +YC 844.894782 1 0.0065 359 | 0/17
14 h-m-p 0.0007 0.0036 58.0792 YCYCCC 843.405123 5 0.0020 387 | 0/17
15 h-m-p 0.0019 0.0097 12.3067 YCCC 842.941342 3 0.0043 412 | 0/17
16 h-m-p 0.0011 0.0057 11.6204 +YCCC 842.586819 3 0.0037 438 | 0/17
17 h-m-p 0.0157 0.0786 1.6723 +CYCC 841.157259 3 0.0575 464 | 0/17
18 h-m-p 0.0014 0.0071 23.9341 +YYCCCC 837.703461 5 0.0047 493 | 0/17
19 h-m-p 0.0011 0.0057 56.0907 +YCYCCC 832.050789 5 0.0034 522 | 0/17
20 h-m-p 0.0008 0.0041 22.1293 CCCC 831.819723 3 0.0012 548 | 0/17
21 h-m-p 0.0829 0.9846 0.3212 +CYCCC 825.762613 4 0.4155 576 | 0/17
22 h-m-p 0.1077 0.5387 0.2435 YCYCCC 823.319039 5 0.2553 621 | 0/17
23 h-m-p 0.7054 8.0000 0.0882 CCYC 821.359669 3 0.7121 663 | 0/17
24 h-m-p 0.6221 3.1107 0.0373 CCCCC 820.483510 4 1.0173 708 | 0/17
25 h-m-p 0.6367 3.1833 0.0551 CCCC 819.632556 3 0.7965 751 | 0/17
26 h-m-p 1.5483 7.7417 0.0276 CYC 818.885384 2 1.3656 791 | 0/17
27 h-m-p 1.4658 7.7608 0.0257 YCCC 817.824384 3 2.5265 833 | 0/17
28 h-m-p 1.6000 8.0000 0.0313 CCC 817.241212 2 1.4863 874 | 0/17
29 h-m-p 1.6000 8.0000 0.0214 YCCC 816.327752 3 2.8991 916 | 0/17
30 h-m-p 1.6000 8.0000 0.0291 CYC 815.983048 2 1.7516 956 | 0/17
31 h-m-p 1.6000 8.0000 0.0189 YCC 815.780656 2 2.7279 996 | 0/17
32 h-m-p 1.6000 8.0000 0.0214 CYC 815.670756 2 1.9513 1036 | 0/17
33 h-m-p 1.6000 8.0000 0.0093 CCC 815.595600 2 2.3116 1077 | 0/17
34 h-m-p 1.6000 8.0000 0.0033 +YC 815.464619 1 5.2678 1116 | 0/17
35 h-m-p 1.6000 8.0000 0.0047 +YCCC 815.185988 3 5.1269 1159 | 0/17
36 h-m-p 0.9974 8.0000 0.0241 +C 814.800081 0 3.9894 1197 | 0/17
37 h-m-p 1.6000 8.0000 0.0300 CYC 814.644631 2 1.8349 1237 | 0/17
38 h-m-p 1.6000 8.0000 0.0071 YYC 814.604290 2 1.2003 1276 | 0/17
39 h-m-p 1.6000 8.0000 0.0045 CC 814.586158 1 1.4331 1315 | 0/17
40 h-m-p 0.9445 8.0000 0.0068 +CC 814.565262 1 3.9573 1355 | 0/17
41 h-m-p 1.6000 8.0000 0.0141 YC 814.546272 1 3.0869 1393 | 0/17
42 h-m-p 1.6000 8.0000 0.0212 YC 814.521491 1 3.4402 1431 | 0/17
43 h-m-p 1.6000 8.0000 0.0085 CC 814.516817 1 1.4559 1470 | 0/17
44 h-m-p 1.6000 8.0000 0.0017 +CC 814.510924 1 5.6625 1510 | 0/17
45 h-m-p 1.6000 8.0000 0.0014 ++ 814.464541 m 8.0000 1547 | 0/17
46 h-m-p 1.0849 8.0000 0.0107 YCCC 814.229044 3 1.9536 1589 | 0/17
47 h-m-p 1.5399 8.0000 0.0136 ++ 813.445424 m 8.0000 1626 | 0/17
48 h-m-p 1.2825 6.4123 0.0255 CCCCC 813.009667 4 2.0315 1671 | 0/17
49 h-m-p 1.6000 8.0000 0.0238 YCCC 812.733305 3 2.9591 1713 | 0/17
50 h-m-p 1.6000 8.0000 0.0311 YCCC 812.410132 3 2.7998 1755 | 0/17
51 h-m-p 1.6000 8.0000 0.0124 CCC 812.269782 2 2.3106 1796 | 0/17
52 h-m-p 1.6000 8.0000 0.0090 CCC 812.229274 2 2.1258 1837 | 0/17
53 h-m-p 1.6000 8.0000 0.0080 C 812.223826 0 1.5835 1874 | 0/17
54 h-m-p 1.6000 8.0000 0.0011 CC 812.223640 1 1.2749 1913 | 0/17
55 h-m-p 1.6000 8.0000 0.0005 C 812.223634 0 1.3931 1950 | 0/17
56 h-m-p 1.6000 8.0000 0.0000 Y 812.223634 0 1.1817 1987 | 0/17
57 h-m-p 1.6000 8.0000 0.0000 C 812.223634 0 1.4963 2024 | 0/17
58 h-m-p 1.6000 8.0000 0.0000 Y 812.223634 0 0.2025 2061 | 0/17
59 h-m-p 0.2434 8.0000 0.0000 -Y 812.223634 0 0.0152 2099 | 0/17
60 h-m-p 0.0174 8.0000 0.0000 -------------.. | 0/17
61 h-m-p 0.0160 8.0000 0.0008 --------C 812.223634 0 0.0000 2192
Out..
lnL = -812.223634
2193 lfun, 2193 eigenQcodon, 32895 P(t)
Time used: 0:08
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
0.047644 0.013796 0.010633 0.013675 0.034188 0.070808 0.028952 0.071287 0.116128 0.079830 0.157428 0.260076 0.062240 0.075691 0.071203 2.069209 0.579915 0.172397
ntime & nrate & np: 15 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.686095
np = 18
lnL0 = -913.505002
Iterating by ming2
Initial: fx= 913.505002
x= 0.04764 0.01380 0.01063 0.01368 0.03419 0.07081 0.02895 0.07129 0.11613 0.07983 0.15743 0.26008 0.06224 0.07569 0.07120 2.06921 0.57992 0.17240
1 h-m-p 0.0000 0.0012 254.5417 ++++ 849.819146 m 0.0012 25 | 1/18
2 h-m-p 0.0001 0.0007 481.5886 +YCYCCC 832.226027 5 0.0004 55 | 0/18
3 h-m-p 0.0000 0.0000 4257.0452 YCYCCC 831.598743 5 0.0000 84 | 0/18
4 h-m-p 0.0002 0.0008 82.9869 +YYYCCC 829.441539 5 0.0006 113 | 0/18
5 h-m-p 0.0001 0.0006 79.1970 YCCCC 829.035456 4 0.0002 141 | 0/18
6 h-m-p 0.0004 0.0037 47.9315 +YYC 828.165751 2 0.0012 165 | 0/18
7 h-m-p 0.0003 0.0013 56.5634 CYCCC 827.857449 4 0.0005 193 | 0/18
8 h-m-p 0.0015 0.0077 15.4153 CCCC 827.645572 3 0.0023 220 | 0/18
9 h-m-p 0.0032 0.0158 7.6623 YC 827.599329 1 0.0019 242 | 0/18
10 h-m-p 0.0036 0.0381 3.9791 YCC 827.537841 2 0.0066 266 | 0/18
11 h-m-p 0.0031 0.0191 8.4998 CCC 827.436673 2 0.0049 291 | 0/18
12 h-m-p 0.0017 0.0096 24.3026 +YCCC 827.150335 3 0.0046 318 | 0/18
13 h-m-p 0.0017 0.0085 28.5399 +YCCC 826.785983 3 0.0049 345 | 0/18
14 h-m-p 0.0004 0.0020 112.5863 ++ 826.172406 m 0.0020 366 | 0/18
15 h-m-p 0.0034 0.0178 67.1564 CYC 825.636115 2 0.0032 390 | 0/18
16 h-m-p 0.0041 0.0204 26.7920 YC 825.510241 1 0.0020 412 | 0/18
17 h-m-p 0.0134 0.0813 3.9154 CCC 825.468715 2 0.0044 437 | 0/18
18 h-m-p 0.0099 0.6083 1.7506 ++CYCCCC 819.724612 5 0.4443 470 | 0/18
19 h-m-p 0.0006 0.0032 109.0010 YCYCCC 818.614472 5 0.0015 499 | 0/18
20 h-m-p 0.0755 0.3773 1.1903 ++ 815.262770 m 0.3773 520 | 1/18
21 h-m-p 0.0434 0.2171 6.0546 YCCCC 813.977983 4 0.1106 548 | 1/18
22 h-m-p 0.0504 0.2519 3.6935 YCCCC 812.932172 4 0.1117 576 | 1/18
23 h-m-p 0.4759 2.6318 0.8669 YCCC 812.444655 3 0.2566 602 | 1/18
24 h-m-p 0.3953 1.9763 0.1843 YCC 812.297166 2 0.3001 643 | 1/18
25 h-m-p 0.8861 4.4304 0.0492 CC 812.243799 1 0.3548 683 | 1/18
26 h-m-p 1.6000 8.0000 0.0085 YC 812.230093 1 0.8395 722 | 1/18
27 h-m-p 0.4347 8.0000 0.0163 YC 812.227133 1 0.7582 761 | 1/18
28 h-m-p 1.0642 8.0000 0.0116 C 812.225424 0 1.1010 799 | 1/18
29 h-m-p 1.1857 8.0000 0.0108 CC 812.224539 1 1.0581 839 | 1/18
30 h-m-p 1.6000 8.0000 0.0031 YC 812.224377 1 0.9407 878 | 1/18
31 h-m-p 1.6000 8.0000 0.0010 YC 812.224351 1 0.8571 917 | 1/18
32 h-m-p 1.6000 8.0000 0.0002 Y 812.224350 0 0.9692 955 | 1/18
33 h-m-p 1.6000 8.0000 0.0000 Y 812.224350 0 1.1812 993 | 1/18
34 h-m-p 1.6000 8.0000 0.0000 Y 812.224350 0 1.0591 1031 | 1/18
35 h-m-p 1.6000 8.0000 0.0000 Y 812.224350 0 1.0490 1069 | 1/18
36 h-m-p 1.6000 8.0000 0.0000 C 812.224350 0 2.0815 1107 | 1/18
37 h-m-p 1.6000 8.0000 0.0000 ------Y 812.224350 0 0.0001 1151
Out..
lnL = -812.224350
1152 lfun, 3456 eigenQcodon, 34560 P(t)
Time used: 0:17
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
initial w for M2:NSpselection reset.
0.047644 0.013796 0.010633 0.013675 0.034188 0.070808 0.028952 0.071287 0.116128 0.079830 0.157428 0.260076 0.062240 0.075691 0.071203 2.069236 1.265673 0.374565 0.422161 2.960589
ntime & nrate & np: 15 3 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.074877
np = 20
lnL0 = -955.877617
Iterating by ming2
Initial: fx= 955.877617
x= 0.04764 0.01380 0.01063 0.01368 0.03419 0.07081 0.02895 0.07129 0.11613 0.07983 0.15743 0.26008 0.06224 0.07569 0.07120 2.06924 1.26567 0.37456 0.42216 2.96059
1 h-m-p 0.0000 0.0036 203.6576 +++++ 918.918799 m 0.0036 28 | 0/20
2 h-m-p 0.0000 0.0000 12563.2794 ++ 880.475158 m 0.0000 51 | 1/20
3 h-m-p 0.0023 0.0152 103.6161 YCCC 864.994678 3 0.0055 79 | 0/20
4 h-m-p 0.0000 0.0002 5923.3570 -YYCCC 864.766746 4 0.0000 109 | 0/20
5 h-m-p 0.0002 0.0027 104.1014 ++YYYYYYCC 857.218123 7 0.0024 142 | 0/20
6 h-m-p 0.0002 0.0010 298.1093 +YYCYYYCC 850.591891 7 0.0009 175 | 0/20
7 h-m-p 0.0000 0.0002 1684.1274 +YYYCCC 845.140126 5 0.0002 206 | 0/20
8 h-m-p 0.0006 0.0030 136.4730 +YYYYCCC 839.214263 6 0.0023 238 | 0/20
9 h-m-p 0.0007 0.0033 50.2311 YCCCCC 838.381859 5 0.0013 270 | 0/20
10 h-m-p 0.0013 0.0144 49.4598 +YCYCCCC 834.046853 6 0.0076 304 | 0/20
11 h-m-p 0.0020 0.0099 78.5169 CYCCC 831.371381 4 0.0037 334 | 0/20
12 h-m-p 0.0043 0.0217 29.6103 CCCCC 830.144149 4 0.0058 365 | 0/20
13 h-m-p 0.0048 0.0403 35.5714 YCCC 827.374689 3 0.0121 393 | 0/20
14 h-m-p 0.0031 0.0155 79.5586 CCCCC 824.984062 4 0.0048 424 | 0/20
15 h-m-p 0.0076 0.0379 41.7052 CYC 823.322984 2 0.0073 450 | 0/20
16 h-m-p 0.0095 0.0473 22.6127 CCC 821.689686 2 0.0146 477 | 0/20
17 h-m-p 0.0135 0.0675 9.7550 CCCC 820.985552 3 0.0193 506 | 0/20
18 h-m-p 0.0296 0.1481 4.7816 CCCCC 820.488119 4 0.0377 537 | 0/20
19 h-m-p 0.0067 0.1290 26.7585 +CCCC 817.521373 3 0.0448 567 | 0/20
20 h-m-p 0.0053 0.0265 50.1644 CCC 817.003356 2 0.0046 594 | 0/20
21 h-m-p 0.2591 2.4244 0.8940 +YYYYC 815.270868 4 1.0033 622 | 0/20
22 h-m-p 0.4605 2.3023 1.0523 YYCC 814.783119 3 0.4055 669 | 0/20
23 h-m-p 0.3100 1.5499 1.1053 CCCC 814.163017 3 0.4599 698 | 0/20
24 h-m-p 0.2755 1.3774 0.7650 CCCCC 813.905827 4 0.3311 729 | 0/20
25 h-m-p 0.2548 5.4339 0.9940 +YCCC 813.504212 3 0.7005 778 | 0/20
26 h-m-p 0.5884 2.9419 1.1559 CYCCC 813.091732 4 0.9411 828 | 0/20
27 h-m-p 0.9187 4.5934 1.1681 YCC 812.912590 2 0.5924 854 | 0/20
28 h-m-p 0.6636 3.3180 0.9630 CCCC 812.758153 3 0.7928 883 | 0/20
29 h-m-p 0.5719 5.5192 1.3349 CCCC 812.605712 3 0.8082 932 | 0/20
30 h-m-p 0.8296 6.3650 1.3004 YCC 812.510745 2 0.6509 958 | 0/20
31 h-m-p 0.6000 7.6997 1.4109 CCC 812.433272 2 0.6995 985 | 0/20
32 h-m-p 1.0083 8.0000 0.9788 YC 812.400814 1 0.5331 1009 | 0/20
33 h-m-p 0.4990 8.0000 1.0458 C 812.380487 0 0.5004 1052 | 0/20
34 h-m-p 0.8100 8.0000 0.6461 YC 812.347638 1 1.7427 1076 | 0/20
35 h-m-p 0.8276 8.0000 1.3606 CCC 812.307632 2 1.1146 1123 | 0/20
36 h-m-p 0.7638 8.0000 1.9855 CCC 812.254019 2 0.9355 1150 | 0/20
37 h-m-p 1.2462 8.0000 1.4905 YC 812.237265 1 0.5514 1174 | 0/20
38 h-m-p 1.0886 8.0000 0.7550 YC 812.232647 1 0.5615 1198 | 0/20
39 h-m-p 1.5075 8.0000 0.2812 YC 812.231480 1 0.6957 1242 | 0/20
40 h-m-p 0.8430 8.0000 0.2321 C 812.231147 0 0.8430 1285 | 0/20
41 h-m-p 1.1109 8.0000 0.1761 CC 812.230687 1 1.7127 1330 | 0/20
42 h-m-p 1.0237 8.0000 0.2946 CC 812.230002 1 1.5598 1375 | 0/20
43 h-m-p 1.0465 8.0000 0.4391 +YC 812.227621 1 3.3242 1420 | 0/20
44 h-m-p 1.0634 8.0000 1.3726 CC 812.225780 1 0.9001 1465 | 0/20
45 h-m-p 0.9382 8.0000 1.3168 CC 812.224747 1 1.0703 1490 | 0/20
46 h-m-p 1.5915 8.0000 0.8855 CC 812.224193 1 2.2760 1515 | 0/20
47 h-m-p 1.6000 8.0000 1.1345 C 812.223881 0 1.6000 1558 | 0/20
48 h-m-p 1.6000 8.0000 0.9932 C 812.223751 0 2.0931 1581 | 0/20
49 h-m-p 1.6000 8.0000 0.8907 C 812.223685 0 2.1827 1624 | 0/20
50 h-m-p 1.6000 8.0000 0.9404 C 812.223657 0 2.2096 1667 | 0/20
51 h-m-p 1.6000 8.0000 0.9253 C 812.223645 0 2.1261 1710 | 0/20
52 h-m-p 1.6000 8.0000 0.9562 C 812.223639 0 2.1180 1753 | 0/20
53 h-m-p 1.6000 8.0000 0.9253 C 812.223636 0 2.3703 1796 | 0/20
54 h-m-p 1.6000 8.0000 0.8994 C 812.223635 0 2.3723 1839 | 0/20
55 h-m-p 1.6000 8.0000 0.9128 Y 812.223634 0 2.5611 1882 | 0/20
56 h-m-p 1.6000 8.0000 0.8808 C 812.223634 0 2.2404 1925 | 0/20
57 h-m-p 1.6000 8.0000 0.9340 Y 812.223634 0 2.7863 1968 | 0/20
58 h-m-p 1.6000 8.0000 0.8742 C 812.223634 0 1.9991 2011 | 0/20
59 h-m-p 1.6000 8.0000 0.9187 Y 812.223634 0 3.1377 2054 | 0/20
60 h-m-p 1.6000 8.0000 0.8854 C 812.223634 0 2.0076 2097 | 0/20
61 h-m-p 1.3591 8.0000 1.3079 +Y 812.223634 0 4.0882 2141 | 0/20
62 h-m-p 1.4585 8.0000 3.6660 C 812.223634 0 0.5612 2164 | 0/20
63 h-m-p 0.3784 8.0000 5.4380 Y 812.223634 0 0.2705 2187 | 0/20
64 h-m-p 1.6000 8.0000 0.4140 ----Y 812.223634 0 0.0016 2214 | 0/20
65 h-m-p 0.0160 8.0000 0.2103 -Y 812.223634 0 0.0010 2258 | 0/20
66 h-m-p 0.0201 8.0000 0.0104 -------------.. | 0/20
67 h-m-p 0.0160 8.0000 0.0213 ------------- | 0/20
68 h-m-p 0.0160 8.0000 0.0213 -------------
Out..
lnL = -812.223634
2421 lfun, 9684 eigenQcodon, 108945 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -844.122793 S = -827.539082 -9.592266
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 80 patterns 0:46
did 20 / 80 patterns 0:46
did 30 / 80 patterns 0:46
did 40 / 80 patterns 0:46
did 50 / 80 patterns 0:46
did 60 / 80 patterns 0:46
did 70 / 80 patterns 0:46
did 80 / 80 patterns 0:46
Time used: 0:46
Model 3: discrete
TREE # 1
(1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
0.047644 0.013796 0.010633 0.013675 0.034188 0.070808 0.028952 0.071287 0.116128 0.079830 0.157428 0.260076 0.062240 0.075691 0.071203 2.069208 0.296071 0.323761 0.002686 0.006899 0.011063
ntime & nrate & np: 15 4 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 22.845993
np = 21
lnL0 = -814.462009
Iterating by ming2
Initial: fx= 814.462009
x= 0.04764 0.01380 0.01063 0.01368 0.03419 0.07081 0.02895 0.07129 0.11613 0.07983 0.15743 0.26008 0.06224 0.07569 0.07120 2.06921 0.29607 0.32376 0.00269 0.00690 0.01106
1 h-m-p 0.0000 0.0001 142.4718 ++ 813.575430 m 0.0001 47 | 1/21
2 h-m-p 0.0001 0.0004 166.3879 CCCC 813.120734 3 0.0001 98 | 1/21
3 h-m-p 0.0002 0.0008 51.2204 CYCCC 812.736986 4 0.0003 149 | 1/21
4 h-m-p 0.0003 0.0014 41.0864 CCCC 812.498261 3 0.0004 199 | 1/21
5 h-m-p 0.0003 0.0044 55.9538 YCCC 812.413680 3 0.0002 248 | 1/21
6 h-m-p 0.0005 0.0059 16.8247 CCC 812.327453 2 0.0009 296 | 1/21
7 h-m-p 0.0003 0.0014 22.7980 YYC 812.302433 2 0.0002 342 | 1/21
8 h-m-p 0.0003 0.0077 21.2679 CCC 812.274176 2 0.0004 390 | 1/21
9 h-m-p 0.0013 0.0186 6.2236 YC 812.263238 1 0.0008 435 | 1/21
10 h-m-p 0.0023 0.0213 2.3100 YC 812.260307 1 0.0014 480 | 1/21
11 h-m-p 0.0018 0.0162 1.7749 YC 812.259112 1 0.0012 525 | 1/21
12 h-m-p 0.0020 0.0158 1.0598 CC 812.258123 1 0.0026 571 | 1/21
13 h-m-p 0.0019 0.0094 1.2076 CC 812.257389 1 0.0022 617 | 1/21
14 h-m-p 0.0018 0.0091 0.8274 CC 812.256888 1 0.0027 663 | 1/21
15 h-m-p 0.0013 0.0064 0.8232 +YC 812.256281 1 0.0037 709 | 1/21
16 h-m-p 0.0066 0.0331 0.2611 C 812.256035 0 0.0058 753 | 1/21
17 h-m-p 0.0042 2.0909 0.6926 ++CC 812.249413 1 0.0581 801 | 1/21
18 h-m-p 0.0020 0.0518 20.1771 YCC 812.238791 2 0.0032 848 | 1/21
19 h-m-p 0.1652 0.8260 0.0636 YCC 812.231550 2 0.3094 895 | 1/21
20 h-m-p 1.3984 8.0000 0.0141 YC 812.228501 1 1.0845 940 | 0/21
21 h-m-p 0.0095 0.1455 1.6103 ---Y 812.228498 0 0.0001 987 | 0/21
22 h-m-p 0.0033 1.0129 0.0333 +++CC 812.228205 1 0.3330 1037 | 0/21
23 h-m-p 0.0403 0.2016 0.0218 ++ 812.228133 m 0.2016 1082 | 1/21
24 h-m-p 0.6259 8.0000 0.0070 YC 812.228011 1 1.0469 1128 | 0/21
25 h-m-p 0.0000 0.0003 3949.3010 ---Y 812.228011 0 0.0000 1175 | 1/21
26 h-m-p 0.0177 8.0000 0.0046 ++++Y 812.227920 0 5.7130 1224 | 0/21
27 h-m-p 0.0000 0.0000 46640.7286 ---Y 812.227920 0 0.0000 1271 | 1/21
28 h-m-p 0.0353 8.0000 0.0195 ++++ 812.227646 m 8.0000 1318 | 0/21
29 h-m-p 0.0000 0.0000 467141.9924 ++ 812.227643 m 0.0000 1362 | 1/21
30 h-m-p 0.1141 8.0000 0.0073 ++CC 812.227150 1 2.2219 1411 | 0/21
31 h-m-p 0.0000 0.0001 2192.3273 --Y 812.227150 0 0.0000 1457 | 1/21
32 h-m-p 0.0160 8.0000 0.0716 ++++YC 812.226569 1 2.6971 1507 | 0/21
33 h-m-p 0.0000 0.0000 556470.9439 -Y 812.226563 0 0.0000 1552 | 1/21
34 h-m-p 0.1836 8.0000 0.0890 ++C 812.225879 0 2.9854 1599 | 0/21
35 h-m-p 0.0000 0.0000 490321.7388 C 812.225842 0 0.0000 1643 | 0/21
36 h-m-p 0.4110 2.0550 0.0351 +C 812.225446 0 1.5276 1689 | 0/21
37 h-m-p 0.0258 0.1289 0.2150 ++ 812.225377 m 0.1289 1734 | 1/21
38 h-m-p 0.1178 8.0000 0.2353 +CCC 812.225177 2 0.5923 1784 | 0/21
39 h-m-p 0.0000 0.0000 93523.4857 --Y 812.225176 0 0.0000 1830 | 1/21
40 h-m-p 0.0799 8.0000 0.0592 +++YC 812.224836 1 4.0222 1879 | 0/21
41 h-m-p 0.0000 0.0003 10442.9777 --C 812.224836 0 0.0000 1925 | 1/21
42 h-m-p 0.0320 8.0000 0.1236 +++C 812.224552 0 2.2574 1973 | 0/21
43 h-m-p 0.0000 0.0000 153526.7380 -Y 812.224547 0 0.0000 2018 | 0/21
44 h-m-p 0.4458 2.2531 0.0882 C 812.224463 0 0.5423 2063 | 0/21
45 h-m-p 0.0893 0.4464 0.1750 ++ 812.224340 m 0.4464 2108 | 1/21
46 h-m-p 0.1651 8.0000 0.4733 YC 812.224229 1 0.3318 2154 | 0/21
47 h-m-p 0.0000 0.0000 139429.7845 --C 812.224227 0 0.0000 2200 | 1/21
48 h-m-p 0.3376 8.0000 0.0516 ++YC 812.224056 1 4.0333 2248 | 0/21
49 h-m-p 0.0000 0.0005 4859.9230 -Y 812.224056 0 0.0000 2293 | 0/21
50 h-m-p 0.0812 2.1496 0.1000 +++ 812.223954 m 2.1496 2339 | 1/21
51 h-m-p 0.5742 8.0000 0.3744 C 812.223902 0 0.5742 2384 | 1/21
52 h-m-p 1.2329 8.0000 0.1744 YC 812.223841 1 2.8115 2429 | 0/21
53 h-m-p 0.0318 7.3523 15.4198 C 812.223787 0 0.0096 2473 | 0/21
54 h-m-p 0.2987 8.0000 0.4947 Y 812.223758 0 0.2987 2518 | 0/21
55 h-m-p 0.6764 8.0000 0.2185 C 812.223693 0 0.7793 2563 | 0/21
56 h-m-p 0.6309 8.0000 0.2699 YC 812.223665 1 0.3293 2609 | 0/21
57 h-m-p 0.8649 8.0000 0.1027 Y 812.223641 0 0.8649 2654 | 0/21
58 h-m-p 1.6000 8.0000 0.0428 Y 812.223636 0 0.9002 2699 | 0/21
59 h-m-p 1.6000 8.0000 0.0038 C 812.223635 0 1.8706 2744 | 0/21
60 h-m-p 0.3819 8.0000 0.0186 Y 812.223634 0 0.9506 2789 | 0/21
61 h-m-p 1.6000 8.0000 0.0014 C 812.223634 0 0.4075 2834 | 0/21
62 h-m-p 0.5285 8.0000 0.0010 -Y 812.223634 0 0.0646 2880 | 0/21
63 h-m-p 0.0682 8.0000 0.0010 ------C 812.223634 0 0.0000 2931
Out..
lnL = -812.223634
2932 lfun, 11728 eigenQcodon, 131940 P(t)
Time used: 1:21
Model 7: beta
TREE # 1
(1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
0.047644 0.013796 0.010633 0.013675 0.034188 0.070808 0.028952 0.071287 0.116128 0.079830 0.157428 0.260076 0.062240 0.075691 0.071203 2.069186 0.646685 1.067456
ntime & nrate & np: 15 1 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.333883
np = 18
lnL0 = -895.405493
Iterating by ming2
Initial: fx= 895.405493
x= 0.04764 0.01380 0.01063 0.01368 0.03419 0.07081 0.02895 0.07129 0.11613 0.07983 0.15743 0.26008 0.06224 0.07569 0.07120 2.06919 0.64668 1.06746
1 h-m-p 0.0000 0.0019 184.0385 +++YCCC 888.706298 3 0.0010 49 | 0/18
2 h-m-p 0.0002 0.0011 156.5222 +YCYYCYCYC 876.870425 8 0.0010 101 | 0/18
3 h-m-p 0.0001 0.0003 2076.4151 +YYYCCCC 850.397823 6 0.0002 150 | 0/18
4 h-m-p 0.0001 0.0006 205.9961 +YCCCC 847.099004 4 0.0003 197 | 0/18
5 h-m-p 0.0011 0.0056 37.5398 +YYYCCC 843.681744 5 0.0041 244 | 0/18
6 h-m-p 0.0002 0.0008 282.5017 +YYYCCC 840.601883 5 0.0006 291 | 0/18
7 h-m-p 0.0003 0.0015 116.5209 +YYYCCC 838.316700 5 0.0011 338 | 0/18
8 h-m-p 0.0001 0.0007 138.8493 YCCCC 837.811428 4 0.0003 384 | 0/18
9 h-m-p 0.0010 0.0071 43.1972 YCCCC 836.718339 4 0.0024 430 | 0/18
10 h-m-p 0.0003 0.0014 139.8158 YCCCC 835.896672 4 0.0006 476 | 0/18
11 h-m-p 0.0011 0.0053 28.3446 YYC 835.726947 2 0.0008 517 | 0/18
12 h-m-p 0.0015 0.0074 13.0760 YCC 835.649993 2 0.0009 559 | 0/18
13 h-m-p 0.0012 0.0208 10.0271 +YCC 835.410782 2 0.0032 602 | 0/18
14 h-m-p 0.0024 0.0239 13.0869 +YYCCC 834.032457 4 0.0082 648 | 0/18
15 h-m-p 0.0053 0.0263 13.3411 +YYYCYCCCC 824.651120 8 0.0218 700 | 0/18
16 h-m-p 0.0010 0.0049 24.5675 YCCCCC 824.066983 5 0.0020 748 | 0/18
17 h-m-p 0.0126 0.0885 3.9728 CYC 823.824532 2 0.0117 790 | 0/18
18 h-m-p 0.0066 0.0547 7.0251 CCCC 823.110911 3 0.0105 835 | 0/18
19 h-m-p 0.0032 0.0162 14.6739 YYYC 822.667955 3 0.0030 877 | 0/18
20 h-m-p 0.1146 1.3993 0.3903 +CYCCCC 817.164448 5 0.6707 926 | 0/18
21 h-m-p 0.0363 0.1813 0.9262 +YYCCCC 815.147420 5 0.1164 974 | 0/18
22 h-m-p 0.0614 0.3068 0.4298 YCYCCC 814.084364 5 0.1396 1021 | 0/18
23 h-m-p 0.3217 3.5043 0.1865 +YCCC 812.973367 3 0.9563 1066 | 0/18
24 h-m-p 0.3899 1.9493 0.1554 CCCCC 812.768189 4 0.4547 1113 | 0/18
25 h-m-p 0.6020 3.7323 0.1174 CCCC 812.611730 3 0.7148 1158 | 0/18
26 h-m-p 0.2899 4.8493 0.2894 CCC 812.570077 2 0.3470 1201 | 0/18
27 h-m-p 1.6000 8.0000 0.0368 CCC 812.534348 2 1.3563 1244 | 0/18
28 h-m-p 1.0855 8.0000 0.0459 CC 812.480317 1 1.3136 1285 | 0/18
29 h-m-p 1.6000 8.0000 0.0221 YCC 812.397450 2 1.2092 1327 | 0/18
30 h-m-p 1.6000 8.0000 0.0153 CCC 812.342716 2 1.3369 1370 | 0/18
31 h-m-p 1.2356 8.0000 0.0165 CC 812.322336 1 1.1583 1411 | 0/18
32 h-m-p 1.1669 8.0000 0.0164 CC 812.310874 1 1.4395 1452 | 0/18
33 h-m-p 1.6000 8.0000 0.0057 YC 812.309623 1 1.2046 1492 | 0/18
34 h-m-p 1.6000 8.0000 0.0008 C 812.309526 0 1.4312 1531 | 0/18
35 h-m-p 1.6000 8.0000 0.0003 C 812.309510 0 1.5830 1570 | 0/18
36 h-m-p 1.6000 8.0000 0.0003 C 812.309507 0 1.8737 1609 | 0/18
37 h-m-p 1.5420 8.0000 0.0004 +Y 812.309500 0 5.2308 1649 | 0/18
38 h-m-p 1.4128 8.0000 0.0014 ++ 812.309455 m 8.0000 1688 | 0/18
39 h-m-p 0.4326 8.0000 0.0254 +YC 812.309302 1 2.8208 1729 | 0/18
40 h-m-p 1.6000 8.0000 0.0308 ++ 812.308254 m 8.0000 1768 | 0/18
41 h-m-p 0.5020 8.0000 0.4905 +C 812.306054 0 2.0082 1808 | 0/18
42 h-m-p 1.6000 8.0000 0.3746 ++ 812.296096 m 8.0000 1847 | 0/18
43 h-m-p 1.6000 8.0000 0.3720 CC 812.292217 1 2.4777 1888 | 0/18
44 h-m-p 1.6000 8.0000 0.4683 ++ 812.276855 m 8.0000 1927 | 0/18
45 h-m-p 1.6000 8.0000 2.0360 CC 812.266082 1 2.1753 1968 | 0/18
46 h-m-p 1.6000 8.0000 2.5790 YC 812.255788 1 3.7912 2008 | 0/18
47 h-m-p 1.6000 8.0000 3.9863 YCC 812.248097 2 2.7542 2050 | 0/18
48 h-m-p 1.6000 8.0000 5.5535 +YC 812.241379 1 4.2854 2091 | 0/18
49 h-m-p 0.8885 4.4425 8.7333 +YC 812.237301 1 2.6840 2132 | 0/18
50 h-m-p 0.2512 1.2559 12.2277 ++ 812.235485 m 1.2559 2171 | 1/18
51 h-m-p 0.1820 8.0000 0.4829 ---------------.. | 1/18
52 h-m-p 0.0007 0.3638 0.4355 C 812.235402 0 0.0009 2261 | 1/18
53 h-m-p 0.0003 0.0331 1.2037 YC 812.235361 1 0.0002 2300 | 1/18
54 h-m-p 0.0007 0.3705 0.5409 C 812.235302 0 0.0008 2338 | 1/18
55 h-m-p 0.0006 0.1680 0.6975 C 812.235232 0 0.0009 2376 | 1/18
56 h-m-p 0.0002 0.0425 3.2320 YC 812.235115 1 0.0003 2415 | 1/18
57 h-m-p 0.0004 0.1990 3.0253 +YC 812.234712 1 0.0013 2455 | 1/18
58 h-m-p 0.0004 0.0470 9.6909 YC 812.234038 1 0.0007 2494 | 1/18
59 h-m-p 0.0013 0.0986 5.0826 CC 812.233473 1 0.0011 2534 | 1/18
60 h-m-p 0.0017 0.1802 3.2905 YC 812.233252 1 0.0007 2573 | 1/18
61 h-m-p 0.0022 0.4764 1.0816 YC 812.233128 1 0.0013 2612 | 1/18
62 h-m-p 0.0031 0.7383 0.4606 YC 812.233073 1 0.0016 2651 | 1/18
63 h-m-p 0.0026 0.9595 0.2865 YC 812.233050 1 0.0014 2690 | 1/18
64 h-m-p 0.0085 4.2269 0.1002 C 812.233043 0 0.0020 2728 | 1/18
65 h-m-p 0.0154 7.7144 0.0295 Y 812.233042 0 0.0026 2766 | 1/18
66 h-m-p 0.0160 8.0000 0.0134 Y 812.233042 0 0.0025 2804 | 1/18
67 h-m-p 0.0160 8.0000 0.0135 +Y 812.233039 0 0.0473 2843 | 1/18
68 h-m-p 0.0121 6.0297 0.3441 C 812.233035 0 0.0033 2881 | 1/18
69 h-m-p 1.6000 8.0000 0.0002 Y 812.233035 0 0.9567 2919 | 1/18
70 h-m-p 1.6000 8.0000 0.0000 Y 812.233035 0 1.0786 2957 | 1/18
71 h-m-p 1.6000 8.0000 0.0000 Y 812.233035 0 0.4000 2995
Out..
lnL = -812.233035
2996 lfun, 32956 eigenQcodon, 449400 P(t)
Time used: 3:19
Model 8: beta&w>1
TREE # 1
(1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
initial w for M8:NSbetaw>1 reset.
0.047644 0.013796 0.010633 0.013675 0.034188 0.070808 0.028952 0.071287 0.116128 0.079830 0.157428 0.260076 0.062240 0.075691 0.071203 2.070340 0.900000 0.424862 1.004508 2.363541
ntime & nrate & np: 15 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.845287
np = 20
lnL0 = -898.356290
Iterating by ming2
Initial: fx= 898.356290
x= 0.04764 0.01380 0.01063 0.01368 0.03419 0.07081 0.02895 0.07129 0.11613 0.07983 0.15743 0.26008 0.06224 0.07569 0.07120 2.07034 0.90000 0.42486 1.00451 2.36354
1 h-m-p 0.0000 0.0005 311.0825 +++ 869.344880 m 0.0005 46 | 1/20
2 h-m-p 0.0002 0.0010 192.6800 +CYCCCCC 847.844276 6 0.0010 102 | 1/20
3 h-m-p 0.0000 0.0000 4211.1787 +YCYYYCCCCC 839.784220 9 0.0000 159 | 1/20
4 h-m-p 0.0000 0.0000 86872.7435 +YYYCC 829.499027 4 0.0000 207 | 1/20
5 h-m-p 0.0003 0.0016 47.4166 CYCCC 829.299896 4 0.0002 256 | 0/20
6 h-m-p 0.0000 0.0017 327.2233 +CYCCC 825.387679 4 0.0001 306 | 0/20
7 h-m-p 0.0007 0.0056 48.9342 CYCC 824.871585 3 0.0010 354 | 0/20
8 h-m-p 0.0016 0.0081 30.0053 CCCC 824.423768 3 0.0017 403 | 0/20
9 h-m-p 0.0030 0.0201 16.8035 CCCC 824.042724 3 0.0035 452 | 0/20
10 h-m-p 0.0023 0.0174 25.8472 YCCC 823.409133 3 0.0041 500 | 0/20
11 h-m-p 0.0037 0.0230 28.5599 YCC 822.970985 2 0.0028 546 | 0/20
12 h-m-p 0.0027 0.0135 21.2324 CCCC 822.588717 3 0.0034 595 | 0/20
13 h-m-p 0.0031 0.0157 20.0909 CCCCC 822.152768 4 0.0041 646 | 0/20
14 h-m-p 0.0038 0.0191 11.5646 YYCC 822.002699 3 0.0028 693 | 0/20
15 h-m-p 0.0031 0.0273 10.3741 YYC 821.891901 2 0.0025 738 | 0/20
16 h-m-p 0.0049 0.0462 5.3370 CCCC 821.702875 3 0.0087 787 | 0/20
17 h-m-p 0.0042 0.0309 11.0882 CCCCC 821.509506 4 0.0052 838 | 0/20
18 h-m-p 0.0102 0.0534 5.6255 CC 821.467149 1 0.0036 883 | 0/20
19 h-m-p 0.0104 0.2006 1.9296 +YYC 821.324777 2 0.0334 929 | 0/20
20 h-m-p 0.0022 0.0402 28.9734 +++ 816.963039 m 0.0402 973 | 0/20
21 h-m-p -0.0000 -0.0000 28.8480
h-m-p: -0.00000000e+00 -0.00000000e+00 2.88480410e+01 816.963039
.. | 0/20
22 h-m-p 0.0000 0.0006 517.3697 +YYCCCC 815.528824 5 0.0000 1065 | 0/20
23 h-m-p 0.0002 0.0009 75.5164 YCCC 814.430845 3 0.0004 1113 | 0/20
24 h-m-p 0.0000 0.0001 200.8734 +CC 813.857156 1 0.0001 1159 | 0/20
25 h-m-p 0.0000 0.0000 156.7300 ++ 813.650869 m 0.0000 1202 | 1/20
26 h-m-p 0.0001 0.0016 36.9429 +YYCCCCC 813.390438 6 0.0005 1256 | 1/20
27 h-m-p 0.0002 0.0024 89.9784 CC 813.110029 1 0.0002 1300 | 1/20
28 h-m-p 0.0012 0.0094 17.2760 YCC 812.937911 2 0.0010 1345 | 1/20
29 h-m-p 0.0016 0.0171 10.6680 YC 812.886662 1 0.0011 1388 | 1/20
30 h-m-p 0.0010 0.0124 10.9355 CCC 812.838615 2 0.0015 1434 | 1/20
31 h-m-p 0.0011 0.0198 14.8110 CCC 812.806663 2 0.0009 1480 | 1/20
32 h-m-p 0.0037 0.0509 3.6344 CC 812.800870 1 0.0011 1524 | 1/20
33 h-m-p 0.0019 0.1012 2.2477 CC 812.795981 1 0.0023 1568 | 1/20
34 h-m-p 0.0016 0.2057 3.3226 +CC 812.774608 1 0.0076 1613 | 1/20
35 h-m-p 0.0014 0.1060 17.3765 ++YYCC 812.496482 3 0.0181 1661 | 1/20
36 h-m-p 0.0056 0.0278 27.2828 CCC 812.459683 2 0.0017 1707 | 1/20
37 h-m-p 0.0116 0.0581 3.5507 CY 812.452755 1 0.0026 1751 | 1/20
38 h-m-p 0.0266 0.6462 0.3536 C 812.451250 0 0.0066 1793 | 1/20
39 h-m-p 0.0020 0.3348 1.1779 +++YCCC 812.369366 3 0.0816 1843 | 1/20
40 h-m-p 0.0088 0.0441 6.6406 YC 812.363056 1 0.0013 1886 | 1/20
41 h-m-p 0.3392 8.0000 0.0251 +CCC 812.332113 2 1.1317 1933 | 1/20
42 h-m-p 1.5804 8.0000 0.0180 C 812.318857 0 1.5804 1975 | 1/20
43 h-m-p 1.6000 8.0000 0.0157 CC 812.315127 1 1.7374 2019 | 1/20
44 h-m-p 1.6000 8.0000 0.0095 C 812.313662 0 1.5428 2061 | 1/20
45 h-m-p 1.6000 8.0000 0.0018 YC 812.313352 1 1.1451 2104 | 1/20
46 h-m-p 0.5371 8.0000 0.0039 +C 812.313311 0 3.0980 2147 | 1/20
47 h-m-p 0.9217 8.0000 0.0130 ++ 812.312870 m 8.0000 2189 | 1/20
48 h-m-p 0.0204 0.2118 5.0894 ++ 812.310490 m 0.2118 2231 | 2/20
49 h-m-p 1.6000 8.0000 0.0710 ++ 812.305074 m 8.0000 2273 | 2/20
50 h-m-p 0.3275 8.0000 1.7335 +YYC 812.297881 2 1.8855 2317 | 2/20
51 h-m-p 1.6000 8.0000 0.4193 YC 812.287966 1 3.7123 2359 | 2/20
52 h-m-p 1.5251 8.0000 1.0206 YC 812.274934 1 3.5518 2401 | 2/20
53 h-m-p 1.6000 8.0000 1.8301 +YC 812.262317 1 4.2850 2444 | 2/20
54 h-m-p 1.6000 8.0000 3.0071 YCC 812.253366 2 2.9642 2488 | 2/20
55 h-m-p 1.6000 8.0000 4.4939 YC 812.245559 1 3.8735 2530 | 2/20
56 h-m-p 1.5186 7.5928 6.9825 YCC 812.240533 2 2.7635 2574 | 2/20
57 h-m-p 0.6692 3.3459 10.0783 ++ 812.236426 m 3.3459 2615 | 3/20
58 h-m-p 0.7444 8.0000 0.2593 ----------------.. | 3/20
59 h-m-p 0.0000 0.0174 2.2359 +YC 812.236152 1 0.0001 2712 | 3/20
60 h-m-p 0.0004 0.0821 0.5804 C 812.236060 0 0.0006 2752 | 3/20
61 h-m-p 0.0004 0.2232 0.8874 CC 812.235942 1 0.0007 2794 | 3/20
62 h-m-p 0.0007 0.1446 0.7876 YC 812.235900 1 0.0003 2835 | 3/20
63 h-m-p 0.0003 0.0486 1.0328 C 812.235865 0 0.0002 2875 | 3/20
64 h-m-p 0.0025 1.2331 0.5159 C 812.235700 0 0.0031 2915 | 3/20
65 h-m-p 0.0007 0.1936 2.1673 YC 812.235321 1 0.0018 2956 | 3/20
66 h-m-p 0.0009 0.1302 4.1457 CC 812.234860 1 0.0011 2998 | 3/20
67 h-m-p 0.0014 0.1710 3.4839 C 812.234446 0 0.0013 3038 | 3/20
68 h-m-p 0.0033 0.4441 1.3520 C 812.234077 0 0.0031 3078 | 3/20
69 h-m-p 0.0020 0.2810 2.0652 YC 812.233807 1 0.0016 3119 | 3/20
70 h-m-p 0.0079 0.7471 0.4041 -Y 812.233780 0 0.0010 3160 | 3/20
71 h-m-p 0.0044 1.5106 0.0903 Y 812.233774 0 0.0018 3200 | 3/20
72 h-m-p 0.0128 6.3796 0.0368 Y 812.233773 0 0.0025 3240 | 3/20
73 h-m-p 0.0160 8.0000 0.0180 Y 812.233772 0 0.0089 3280 | 3/20
74 h-m-p 0.0160 8.0000 0.1055 C 812.233754 0 0.0255 3320 | 3/20
75 h-m-p 0.0108 4.0239 0.2479 Y 812.233752 0 0.0014 3360 | 3/20
76 h-m-p 1.6000 8.0000 0.0002 Y 812.233751 0 0.9678 3400 | 3/20
77 h-m-p 1.6000 8.0000 0.0000 Y 812.233751 0 1.2550 3440 | 3/20
78 h-m-p 1.6000 8.0000 0.0000 C 812.233751 0 0.4000 3480
Out..
lnL = -812.233751
3481 lfun, 41772 eigenQcodon, 574365 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -850.680653 S = -827.531956 -16.571782
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 80 patterns 5:50
did 20 / 80 patterns 5:50
did 30 / 80 patterns 5:51
did 40 / 80 patterns 5:51
did 50 / 80 patterns 5:51
did 60 / 80 patterns 5:51
did 70 / 80 patterns 5:51
did 80 / 80 patterns 5:52
Time used: 5:52
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=107
D_melanogaster_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
D_sechellia_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
D_simulans_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
D_yakuba_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
D_erecta_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
D_takahashii_CG42404-PF MYLLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
D_biarmipes_CG42404-PF MYFLALLAFIGNAKDGSAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
D_eugracilis_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC
D_ficusphila_CG42404-PF MYFLALLAFIGNAKDGNAVSSSMIPGGSCRDYNGKMYETGMHYMPGPDSC
D_rhopaloa_CG42404-PF MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC
D_elegans_CG42404-PF MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC
**:*************.*****: *************************
D_melanogaster_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_sechellia_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_simulans_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_yakuba_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_erecta_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_takahashii_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_biarmipes_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_eugracilis_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_ficusphila_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_rhopaloa_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
D_elegans_CG42404-PF RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS
**************************************************
D_melanogaster_CG42404-PF TDFGI--
D_sechellia_CG42404-PF TDFGI--
D_simulans_CG42404-PF TDFGI--
D_yakuba_CG42404-PF TDFGI--
D_erecta_CG42404-PF TDFGI--
D_takahashii_CG42404-PF TDFGI--
D_biarmipes_CG42404-PF TDFGI--
D_eugracilis_CG42404-PF TDFGI--
D_ficusphila_CG42404-PF TDFGI--
D_rhopaloa_CG42404-PF TDFGIoo
D_elegans_CG42404-PF TDFGIoo
*****
>D_melanogaster_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA CGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG GAAAGATGTACGAGACTGGCATGCACTATATGCCGGGACCCGACTCATGC CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCTTGCAAGATGGTGCT CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA ACAACTGCTGCGAGGTGATCTGCCTGGATGACCAGTTCAGCGATGGGAGC ACCGACTTCGGCATT------ >D_sechellia_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG GCAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCATGC CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCCTGCAAGATGGTGCT CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC ACCGACTTCGGCATT------ >D_simulans_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGATTACAATG GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCGTGC CGCCTCTGCATCTGCGACAGCGGACTGCCCAAGGCCTGCAAGATGGTGCT CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC ACCGACTTCGGCATT------ >D_yakuba_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGACTACAATG GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCCGACTCATGC CGCCTGTGCATCTGCGACAGCGGACTGCCCAAGGCGTGCAAGATGGTGCT CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGAAGC ACCGACTTCGGCATT------ >D_erecta_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA TGCGGTGAGCTCGAGCCTGATCCCCGGCGGCTCCTGCCGCGACTACAATG GAAAGATGTACGAGACTGGCATGCACTATATGCCAGGACCGGACTCATGT CGCCTGTGCATCTGCGACAGCGGACTGCCCAAGGCGTGCAAGATGGTGCT GTGCGAGGCGTTTAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGTGGCA ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAATTCAGCGATGGGAGC ACCGACTTCGGCATT------ >D_takahashii_CG42404-PF ATGTATCTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA TGCGGTGAGCTCGAGCCTGATCCCCGGCGGGTCCTGCCGCGACTACAATG GGAAGATGTACGAGACGGGCATGCACTACATGCCCGGTCCCGACTCCTGC CGCCTGTGCATCTGCGACAGCGGGCTGCCCAAGGCGTGCAAGATGGTGCT CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC ACCGACTTTGGCATT------ >D_biarmipes_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGGAG CGCGGTGAGCTCGAGCCTTATCCCCGGCGGCTCCTGCCGCGACTACAATG GAAAGATGTACGAGACGGGCATGCACTACATGCCGGGGCCCGACTCCTGT CGCCTGTGCATCTGCGACAGCGGGCTGCCCAAGGCGTGCAAGATGGTGCT GTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA ACAACTGCTGCGAGGTCATCTGCCTGGACGACCAGTTCAGCGATGGGAGC ACCGACTTCGGCATT------ >D_eugracilis_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA TGCGGTGAGCTCGAGCCTGATCCCTGGCGGCTCCTGCCGGGACTACAATG GGAAGATGTACGAGACGGGCATGCATTATATGCCAGGACCGGACTCCTGC CGCCTGTGCATCTGCGATAGCGGATTGCCAAAGGCATGCAAGATGGTCCT CTGTGAGGCGTTTAGCAAGTGCAAGTCCTTCCAGACAGTGGGCAGCGGGA ACAACTGTTGCGAGGTAATCTGCCTGGACGACCAATTCAGCGATGGGAGC ACTGACTTTGGCATT------ >D_ficusphila_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA CGCGGTGAGCTCAAGCATGATCCCAGGTGGGTCTTGCCGGGATTACAATG GGAAAATGTACGAGACGGGAATGCACTATATGCCAGGTCCCGACTCTTGC CGCCTCTGCATCTGCGACAGCGGGTTGCCCAAGGCCTGCAAGATGGTACT CTGTGAGGCGTTTAGCAAATGCAAGTCCTTCCAAACCGTTGGTAGTGGCA ACAACTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGATGGGAGC ACTGACTTTGGCATT------ >D_rhopaloa_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTTATTGGAAATGCCAAAGATGGAAA CGCGGTGAGCTCGAGCCTC------GGAGGCTCCTGCCGCGACTATAATG GGAAGATGTACGAGACGGGCATGCACTATATGCCAGGACCCGACTCCTGC CGCCTCTGCATCTGCGACAGCGGGCTGCCCAAGGCCTGCAAAATGGTGCT CTGCGAGGCTTTCAGCAAGTGCAAGTCCTTTCAGACGGTGGGCAGCGGCA ACAATTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC ACCGACTTTGGCATT------ >D_elegans_CG42404-PF ATGTATTTTTTGGCATTGCTTGCGTTCATTGGAAATGCCAAAGATGGAAA CGCTGTGAGCTCGAGCCTC------GGAGGCTCCTGCCGCGACTATAATG GAAAAATGTACGAGACGGGCATGCACTACATGCCAGGACCTGACTCCTGC CGCCTGTGCATCTGCGACAGTGGACTGCCCAAGGCCTGCAAGATGGTGCT CTGCGAGGCGTTCAGCAAGTGCAAGTCCTTCCAGACGGTGGGCAGCGGCA ACAATTGCTGCGAGGTGATCTGCCTGGACGACCAGTTCAGCGACGGGAGC ACCGACTTCGGCATT------
>D_melanogaster_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_sechellia_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_simulans_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_yakuba_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_erecta_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_takahashii_CG42404-PF MYLLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_biarmipes_CG42404-PF MYFLALLAFIGNAKDGSAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_eugracilis_CG42404-PF MYFLALLAFIGNAKDGNAVSSSLIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_ficusphila_CG42404-PF MYFLALLAFIGNAKDGNAVSSSMIPGGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_rhopaloa_CG42404-PF MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI >D_elegans_CG42404-PF MYFLALLAFIGNAKDGNAVSSSL--GGSCRDYNGKMYETGMHYMPGPDSC RLCICDSGLPKACKMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGS TDFGI
#NEXUS
[ID: 1657674682]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_CG42404-PF
D_sechellia_CG42404-PF
D_simulans_CG42404-PF
D_yakuba_CG42404-PF
D_erecta_CG42404-PF
D_takahashii_CG42404-PF
D_biarmipes_CG42404-PF
D_eugracilis_CG42404-PF
D_ficusphila_CG42404-PF
D_rhopaloa_CG42404-PF
D_elegans_CG42404-PF
;
end;
begin trees;
translate
1 D_melanogaster_CG42404-PF,
2 D_sechellia_CG42404-PF,
3 D_simulans_CG42404-PF,
4 D_yakuba_CG42404-PF,
5 D_erecta_CG42404-PF,
6 D_takahashii_CG42404-PF,
7 D_biarmipes_CG42404-PF,
8 D_eugracilis_CG42404-PF,
9 D_ficusphila_CG42404-PF,
10 D_rhopaloa_CG42404-PF,
11 D_elegans_CG42404-PF
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.04032466,2:0.01294264,3:0.0120609,(4:0.01788075,5:0.05360646,(6:0.06236863,7:0.09842501,(8:0.171556,9:0.3201452)0.514:0.08975464,(10:0.07960698,11:0.05271308)0.994:0.07104299)0.796:0.03445143)0.896:0.02827459);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.04032466,2:0.01294264,3:0.0120609,(4:0.01788075,5:0.05360646,(6:0.06236863,7:0.09842501,(8:0.171556,9:0.3201452):0.08975464,(10:0.07960698,11:0.05271308):0.07104299):0.03445143):0.02827459);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.05 -920.58
2 -902.42 -917.98
--------------------------------------
TOTAL -902.22 -919.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/143/CG42404-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.268821 0.052009 0.853714 1.730708 1.249277 1252.22 1376.61 1.001
r(A<->C){all} 0.062076 0.000805 0.013374 0.117128 0.058357 648.52 766.71 1.000
r(A<->G){all} 0.309898 0.006325 0.167056 0.473700 0.302486 649.60 699.33 1.001
r(A<->T){all} 0.048614 0.001635 0.000004 0.126531 0.038888 635.20 667.13 1.002
r(C<->G){all} 0.060836 0.000568 0.019268 0.107490 0.058402 972.84 1016.37 1.000
r(C<->T){all} 0.447272 0.007439 0.277694 0.605797 0.446625 468.21 533.35 1.000
r(G<->T){all} 0.071304 0.001282 0.009186 0.140505 0.065774 547.54 575.34 1.000
pi(A){all} 0.199817 0.000429 0.158778 0.240747 0.199497 1100.68 1107.35 1.000
pi(C){all} 0.293292 0.000574 0.245764 0.338201 0.293025 1204.01 1210.33 1.000
pi(G){all} 0.303565 0.000591 0.257447 0.349787 0.303071 989.78 1044.92 1.000
pi(T){all} 0.203325 0.000464 0.162366 0.247852 0.203335 935.18 979.95 1.000
alpha{1,2} 0.076717 0.000451 0.027168 0.120270 0.077426 1017.23 1104.00 1.001
alpha{3} 2.168964 0.613283 0.930709 3.843801 2.042884 1244.39 1275.74 1.001
pinvar{all} 0.513680 0.003394 0.399276 0.624896 0.517660 1183.53 1205.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/143/CG42404-PF/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 103
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 1 1 2 2 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 1 | Cys TGT 0 0 0 0 1 0
TTC 4 5 5 4 4 4 | TCC 2 2 2 2 2 3 | TAC 2 2 2 2 2 3 | TGC 10 10 10 10 9 10
Leu TTA 0 0 0 0 0 0 | TCA 1 1 0 1 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 2 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 2 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 2 2 2 1 0 1 | CCC 2 2 2 2 1 3 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 0 1 1 1 1 0 | Gln CAA 0 0 0 0 1 0 | CGA 0 0 0 0 0 0
CTG 3 3 3 4 5 4 | CCG 1 0 0 0 1 0 | CAG 2 2 2 2 1 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 0 | Asn AAT 2 3 3 3 3 3 | Ser AGT 0 0 0 0 1 0
ATC 2 2 2 2 2 2 | ACC 1 1 1 1 1 1 | AAC 3 2 2 2 2 2 | AGC 7 7 7 7 6 7
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 1 1 1 1 1 2 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 0 0 0 0 0 | Asp GAT 4 3 3 2 2 1 | Gly GGT 0 0 0 0 0 1
GTC 0 0 0 0 0 0 | GCC 1 2 2 1 1 1 | GAC 4 5 5 6 6 7 | GGC 6 7 6 6 6 5
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 5 4 5 6 5 2
GTG 4 4 4 4 4 4 | GCG 3 3 3 4 4 4 | GAG 3 3 3 3 3 3 | GGG 1 1 1 0 1 4
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 1 3 3 4 1 | Ser TCT 0 0 2 0 0 | Tyr TAT 1 2 2 3 2 | Cys TGT 1 2 1 0 0
TTC 5 3 3 2 5 | TCC 3 3 1 3 3 | TAC 3 2 2 1 2 | TGC 9 8 9 10 10
Leu TTA 0 0 0 0 0 | TCA 0 0 1 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 3 3 2 2 | TCG 1 1 0 1 1 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 1 1 1 1 | Pro CCT 0 0 0 0 1 | His CAT 0 1 0 0 0 | Arg CGT 0 0 0 0 0
CTC 0 1 2 3 2 | CCC 2 0 2 2 1 | CAC 1 0 1 1 1 | CGC 2 1 1 2 2
CTA 0 0 0 0 0 | CCA 0 2 1 1 1 | Gln CAA 0 1 1 0 0 | CGA 0 0 0 0 0
CTG 4 3 1 2 3 | CCG 1 1 0 0 0 | CAG 2 1 1 2 2 | CGG 0 1 1 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 | Thr ACT 0 1 1 0 0 | Asn AAT 2 3 2 3 3 | Ser AGT 0 0 1 0 1
ATC 2 2 2 2 2 | ACC 1 0 1 1 1 | AAC 2 2 3 2 2 | AGC 8 7 6 7 6
ATA 0 0 0 0 0 | ACA 0 1 0 0 0 | Lys AAA 1 1 3 2 2 | Arg AGA 0 0 0 0 0
Met ATG 5 5 6 5 5 | ACG 2 1 1 2 2 | AAG 5 5 3 4 4 | AGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 1 0 0 | Ala GCT 0 0 0 1 1 | Asp GAT 2 3 3 1 1 | Gly GGT 0 0 3 0 0
GTC 1 1 0 0 0 | GCC 1 1 2 2 2 | GAC 6 5 5 7 7 | GGC 6 5 2 5 5
GTA 0 1 1 0 0 | GCA 1 2 1 1 1 | Glu GAA 0 0 0 0 0 | GGA 2 4 3 4 6
GTG 3 2 2 4 4 | GCG 4 3 3 2 2 | GAG 3 3 3 3 3 | GGG 4 3 4 3 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG42404-PF
position 1: T:0.25243 C:0.13592 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.14563 C:0.47573 A:0.07767 G:0.30097
Average T:0.22006 C:0.25566 A:0.21683 G:0.30744
#2: D_sechellia_CG42404-PF
position 1: T:0.25243 C:0.13592 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.12621 C:0.50485 A:0.07767 G:0.29126
Average T:0.21359 C:0.26537 A:0.21683 G:0.30421
#3: D_simulans_CG42404-PF
position 1: T:0.25243 C:0.13592 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.12621 C:0.49515 A:0.07767 G:0.30097
Average T:0.21359 C:0.26214 A:0.21683 G:0.30744
#4: D_yakuba_CG42404-PF
position 1: T:0.25243 C:0.13592 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.12621 C:0.47573 A:0.09709 G:0.30097
Average T:0.21359 C:0.25566 A:0.22330 G:0.30744
#5: D_erecta_CG42404-PF
position 1: T:0.25243 C:0.13592 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.14563 C:0.43689 A:0.09709 G:0.32039
Average T:0.22006 C:0.24272 A:0.22330 G:0.31392
#6: D_takahashii_CG42404-PF
position 1: T:0.24272 C:0.14563 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.10680 C:0.50485 A:0.03883 G:0.34951
Average T:0.20388 C:0.26861 A:0.20388 G:0.32362
#7: D_biarmipes_CG42404-PF
position 1: T:0.25243 C:0.13592 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.27184 G:0.31068
position 3: T:0.10680 C:0.50485 A:0.03883 G:0.34951
Average T:0.20712 C:0.26537 A:0.20065 G:0.32686
#8: D_eugracilis_CG42404-PF
position 1: T:0.26214 C:0.12621 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.17476 C:0.39806 A:0.11650 G:0.31068
Average T:0.23301 C:0.22654 A:0.22977 G:0.31068
#9: D_ficusphila_CG42404-PF
position 1: T:0.26214 C:0.11650 A:0.30097 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.21359 C:0.40777 A:0.10680 G:0.27184
Average T:0.24595 C:0.22654 A:0.22977 G:0.29773
#10: D_rhopaloa_CG42404-PF
position 1: T:0.25243 C:0.13592 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.14563 C:0.48544 A:0.07767 G:0.29126
Average T:0.22006 C:0.25890 A:0.21683 G:0.30421
#11: D_elegans_CG42404-PF
position 1: T:0.25243 C:0.13592 A:0.29126 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28155 G:0.30097
position 3: T:0.12621 C:0.49515 A:0.09709 G:0.28155
Average T:0.21359 C:0.26214 A:0.22330 G:0.30097
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 21 | Ser S TCT 2 | Tyr Y TAT 21 | Cys C TGT 5
TTC 44 | TCC 26 | TAC 23 | TGC 105
Leu L TTA 0 | TCA 5 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 11 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 13 | Pro P CCT 1 | His H CAT 1 | Arg R CGT 0
CTC 16 | CCC 19 | CAC 10 | CGC 20
CTA 0 | CCA 9 | Gln Q CAA 3 | CGA 0
CTG 35 | CCG 4 | CAG 19 | CGG 2
------------------------------------------------------------------------------
Ile I ATT 22 | Thr T ACT 7 | Asn N AAT 30 | Ser S AGT 3
ATC 22 | ACC 10 | AAC 24 | AGC 75
ATA 0 | ACA 1 | Lys K AAA 15 | Arg R AGA 0
Met M ATG 56 | ACG 15 | AAG 51 | AGG 0
------------------------------------------------------------------------------
Val V GTT 1 | Ala A GCT 3 | Asp D GAT 25 | Gly G GGT 4
GTC 2 | GCC 16 | GAC 63 | GGC 59
GTA 2 | GCA 12 | Glu E GAA 0 | GGA 46
GTG 39 | GCG 35 | GAG 33 | GGG 23
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.25331 C:0.13416 A:0.29214 G:0.32039
position 2: T:0.26214 C:0.15534 A:0.28067 G:0.30185
position 3: T:0.14034 C:0.47132 A:0.08208 G:0.30627
Average T:0.21859 C:0.25360 A:0.21830 G:0.30950
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG42404-PF
D_sechellia_CG42404-PF -1.0000 (0.0000 0.0984)
D_simulans_CG42404-PF -1.0000 (0.0000 0.0984)-1.0000 (0.0000 0.0314)
D_yakuba_CG42404-PF -1.0000 (0.0000 0.1157)-1.0000 (0.0000 0.0981)-1.0000 (0.0000 0.0981)
D_erecta_CG42404-PF -1.0000 (0.0000 0.2309)-1.0000 (0.0000 0.1711)-1.0000 (0.0000 0.1711)-1.0000 (0.0000 0.1330)
D_takahashii_CG42404-PF 0.0139 (0.0041 0.2961) 0.0178 (0.0041 0.2311) 0.0178 (0.0041 0.2311) 0.0197 (0.0041 0.2096) 0.0140 (0.0041 0.2942)
D_biarmipes_CG42404-PF 0.0149 (0.0041 0.2755) 0.0138 (0.0041 0.2982) 0.0149 (0.0041 0.2757) 0.0163 (0.0041 0.2526) 0.0163 (0.0041 0.2520) 0.0392 (0.0083 0.2104)
D_eugracilis_CG42404-PF -1.0000 (0.0000 0.5716)-1.0000 (0.0000 0.4505)-1.0000 (0.0000 0.4505)-1.0000 (0.0000 0.4482)-1.0000 (0.0000 0.3933) 0.0092 (0.0041 0.4470) 0.0068 (0.0041 0.6055)
D_ficusphila_CG42404-PF 0.0063 (0.0041 0.6545) 0.0074 (0.0041 0.5506) 0.0074 (0.0041 0.5506) 0.0056 (0.0041 0.7291) 0.0056 (0.0041 0.7264) 0.0151 (0.0082 0.5459) 0.0129 (0.0103 0.7982) 0.0062 (0.0041 0.6557)
D_rhopaloa_CG42404-PF -1.0000 (0.0000 0.3229)-1.0000 (0.0000 0.2998)-1.0000 (0.0000 0.2998)-1.0000 (0.0000 0.3216)-1.0000 (0.0000 0.4773) 0.0149 (0.0041 0.2752) 0.0103 (0.0041 0.3978)-1.0000 (0.0000 0.6451) 0.0091 (0.0061 0.6782)
D_elegans_CG42404-PF -1.0000 (0.0000 0.3454)-1.0000 (0.0000 0.2984)-1.0000 (0.0000 0.2758)-1.0000 (0.0000 0.2970)-1.0000 (0.0000 0.3676) 0.0139 (0.0041 0.2963) 0.0128 (0.0041 0.3215)-1.0000 (0.0000 0.6412) 0.0077 (0.0061 0.7988)-1.0000 (0.0000 0.2337)
Model 0: one-ratio
TREE # 1: (1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
lnL(ntime: 15 np: 17): -812.223634 +0.000000
12..1 12..2 12..3 12..13 13..4 13..5 13..14 14..6 14..7 14..15 15..8 15..9 14..16 16..10 16..11
0.051048 0.010167 0.010030 0.030667 0.019945 0.061191 0.030179 0.093495 0.137037 0.093028 0.111602 0.281674 0.080146 0.083452 0.063246 2.069209 0.005372
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.15691
(1: 0.051048, 2: 0.010167, 3: 0.010030, (4: 0.019945, 5: 0.061191, (6: 0.093495, 7: 0.137037, (8: 0.111602, 9: 0.281674): 0.093028, (10: 0.083452, 11: 0.063246): 0.080146): 0.030179): 0.030667);
(D_melanogaster_CG42404-PF: 0.051048, D_sechellia_CG42404-PF: 0.010167, D_simulans_CG42404-PF: 0.010030, (D_yakuba_CG42404-PF: 0.019945, D_erecta_CG42404-PF: 0.061191, (D_takahashii_CG42404-PF: 0.093495, D_biarmipes_CG42404-PF: 0.137037, (D_eugracilis_CG42404-PF: 0.111602, D_ficusphila_CG42404-PF: 0.281674): 0.093028, (D_rhopaloa_CG42404-PF: 0.083452, D_elegans_CG42404-PF: 0.063246): 0.080146): 0.030179): 0.030667);
Detailed output identifying parameters
kappa (ts/tv) = 2.06921
omega (dN/dS) = 0.00537
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.051 256.2 52.8 0.0054 0.0005 0.0971 0.1 5.1
12..2 0.010 256.2 52.8 0.0054 0.0001 0.0193 0.0 1.0
12..3 0.010 256.2 52.8 0.0054 0.0001 0.0191 0.0 1.0
12..13 0.031 256.2 52.8 0.0054 0.0003 0.0583 0.1 3.1
13..4 0.020 256.2 52.8 0.0054 0.0002 0.0379 0.1 2.0
13..5 0.061 256.2 52.8 0.0054 0.0006 0.1164 0.2 6.1
13..14 0.030 256.2 52.8 0.0054 0.0003 0.0574 0.1 3.0
14..6 0.093 256.2 52.8 0.0054 0.0010 0.1778 0.2 9.4
14..7 0.137 256.2 52.8 0.0054 0.0014 0.2606 0.4 13.8
14..15 0.093 256.2 52.8 0.0054 0.0010 0.1769 0.2 9.3
15..8 0.112 256.2 52.8 0.0054 0.0011 0.2123 0.3 11.2
15..9 0.282 256.2 52.8 0.0054 0.0029 0.5357 0.7 28.3
14..16 0.080 256.2 52.8 0.0054 0.0008 0.1524 0.2 8.0
16..10 0.083 256.2 52.8 0.0054 0.0009 0.1587 0.2 8.4
16..11 0.063 256.2 52.8 0.0054 0.0006 0.1203 0.2 6.3
tree length for dN: 0.0118
tree length for dS: 2.2004
Time used: 0:08
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
lnL(ntime: 15 np: 18): -812.224350 +0.000000
12..1 12..2 12..3 12..13 13..4 13..5 13..14 14..6 14..7 14..15 15..8 15..9 14..16 16..10 16..11
0.051050 0.010168 0.010031 0.030668 0.019946 0.061194 0.030181 0.093499 0.137043 0.093031 0.111607 0.281684 0.080149 0.083455 0.063248 2.069236 0.999990 0.005371
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.15695
(1: 0.051050, 2: 0.010168, 3: 0.010031, (4: 0.019946, 5: 0.061194, (6: 0.093499, 7: 0.137043, (8: 0.111607, 9: 0.281684): 0.093031, (10: 0.083455, 11: 0.063248): 0.080149): 0.030181): 0.030668);
(D_melanogaster_CG42404-PF: 0.051050, D_sechellia_CG42404-PF: 0.010168, D_simulans_CG42404-PF: 0.010031, (D_yakuba_CG42404-PF: 0.019946, D_erecta_CG42404-PF: 0.061194, (D_takahashii_CG42404-PF: 0.093499, D_biarmipes_CG42404-PF: 0.137043, (D_eugracilis_CG42404-PF: 0.111607, D_ficusphila_CG42404-PF: 0.281684): 0.093031, (D_rhopaloa_CG42404-PF: 0.083455, D_elegans_CG42404-PF: 0.063248): 0.080149): 0.030181): 0.030668);
Detailed output identifying parameters
kappa (ts/tv) = 2.06924
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00537 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.051 256.2 52.8 0.0054 0.0005 0.0971 0.1 5.1
12..2 0.010 256.2 52.8 0.0054 0.0001 0.0193 0.0 1.0
12..3 0.010 256.2 52.8 0.0054 0.0001 0.0191 0.0 1.0
12..13 0.031 256.2 52.8 0.0054 0.0003 0.0583 0.1 3.1
13..4 0.020 256.2 52.8 0.0054 0.0002 0.0379 0.1 2.0
13..5 0.061 256.2 52.8 0.0054 0.0006 0.1164 0.2 6.1
13..14 0.030 256.2 52.8 0.0054 0.0003 0.0574 0.1 3.0
14..6 0.093 256.2 52.8 0.0054 0.0010 0.1778 0.2 9.4
14..7 0.137 256.2 52.8 0.0054 0.0014 0.2606 0.4 13.8
14..15 0.093 256.2 52.8 0.0054 0.0010 0.1769 0.2 9.3
15..8 0.112 256.2 52.8 0.0054 0.0011 0.2123 0.3 11.2
15..9 0.282 256.2 52.8 0.0054 0.0029 0.5357 0.7 28.3
14..16 0.080 256.2 52.8 0.0054 0.0008 0.1524 0.2 8.0
16..10 0.083 256.2 52.8 0.0054 0.0009 0.1587 0.2 8.4
16..11 0.063 256.2 52.8 0.0054 0.0006 0.1203 0.2 6.3
Time used: 0:17
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
check convergence..
lnL(ntime: 15 np: 20): -812.223634 +0.000000
12..1 12..2 12..3 12..13 13..4 13..5 13..14 14..6 14..7 14..15 15..8 15..9 14..16 16..10 16..11
0.051048 0.010167 0.010030 0.030667 0.019945 0.061191 0.030179 0.093495 0.137038 0.093028 0.111602 0.281674 0.080146 0.083452 0.063246 2.069208 1.000000 0.000000 0.005371 56.870028
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.15691
(1: 0.051048, 2: 0.010167, 3: 0.010030, (4: 0.019945, 5: 0.061191, (6: 0.093495, 7: 0.137038, (8: 0.111602, 9: 0.281674): 0.093028, (10: 0.083452, 11: 0.063246): 0.080146): 0.030179): 0.030667);
(D_melanogaster_CG42404-PF: 0.051048, D_sechellia_CG42404-PF: 0.010167, D_simulans_CG42404-PF: 0.010030, (D_yakuba_CG42404-PF: 0.019945, D_erecta_CG42404-PF: 0.061191, (D_takahashii_CG42404-PF: 0.093495, D_biarmipes_CG42404-PF: 0.137038, (D_eugracilis_CG42404-PF: 0.111602, D_ficusphila_CG42404-PF: 0.281674): 0.093028, (D_rhopaloa_CG42404-PF: 0.083452, D_elegans_CG42404-PF: 0.063246): 0.080146): 0.030179): 0.030667);
Detailed output identifying parameters
kappa (ts/tv) = 2.06921
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00537 1.00000 56.87003
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.051 256.2 52.8 0.0054 0.0005 0.0971 0.1 5.1
12..2 0.010 256.2 52.8 0.0054 0.0001 0.0193 0.0 1.0
12..3 0.010 256.2 52.8 0.0054 0.0001 0.0191 0.0 1.0
12..13 0.031 256.2 52.8 0.0054 0.0003 0.0583 0.1 3.1
13..4 0.020 256.2 52.8 0.0054 0.0002 0.0379 0.1 2.0
13..5 0.061 256.2 52.8 0.0054 0.0006 0.1164 0.2 6.1
13..14 0.030 256.2 52.8 0.0054 0.0003 0.0574 0.1 3.0
14..6 0.093 256.2 52.8 0.0054 0.0010 0.1778 0.2 9.4
14..7 0.137 256.2 52.8 0.0054 0.0014 0.2606 0.4 13.8
14..15 0.093 256.2 52.8 0.0054 0.0010 0.1769 0.2 9.3
15..8 0.112 256.2 52.8 0.0054 0.0011 0.2123 0.3 11.2
15..9 0.282 256.2 52.8 0.0054 0.0029 0.5357 0.7 28.3
14..16 0.080 256.2 52.8 0.0054 0.0008 0.1524 0.2 8.0
16..10 0.083 256.2 52.8 0.0054 0.0009 0.1587 0.2 8.4
16..11 0.063 256.2 52.8 0.0054 0.0006 0.1203 0.2 6.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42404-PF)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.109 0.101 0.099 0.099 0.099 0.099 0.099 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.999
sum of density on p0-p1 = 1.000000
Time used: 0:46
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
lnL(ntime: 15 np: 21): -812.223634 +0.000000
12..1 12..2 12..3 12..13 13..4 13..5 13..14 14..6 14..7 14..15 15..8 15..9 14..16 16..10 16..11
0.051048 0.010167 0.010030 0.030668 0.019945 0.061191 0.030180 0.093495 0.137038 0.093028 0.111605 0.281679 0.080146 0.083451 0.063246 2.069186 0.019735 0.199517 0.005349 0.005360 0.005375
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.15692
(1: 0.051048, 2: 0.010167, 3: 0.010030, (4: 0.019945, 5: 0.061191, (6: 0.093495, 7: 0.137038, (8: 0.111605, 9: 0.281679): 0.093028, (10: 0.083451, 11: 0.063246): 0.080146): 0.030180): 0.030668);
(D_melanogaster_CG42404-PF: 0.051048, D_sechellia_CG42404-PF: 0.010167, D_simulans_CG42404-PF: 0.010030, (D_yakuba_CG42404-PF: 0.019945, D_erecta_CG42404-PF: 0.061191, (D_takahashii_CG42404-PF: 0.093495, D_biarmipes_CG42404-PF: 0.137038, (D_eugracilis_CG42404-PF: 0.111605, D_ficusphila_CG42404-PF: 0.281679): 0.093028, (D_rhopaloa_CG42404-PF: 0.083451, D_elegans_CG42404-PF: 0.063246): 0.080146): 0.030180): 0.030668);
Detailed output identifying parameters
kappa (ts/tv) = 2.06919
dN/dS (w) for site classes (K=3)
p: 0.01974 0.19952 0.78075
w: 0.00535 0.00536 0.00537
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.051 256.2 52.8 0.0054 0.0005 0.0971 0.1 5.1
12..2 0.010 256.2 52.8 0.0054 0.0001 0.0193 0.0 1.0
12..3 0.010 256.2 52.8 0.0054 0.0001 0.0191 0.0 1.0
12..13 0.031 256.2 52.8 0.0054 0.0003 0.0583 0.1 3.1
13..4 0.020 256.2 52.8 0.0054 0.0002 0.0379 0.1 2.0
13..5 0.061 256.2 52.8 0.0054 0.0006 0.1164 0.2 6.1
13..14 0.030 256.2 52.8 0.0054 0.0003 0.0574 0.1 3.0
14..6 0.093 256.2 52.8 0.0054 0.0010 0.1778 0.2 9.4
14..7 0.137 256.2 52.8 0.0054 0.0014 0.2606 0.4 13.8
14..15 0.093 256.2 52.8 0.0054 0.0010 0.1769 0.2 9.3
15..8 0.112 256.2 52.8 0.0054 0.0011 0.2123 0.3 11.2
15..9 0.282 256.2 52.8 0.0054 0.0029 0.5357 0.7 28.3
14..16 0.080 256.2 52.8 0.0054 0.0008 0.1524 0.2 8.0
16..10 0.083 256.2 52.8 0.0054 0.0009 0.1587 0.2 8.4
16..11 0.063 256.2 52.8 0.0054 0.0006 0.1203 0.2 6.3
Naive Empirical Bayes (NEB) analysis
Time used: 1:21
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
lnL(ntime: 15 np: 18): -812.233035 +0.000000
12..1 12..2 12..3 12..13 13..4 13..5 13..14 14..6 14..7 14..15 15..8 15..9 14..16 16..10 16..11
0.051072 0.010174 0.010037 0.030688 0.019958 0.061232 0.030196 0.093562 0.137107 0.093086 0.111680 0.281738 0.080178 0.083461 0.063254 2.070340 0.577796 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.15742
(1: 0.051072, 2: 0.010174, 3: 0.010037, (4: 0.019958, 5: 0.061232, (6: 0.093562, 7: 0.137107, (8: 0.111680, 9: 0.281738): 0.093086, (10: 0.083461, 11: 0.063254): 0.080178): 0.030196): 0.030688);
(D_melanogaster_CG42404-PF: 0.051072, D_sechellia_CG42404-PF: 0.010174, D_simulans_CG42404-PF: 0.010037, (D_yakuba_CG42404-PF: 0.019958, D_erecta_CG42404-PF: 0.061232, (D_takahashii_CG42404-PF: 0.093562, D_biarmipes_CG42404-PF: 0.137107, (D_eugracilis_CG42404-PF: 0.111680, D_ficusphila_CG42404-PF: 0.281738): 0.093086, (D_rhopaloa_CG42404-PF: 0.083461, D_elegans_CG42404-PF: 0.063254): 0.080178): 0.030196): 0.030688);
Detailed output identifying parameters
kappa (ts/tv) = 2.07034
Parameters in M7 (beta):
p = 0.57780 q = 99.00000
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00005 0.00032 0.00079 0.00147 0.00241 0.00366 0.00539 0.00787 0.01189 0.02111
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.051 256.2 52.8 0.0055 0.0005 0.0971 0.1 5.1
12..2 0.010 256.2 52.8 0.0055 0.0001 0.0193 0.0 1.0
12..3 0.010 256.2 52.8 0.0055 0.0001 0.0191 0.0 1.0
12..13 0.031 256.2 52.8 0.0055 0.0003 0.0583 0.1 3.1
13..4 0.020 256.2 52.8 0.0055 0.0002 0.0379 0.1 2.0
13..5 0.061 256.2 52.8 0.0055 0.0006 0.1164 0.2 6.1
13..14 0.030 256.2 52.8 0.0055 0.0003 0.0574 0.1 3.0
14..6 0.094 256.2 52.8 0.0055 0.0010 0.1778 0.3 9.4
14..7 0.137 256.2 52.8 0.0055 0.0014 0.2606 0.4 13.8
14..15 0.093 256.2 52.8 0.0055 0.0010 0.1769 0.2 9.3
15..8 0.112 256.2 52.8 0.0055 0.0012 0.2123 0.3 11.2
15..9 0.282 256.2 52.8 0.0055 0.0029 0.5355 0.8 28.3
14..16 0.080 256.2 52.8 0.0055 0.0008 0.1524 0.2 8.0
16..10 0.083 256.2 52.8 0.0055 0.0009 0.1586 0.2 8.4
16..11 0.063 256.2 52.8 0.0055 0.0007 0.1202 0.2 6.3
Time used: 3:19
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, (4, 5, (6, 7, (8, 9), (10, 11)))); MP score: 97
lnL(ntime: 15 np: 20): -812.233751 +0.000000
12..1 12..2 12..3 12..13 13..4 13..5 13..14 14..6 14..7 14..15 15..8 15..9 14..16 16..10 16..11
0.051074 0.010174 0.010037 0.030689 0.019959 0.061235 0.030197 0.093566 0.137112 0.093090 0.111684 0.281748 0.080181 0.083464 0.063256 2.070369 0.999990 0.577750 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.15747
(1: 0.051074, 2: 0.010174, 3: 0.010037, (4: 0.019959, 5: 0.061235, (6: 0.093566, 7: 0.137112, (8: 0.111684, 9: 0.281748): 0.093090, (10: 0.083464, 11: 0.063256): 0.080181): 0.030197): 0.030689);
(D_melanogaster_CG42404-PF: 0.051074, D_sechellia_CG42404-PF: 0.010174, D_simulans_CG42404-PF: 0.010037, (D_yakuba_CG42404-PF: 0.019959, D_erecta_CG42404-PF: 0.061235, (D_takahashii_CG42404-PF: 0.093566, D_biarmipes_CG42404-PF: 0.137112, (D_eugracilis_CG42404-PF: 0.111684, D_ficusphila_CG42404-PF: 0.281748): 0.093090, (D_rhopaloa_CG42404-PF: 0.083464, D_elegans_CG42404-PF: 0.063256): 0.080181): 0.030197): 0.030689);
Detailed output identifying parameters
kappa (ts/tv) = 2.07037
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.57775 q = 99.00000
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00005 0.00032 0.00079 0.00147 0.00241 0.00366 0.00539 0.00787 0.01189 0.02111 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.051 256.2 52.8 0.0055 0.0005 0.0971 0.1 5.1
12..2 0.010 256.2 52.8 0.0055 0.0001 0.0193 0.0 1.0
12..3 0.010 256.2 52.8 0.0055 0.0001 0.0191 0.0 1.0
12..13 0.031 256.2 52.8 0.0055 0.0003 0.0583 0.1 3.1
13..4 0.020 256.2 52.8 0.0055 0.0002 0.0379 0.1 2.0
13..5 0.061 256.2 52.8 0.0055 0.0006 0.1164 0.2 6.1
13..14 0.030 256.2 52.8 0.0055 0.0003 0.0574 0.1 3.0
14..6 0.094 256.2 52.8 0.0055 0.0010 0.1778 0.3 9.4
14..7 0.137 256.2 52.8 0.0055 0.0014 0.2606 0.4 13.8
14..15 0.093 256.2 52.8 0.0055 0.0010 0.1769 0.2 9.3
15..8 0.112 256.2 52.8 0.0055 0.0012 0.2123 0.3 11.2
15..9 0.282 256.2 52.8 0.0055 0.0029 0.5355 0.8 28.3
14..16 0.080 256.2 52.8 0.0055 0.0008 0.1524 0.2 8.0
16..10 0.083 256.2 52.8 0.0055 0.0009 0.1586 0.2 8.4
16..11 0.063 256.2 52.8 0.0055 0.0007 0.1202 0.2 6.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG42404-PF)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.003 0.021 0.083 0.254 0.638
ws: 0.113 0.101 0.099 0.098 0.098 0.098 0.098 0.098 0.098 0.098
Time used: 5:52
Model 1: NearlyNeutral -812.22435 Model 2: PositiveSelection -812.223634 Model 0: one-ratio -812.223634 Model 3: discrete -812.223634 Model 7: beta -812.233035 Model 8: beta&w>1 -812.233751 Model 0 vs 1 0.0014320000000225264 Model 2 vs 1 0.0014320000000225264 Model 8 vs 7 0.0014320000000225264
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
