--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 02 10:40:21 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/139/CG40498-PK/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1673.25         -1688.15
2      -1673.33         -1686.30
--------------------------------------
TOTAL    -1673.29         -1687.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.191774    0.000788    0.137623    0.244201    0.189300   1335.03   1340.05    1.000
r(A<->C){all}   0.163841    0.001953    0.083028    0.255560    0.161236    907.24    979.98    1.000
r(A<->G){all}   0.219379    0.002449    0.129117    0.320130    0.214876    671.31    762.40    1.000
r(A<->T){all}   0.141953    0.001348    0.075400    0.217419    0.138754    927.65    956.63    1.000
r(C<->G){all}   0.080053    0.001141    0.021072    0.147203    0.075570    651.97    756.57    1.000
r(C<->T){all}   0.319654    0.003262    0.210049    0.430387    0.316561    629.73    709.99    1.000
r(G<->T){all}   0.075119    0.000797    0.025072    0.130261    0.072479    872.18    951.80    1.000
pi(A){all}      0.303955    0.000242    0.273407    0.333209    0.303565    881.97   1163.91    1.000
pi(C){all}      0.185692    0.000164    0.162076    0.212787    0.185225   1099.70   1300.35    1.000
pi(G){all}      0.230487    0.000204    0.204576    0.261189    0.230336   1209.01   1234.92    1.000
pi(T){all}      0.279866    0.000223    0.250750    0.309714    0.279732   1200.29   1280.31    1.000
alpha{1,2}      0.079961    0.004467    0.000179    0.201425    0.065103   1194.08   1330.99    1.000
alpha{3}        1.689791    0.567472    0.485843    3.161860    1.565703   1391.50   1427.30    1.000
pinvar{all}     0.315369    0.018679    0.039240    0.543808    0.323720   1099.62   1165.28    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1612.34319
Model 2: PositiveSelection	-1609.229767
Model 0: one-ratio	-1619.591069
Model 3: discrete	-1609.229767
Model 7: beta	-1613.242351
Model 8: beta&w>1	-1609.254657


Model 0 vs 1	14.495758000000023

Model 2 vs 1	6.226846000000023

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.879         4.631
   212 S      1.000**       5.254
   252 L      0.889         4.681
   259 L      0.878         4.624

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.759         3.433 +- 2.310
   212 S      0.947         4.067 +- 2.183
   252 L      0.770         3.496 +- 2.328
   259 L      0.742         3.318 +- 2.253


Model 8 vs 7	7.975388000000294

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.870         4.605
   212 S      1.000**       5.278
   252 L      0.880         4.658
   259 L      0.867         4.593

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.831         2.904 +- 1.917
   212 S      0.980*        3.277 +- 1.766
   252 L      0.835         2.926 +- 1.925
   259 L      0.835         2.887 +- 1.882

>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 

C1              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C2              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C3              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C4              MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C5              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C6              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
C7              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
                ****.******************************************:**

C1              KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C2              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C3              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C4              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C5              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C6              KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C7              KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
                ******:.**.*.*************************************

C1              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C2              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C3              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C4              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C5              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
C6              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C7              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
                ***::**************************:******************

C1              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
C2              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C3              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C4              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C5              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
C6              RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
C7              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
                ***************:*********************  **********.

C1              SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C2              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C3              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C4              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C5              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
C6              SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
C7              SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
                *:***.**.** ******:**:********.:*****.******:*****

C1              KLLLRRESLNDAISITRI
C2              KQLLRRESLSDAISITRI
C3              KQLLRREFLSDAISITRI
C4              KQLLRRESLSDAISITRI
C5              KQLLRRESLSDAISITRI
C6              KQLLRRESTNDAINITRI
C7              KLLLRRESINDAINITRI
                * *****  .***.****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [11256]--->[11256]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.390 Mb, Max= 30.781 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI

FORMAT of file /tmp/tmp6968097659462679997aln Not Supported[FATAL:T-COFFEE]
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:268 S:100 BS:268
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.27 C1	 C2	 96.27
TOP	    1    0	 96.27 C2	 C1	 96.27
BOT	    0    2	 95.90 C1	 C3	 95.90
TOP	    2    0	 95.90 C3	 C1	 95.90
BOT	    0    3	 95.90 C1	 C4	 95.90
TOP	    3    0	 95.90 C4	 C1	 95.90
BOT	    0    4	 95.90 C1	 C5	 95.90
TOP	    4    0	 95.90 C5	 C1	 95.90
BOT	    0    5	 93.28 C1	 C6	 93.28
TOP	    5    0	 93.28 C6	 C1	 93.28
BOT	    0    6	 95.90 C1	 C7	 95.90
TOP	    6    0	 95.90 C7	 C1	 95.90
BOT	    1    2	 99.63 C2	 C3	 99.63
TOP	    2    1	 99.63 C3	 C2	 99.63
BOT	    1    3	 99.63 C2	 C4	 99.63
TOP	    3    1	 99.63 C4	 C2	 99.63
BOT	    1    4	 98.88 C2	 C5	 98.88
TOP	    4    1	 98.88 C5	 C2	 98.88
BOT	    1    5	 93.66 C2	 C6	 93.66
TOP	    5    1	 93.66 C6	 C2	 93.66
BOT	    1    6	 94.78 C2	 C7	 94.78
TOP	    6    1	 94.78 C7	 C2	 94.78
BOT	    2    3	 99.25 C3	 C4	 99.25
TOP	    3    2	 99.25 C4	 C3	 99.25
BOT	    2    4	 98.51 C3	 C5	 98.51
TOP	    4    2	 98.51 C5	 C3	 98.51
BOT	    2    5	 93.28 C3	 C6	 93.28
TOP	    5    2	 93.28 C6	 C3	 93.28
BOT	    2    6	 94.40 C3	 C7	 94.40
TOP	    6    2	 94.40 C7	 C3	 94.40
BOT	    3    4	 98.51 C4	 C5	 98.51
TOP	    4    3	 98.51 C5	 C4	 98.51
BOT	    3    5	 93.28 C4	 C6	 93.28
TOP	    5    3	 93.28 C6	 C4	 93.28
BOT	    3    6	 94.40 C4	 C7	 94.40
TOP	    6    3	 94.40 C7	 C4	 94.40
BOT	    4    5	 93.28 C5	 C6	 93.28
TOP	    5    4	 93.28 C6	 C5	 93.28
BOT	    4    6	 94.40 C5	 C7	 94.40
TOP	    6    4	 94.40 C7	 C5	 94.40
BOT	    5    6	 95.15 C6	 C7	 95.15
TOP	    6    5	 95.15 C7	 C6	 95.15
AVG	 0	 C1	  *	 95.52
AVG	 1	 C2	  *	 97.14
AVG	 2	 C3	  *	 96.83
AVG	 3	 C4	  *	 96.83
AVG	 4	 C5	  *	 96.58
AVG	 5	 C6	  *	 93.66
AVG	 6	 C7	  *	 94.84
TOT	 TOT	  *	 95.91
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C2              ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C3              ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C4              ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C5              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C6              ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA
C7              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
                ********.** .********** **************************

C1              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA
C2              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C3              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C4              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C5              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C6              ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA
C7              ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA
                ******:********.******** **.******** *************

C1              GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C2              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C3              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C4              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C5              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C6              GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA
C7              GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA
                *******.***** **************************  ****.***

C1              AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA
C2              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C3              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C4              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C5              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C6              AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA
C7              AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA
                ***** ***** ***** .** ******** * ***.* ***********

C1              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C2              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C3              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C4              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C5              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C6              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C7              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
                **************************************************

C1              TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT
C2              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C3              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C4              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C5              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C6              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C7              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
                ************************* ************************

C1              ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC
C2              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C3              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C4              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C5              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C6              ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC
C7              ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC
                ***********  ****************:**.**************:**

C1              TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA
C2              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C3              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C4              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C5              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA
C6              ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA
C7              TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA
                :******** ******** ** *** ****************:.******

C1              ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C2              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C3              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C4              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C5              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C6              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C7              ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA
                ************* *****.**************************.***

C1              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C2              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C3              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C4              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C5              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C6              CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA
C7              CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA
                ************.*******.************************.****

C1              AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA
C2              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C3              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C4              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C5              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C6              AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA
C7              AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA
                *********************.*****:**.***** ***** *******

C1              AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC
C2              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C3              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C4              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C5              AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C6              AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC
C7              AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT
                **** *******:**:.******************** ******** .* 

C1              TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA
C2              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C3              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C4              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C5              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C6              TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA
C7              TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA
                *** *:**.******:********.******* . ********* *****

C1              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C2              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C3              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C4              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C5              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT
C6              CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT
C7              CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT
                *** :*******::**** *****************.****.:.******

C1              TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG
C2              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C3              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C4              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C5              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C6              TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG
C7              TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG
                ********** *.*** ***********.*****:***************

C1              AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG
C2              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C3              AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG
C4              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C5              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C6              AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG
C7              AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG
                **.*:. * ************* *. .*.***********.***:**.**

C1              TATT
C2              TATT
C3              TATT
C4              TATT
C5              TATT
C6              TATT
C7              TATT
                ****



>C1
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA
GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC
TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC
TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG
AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG
TATT
>C2
ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C3
ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C4
ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C5
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C6
ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA
AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC
ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA
AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA
AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC
TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA
CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT
TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG
AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG
TATT
>C7
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA
GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA
AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC
TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA
CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA
AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT
TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA
CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT
TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG
TATT
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 7 taxa and 804 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478082874
      Setting output file names to "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 119105681
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0921445789
      Seed = 1783177223
      Swapseed = 1478082874
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 21 unique site patterns
      Division 2 has 14 unique site patterns
      Division 3 has 38 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2420.895436 -- -24.557203
         Chain 2 -- -2425.018516 -- -24.557203
         Chain 3 -- -2425.018517 -- -24.557203
         Chain 4 -- -2424.658399 -- -24.557203

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2323.671928 -- -24.557203
         Chain 2 -- -2420.734829 -- -24.557203
         Chain 3 -- -2423.901976 -- -24.557203
         Chain 4 -- -2408.130008 -- -24.557203


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2420.895] (-2425.019) (-2425.019) (-2424.658) * [-2323.672] (-2420.735) (-2423.902) (-2408.130) 
        500 -- [-1695.752] (-1697.332) (-1695.874) (-1695.339) * (-1702.148) (-1699.151) (-1698.639) [-1696.797] -- 0:00:00
       1000 -- (-1691.528) (-1688.445) (-1695.551) [-1679.016] * (-1691.807) [-1684.280] (-1685.046) (-1686.704) -- 0:00:00
       1500 -- (-1691.743) [-1687.673] (-1687.974) (-1681.737) * (-1686.355) [-1681.322] (-1689.832) (-1697.333) -- 0:00:00
       2000 -- (-1684.585) [-1680.845] (-1691.053) (-1681.450) * (-1687.289) [-1685.078] (-1687.611) (-1686.012) -- 0:00:00
       2500 -- (-1692.378) [-1675.862] (-1690.542) (-1683.247) * [-1680.730] (-1681.290) (-1692.842) (-1683.263) -- 0:00:00
       3000 -- (-1697.199) [-1684.116] (-1679.273) (-1679.621) * [-1678.847] (-1675.766) (-1694.520) (-1685.774) -- 0:00:00
       3500 -- (-1694.973) [-1672.038] (-1680.047) (-1687.566) * (-1676.987) [-1676.411] (-1684.481) (-1682.442) -- 0:00:00
       4000 -- (-1688.068) [-1677.629] (-1672.026) (-1691.796) * (-1679.886) [-1673.458] (-1681.862) (-1682.026) -- 0:00:00
       4500 -- (-1691.996) (-1677.424) [-1675.472] (-1670.953) * (-1680.761) [-1680.374] (-1683.338) (-1675.541) -- 0:03:41
       5000 -- (-1684.316) (-1672.480) (-1684.358) [-1677.248] * (-1677.398) (-1675.106) (-1678.166) [-1674.034] -- 0:03:19

      Average standard deviation of split frequencies: 0.026189

       5500 -- (-1675.055) [-1677.710] (-1677.538) (-1679.021) * (-1677.789) (-1680.034) (-1689.554) [-1678.020] -- 0:03:00
       6000 -- (-1675.544) (-1690.486) (-1686.022) [-1674.201] * [-1675.530] (-1682.474) (-1685.602) (-1676.658) -- 0:02:45
       6500 -- (-1681.817) (-1682.509) (-1682.981) [-1672.669] * (-1674.858) (-1678.833) (-1681.963) [-1676.788] -- 0:02:32
       7000 -- [-1683.109] (-1679.011) (-1684.462) (-1677.858) * (-1680.586) (-1679.139) [-1677.605] (-1676.640) -- 0:02:21
       7500 -- (-1673.089) [-1676.746] (-1678.558) (-1677.397) * [-1675.265] (-1676.533) (-1686.070) (-1687.019) -- 0:02:12
       8000 -- (-1674.811) (-1677.607) (-1691.397) [-1683.011] * (-1677.505) (-1676.204) (-1683.456) [-1673.389] -- 0:02:04
       8500 -- (-1682.093) (-1693.001) (-1684.201) [-1678.307] * (-1675.783) (-1679.257) [-1680.707] (-1676.981) -- 0:01:56
       9000 -- (-1681.874) (-1686.924) (-1683.286) [-1674.139] * (-1677.362) [-1687.831] (-1683.307) (-1674.388) -- 0:01:50
       9500 -- (-1684.220) (-1685.914) (-1701.002) [-1673.734] * (-1675.048) [-1684.385] (-1678.518) (-1672.907) -- 0:03:28
      10000 -- (-1679.602) (-1681.279) (-1687.915) [-1674.026] * (-1684.760) (-1681.819) (-1684.543) [-1676.640] -- 0:03:18

      Average standard deviation of split frequencies: 0.051560

      10500 -- (-1674.606) [-1675.901] (-1684.041) (-1679.454) * [-1676.319] (-1683.438) (-1684.528) (-1679.957) -- 0:03:08
      11000 -- (-1677.742) [-1680.693] (-1681.355) (-1674.571) * (-1685.771) (-1675.309) [-1671.599] (-1682.583) -- 0:02:59
      11500 -- (-1674.152) (-1677.638) [-1674.373] (-1675.073) * (-1677.984) [-1675.025] (-1674.240) (-1679.015) -- 0:02:51
      12000 -- (-1675.278) (-1684.532) (-1675.669) [-1677.696] * (-1684.060) (-1673.059) [-1675.718] (-1681.669) -- 0:02:44
      12500 -- (-1671.359) [-1669.898] (-1688.065) (-1676.337) * (-1683.480) (-1682.338) (-1676.242) [-1673.936] -- 0:02:38
      13000 -- [-1675.296] (-1682.487) (-1691.187) (-1678.102) * (-1678.877) [-1679.126] (-1694.917) (-1676.709) -- 0:02:31
      13500 -- [-1676.202] (-1673.361) (-1676.304) (-1677.224) * (-1676.807) (-1686.295) (-1684.968) [-1679.280] -- 0:02:26
      14000 -- (-1682.469) [-1676.344] (-1675.638) (-1677.262) * (-1680.271) [-1679.732] (-1680.870) (-1677.765) -- 0:02:20
      14500 -- (-1682.914) [-1674.503] (-1670.484) (-1676.732) * (-1675.613) [-1676.712] (-1694.698) (-1678.195) -- 0:03:23
      15000 -- (-1679.607) (-1676.023) [-1674.726] (-1683.685) * [-1681.010] (-1680.668) (-1691.961) (-1683.933) -- 0:03:17

      Average standard deviation of split frequencies: 0.044194

      15500 -- (-1678.351) [-1676.287] (-1677.239) (-1676.019) * (-1689.280) (-1684.496) (-1672.340) [-1676.512] -- 0:03:10
      16000 -- [-1674.259] (-1679.124) (-1671.438) (-1690.908) * (-1692.109) [-1676.425] (-1682.041) (-1675.346) -- 0:03:04
      16500 -- (-1685.714) (-1676.750) (-1673.469) [-1678.033] * (-1683.056) (-1676.115) (-1679.194) [-1682.360] -- 0:02:58
      17000 -- (-1686.918) [-1675.418] (-1677.622) (-1678.762) * (-1683.017) (-1678.349) (-1681.854) [-1677.384] -- 0:02:53
      17500 -- (-1685.997) (-1680.524) (-1677.435) [-1676.380] * (-1677.129) [-1675.303] (-1677.718) (-1686.091) -- 0:02:48
      18000 -- (-1678.015) (-1680.364) [-1673.812] (-1684.674) * (-1676.476) [-1678.361] (-1689.354) (-1673.952) -- 0:02:43
      18500 -- (-1679.294) (-1673.052) (-1677.532) [-1680.964] * (-1681.352) [-1675.779] (-1678.106) (-1676.152) -- 0:02:39
      19000 -- [-1680.631] (-1676.203) (-1677.138) (-1685.113) * (-1691.237) (-1678.896) (-1679.094) [-1675.448] -- 0:02:34
      19500 -- (-1676.215) (-1675.250) [-1680.857] (-1678.774) * (-1686.413) [-1679.145] (-1679.834) (-1678.357) -- 0:03:21
      20000 -- (-1678.314) [-1674.929] (-1678.871) (-1679.033) * (-1686.676) [-1675.989] (-1687.163) (-1673.785) -- 0:03:16

      Average standard deviation of split frequencies: 0.038016

      20500 -- (-1679.329) [-1673.684] (-1676.617) (-1679.367) * [-1670.734] (-1682.684) (-1680.075) (-1681.654) -- 0:03:11
      21000 -- (-1678.443) (-1676.095) (-1685.404) [-1677.915] * [-1683.552] (-1682.981) (-1683.810) (-1674.363) -- 0:03:06
      21500 -- [-1677.941] (-1681.059) (-1682.928) (-1678.395) * (-1683.333) (-1675.602) (-1678.859) [-1675.141] -- 0:03:02
      22000 -- (-1673.503) (-1679.773) (-1676.461) [-1682.377] * (-1674.880) (-1675.544) [-1677.041] (-1682.541) -- 0:02:57
      22500 -- (-1677.150) (-1671.897) [-1674.758] (-1681.705) * (-1682.170) (-1675.547) (-1685.802) [-1678.968] -- 0:02:53
      23000 -- [-1676.801] (-1677.762) (-1674.607) (-1683.603) * (-1673.014) (-1672.735) [-1676.363] (-1678.770) -- 0:02:49
      23500 -- (-1679.572) (-1674.322) [-1675.367] (-1682.759) * (-1677.075) (-1675.619) (-1673.493) [-1672.316] -- 0:02:46
      24000 -- [-1676.576] (-1677.401) (-1678.043) (-1688.416) * (-1676.895) (-1682.787) (-1675.819) [-1672.448] -- 0:02:42
      24500 -- (-1677.483) (-1677.334) [-1672.690] (-1688.908) * [-1677.123] (-1674.824) (-1675.023) (-1681.736) -- 0:03:19
      25000 -- (-1676.518) (-1675.947) (-1678.028) [-1680.234] * (-1684.310) (-1677.408) (-1685.796) [-1673.514] -- 0:03:15

      Average standard deviation of split frequencies: 0.042306

      25500 -- [-1676.520] (-1675.506) (-1676.994) (-1678.684) * (-1674.424) [-1681.776] (-1684.808) (-1673.004) -- 0:03:11
      26000 -- (-1679.075) (-1672.297) (-1674.738) [-1672.950] * (-1679.546) (-1683.069) (-1678.994) [-1672.681] -- 0:03:07
      26500 -- (-1681.656) [-1676.061] (-1681.410) (-1676.818) * [-1678.926] (-1685.103) (-1687.067) (-1678.922) -- 0:03:03
      27000 -- (-1676.260) (-1685.279) [-1680.226] (-1674.388) * (-1677.289) [-1676.814] (-1683.731) (-1681.103) -- 0:03:00
      27500 -- (-1677.616) [-1686.203] (-1697.446) (-1679.648) * [-1680.864] (-1685.032) (-1689.123) (-1681.624) -- 0:02:56
      28000 -- [-1680.920] (-1679.887) (-1691.573) (-1680.844) * (-1682.031) (-1678.420) (-1685.469) [-1682.989] -- 0:02:53
      28500 -- (-1676.804) (-1683.585) (-1680.013) [-1682.448] * (-1678.152) [-1678.329] (-1683.365) (-1690.691) -- 0:02:50
      29000 -- [-1678.259] (-1676.405) (-1679.222) (-1687.497) * (-1675.033) [-1680.609] (-1673.244) (-1687.424) -- 0:02:47
      29500 -- (-1692.401) [-1674.846] (-1675.250) (-1680.072) * [-1680.202] (-1693.056) (-1672.115) (-1686.009) -- 0:03:17
      30000 -- (-1677.731) (-1680.359) [-1676.777] (-1677.509) * (-1678.970) [-1675.835] (-1676.610) (-1686.729) -- 0:03:14

      Average standard deviation of split frequencies: 0.030744

      30500 -- (-1680.440) [-1679.885] (-1681.244) (-1678.483) * (-1679.768) (-1679.386) [-1680.824] (-1691.507) -- 0:03:10
      31000 -- (-1680.826) [-1679.340] (-1678.447) (-1688.507) * (-1672.845) (-1677.189) (-1670.975) [-1684.477] -- 0:03:07
      31500 -- (-1675.964) (-1674.545) [-1673.819] (-1683.812) * [-1676.087] (-1683.148) (-1671.815) (-1674.657) -- 0:03:04
      32000 -- (-1685.724) [-1670.816] (-1678.992) (-1681.445) * (-1674.589) (-1684.657) (-1697.875) [-1674.703] -- 0:03:01
      32500 -- (-1681.902) [-1673.796] (-1672.543) (-1681.770) * (-1673.138) (-1681.883) (-1679.025) [-1677.664] -- 0:02:58
      33000 -- (-1677.683) (-1672.031) [-1671.463] (-1690.173) * (-1673.780) (-1682.824) (-1680.147) [-1672.892] -- 0:02:55
      33500 -- (-1676.324) (-1675.156) [-1672.951] (-1683.787) * [-1672.281] (-1684.785) (-1683.531) (-1680.427) -- 0:02:53
      34000 -- (-1682.258) [-1677.634] (-1679.071) (-1691.069) * (-1680.341) (-1682.183) (-1685.427) [-1673.274] -- 0:02:50
      34500 -- (-1683.893) [-1678.472] (-1681.741) (-1683.950) * (-1673.976) (-1681.956) [-1675.935] (-1678.534) -- 0:03:15
      35000 -- (-1672.945) [-1678.191] (-1682.049) (-1685.230) * (-1679.761) (-1678.261) (-1680.490) [-1677.899] -- 0:03:13

      Average standard deviation of split frequencies: 0.026189

      35500 -- (-1669.832) [-1681.959] (-1680.285) (-1690.842) * [-1675.224] (-1676.433) (-1676.745) (-1680.377) -- 0:03:10
      36000 -- (-1681.880) [-1678.340] (-1680.680) (-1688.751) * (-1682.205) [-1677.082] (-1676.918) (-1682.296) -- 0:03:07
      36500 -- [-1681.206] (-1678.699) (-1677.824) (-1683.782) * (-1677.342) (-1685.126) (-1678.567) [-1674.289] -- 0:03:04
      37000 -- (-1673.298) (-1682.345) [-1673.812] (-1688.506) * (-1690.996) (-1683.780) (-1678.350) [-1679.847] -- 0:03:02
      37500 -- [-1676.507] (-1683.275) (-1675.838) (-1687.417) * (-1679.696) (-1685.050) [-1684.288] (-1676.534) -- 0:02:59
      38000 -- (-1678.986) (-1685.196) (-1680.075) [-1680.472] * (-1691.535) (-1677.674) (-1674.035) [-1675.784] -- 0:02:57
      38500 -- (-1686.418) [-1672.431] (-1674.928) (-1676.244) * (-1683.745) [-1681.188] (-1677.759) (-1681.777) -- 0:02:54
      39000 -- (-1678.832) (-1675.936) (-1671.077) [-1678.301] * (-1680.612) (-1676.407) (-1678.831) [-1671.899] -- 0:02:52
      39500 -- (-1680.360) (-1680.873) [-1672.534] (-1681.199) * (-1680.880) (-1680.768) (-1680.837) [-1674.318] -- 0:03:14
      40000 -- [-1684.444] (-1682.867) (-1675.885) (-1680.975) * [-1676.034] (-1677.827) (-1677.785) (-1675.688) -- 0:03:12

      Average standard deviation of split frequencies: 0.021252

      40500 -- [-1681.997] (-1672.608) (-1682.615) (-1679.386) * (-1674.366) (-1674.746) (-1678.596) [-1670.883] -- 0:03:09
      41000 -- [-1680.648] (-1688.702) (-1672.749) (-1682.149) * [-1677.350] (-1679.769) (-1677.233) (-1689.708) -- 0:03:07
      41500 -- (-1684.146) (-1674.933) [-1676.379] (-1679.573) * (-1672.306) [-1674.922] (-1673.011) (-1680.380) -- 0:03:04
      42000 -- (-1679.467) (-1678.944) (-1676.190) [-1673.402] * (-1676.744) [-1674.201] (-1678.225) (-1674.393) -- 0:03:02
      42500 -- [-1672.697] (-1681.043) (-1673.331) (-1675.163) * (-1679.794) [-1674.990] (-1677.369) (-1681.762) -- 0:03:00
      43000 -- (-1676.022) (-1680.146) [-1670.570] (-1680.504) * [-1692.018] (-1677.251) (-1678.935) (-1677.665) -- 0:02:58
      43500 -- [-1682.149] (-1678.152) (-1682.306) (-1674.777) * (-1681.147) [-1679.298] (-1674.777) (-1684.311) -- 0:02:55
      44000 -- [-1673.122] (-1675.401) (-1676.679) (-1674.779) * (-1681.481) [-1681.340] (-1677.822) (-1674.591) -- 0:02:53
      44500 -- (-1676.694) (-1679.569) (-1679.708) [-1678.069] * (-1675.439) [-1677.055] (-1676.451) (-1683.894) -- 0:03:13
      45000 -- (-1673.043) [-1673.897] (-1681.238) (-1681.342) * (-1677.464) (-1687.033) (-1677.560) [-1679.265] -- 0:03:11

      Average standard deviation of split frequencies: 0.018788

      45500 -- (-1679.555) (-1688.619) [-1674.909] (-1690.323) * [-1676.441] (-1680.018) (-1679.581) (-1678.732) -- 0:03:08
      46000 -- (-1676.072) (-1680.246) [-1673.921] (-1680.772) * (-1682.464) [-1677.273] (-1678.546) (-1678.970) -- 0:03:06
      46500 -- (-1679.109) (-1680.189) [-1678.056] (-1678.526) * (-1678.077) (-1677.628) (-1674.151) [-1676.530] -- 0:03:04
      47000 -- (-1674.950) (-1680.993) (-1674.006) [-1679.870] * (-1683.036) (-1683.051) [-1678.160] (-1681.182) -- 0:03:02
      47500 -- (-1683.326) (-1673.729) [-1675.463] (-1687.360) * (-1679.850) (-1680.654) [-1672.382] (-1675.437) -- 0:03:00
      48000 -- (-1675.692) [-1680.983] (-1683.221) (-1681.243) * (-1674.868) (-1674.955) [-1676.368] (-1684.859) -- 0:02:58
      48500 -- (-1675.208) (-1671.619) (-1671.870) [-1678.307] * [-1674.106] (-1684.551) (-1678.151) (-1680.230) -- 0:02:56
      49000 -- (-1680.634) [-1675.451] (-1676.823) (-1678.655) * (-1679.445) (-1696.441) (-1674.236) [-1680.266] -- 0:02:54
      49500 -- (-1674.467) (-1681.390) (-1680.020) [-1671.541] * (-1680.713) (-1689.968) [-1679.460] (-1677.613) -- 0:03:12
      50000 -- (-1684.618) (-1681.872) (-1679.810) [-1672.967] * (-1678.292) (-1690.215) [-1680.071] (-1685.336) -- 0:03:10

      Average standard deviation of split frequencies: 0.017057

      50500 -- (-1679.497) (-1679.192) [-1677.872] (-1673.715) * [-1684.668] (-1677.996) (-1680.318) (-1683.118) -- 0:03:08
      51000 -- (-1684.692) (-1678.694) [-1669.502] (-1682.557) * [-1680.327] (-1675.934) (-1683.260) (-1690.132) -- 0:03:06
      51500 -- (-1680.173) (-1684.238) [-1678.428] (-1674.012) * (-1676.854) (-1675.838) (-1680.136) [-1677.339] -- 0:03:04
      52000 -- [-1674.842] (-1686.803) (-1683.563) (-1675.495) * (-1681.502) (-1680.758) [-1677.278] (-1677.129) -- 0:03:02
      52500 -- (-1677.288) (-1676.472) (-1694.994) [-1673.139] * (-1677.349) (-1681.652) [-1675.029] (-1678.989) -- 0:03:00
      53000 -- (-1685.340) (-1679.503) (-1682.106) [-1681.737] * (-1688.221) (-1678.037) [-1684.765] (-1678.704) -- 0:02:58
      53500 -- (-1677.896) [-1674.900] (-1680.078) (-1676.292) * (-1678.092) (-1675.712) (-1673.431) [-1674.356] -- 0:02:56
      54000 -- (-1680.280) [-1681.713] (-1686.789) (-1676.526) * (-1676.266) [-1676.509] (-1675.898) (-1675.820) -- 0:02:55
      54500 -- (-1683.239) (-1676.816) (-1686.641) [-1678.482] * (-1676.373) (-1674.642) (-1675.069) [-1677.162] -- 0:02:53
      55000 -- [-1677.787] (-1675.644) (-1683.101) (-1678.436) * (-1679.994) (-1677.319) (-1672.852) [-1677.289] -- 0:03:09

      Average standard deviation of split frequencies: 0.009821

      55500 -- (-1672.667) (-1678.638) (-1683.192) [-1674.101] * [-1676.125] (-1672.806) (-1679.691) (-1679.962) -- 0:03:07
      56000 -- (-1674.840) [-1672.136] (-1682.113) (-1678.554) * (-1679.309) (-1682.387) [-1676.988] (-1690.048) -- 0:03:05
      56500 -- (-1678.305) (-1679.558) (-1683.459) [-1675.077] * (-1683.140) (-1670.064) [-1675.260] (-1695.029) -- 0:03:03
      57000 -- (-1686.464) (-1678.071) (-1684.370) [-1679.146] * [-1682.899] (-1681.249) (-1678.981) (-1695.627) -- 0:03:01
      57500 -- (-1676.499) (-1688.382) (-1678.206) [-1680.236] * (-1681.712) (-1688.939) (-1679.475) [-1680.674] -- 0:03:00
      58000 -- (-1678.041) (-1686.288) (-1678.982) [-1677.646] * (-1679.385) [-1680.504] (-1688.151) (-1683.008) -- 0:02:58
      58500 -- (-1676.360) (-1677.638) [-1674.587] (-1685.664) * [-1677.413] (-1673.274) (-1676.048) (-1676.737) -- 0:02:57
      59000 -- (-1678.940) (-1683.622) [-1678.553] (-1680.262) * (-1683.226) (-1678.328) [-1682.564] (-1674.425) -- 0:02:55
      59500 -- (-1676.082) (-1679.985) [-1689.615] (-1681.521) * (-1674.688) (-1682.139) (-1679.340) [-1679.460] -- 0:02:53
      60000 -- (-1681.868) (-1676.894) (-1679.128) [-1677.351] * (-1676.675) (-1675.709) [-1679.119] (-1676.830) -- 0:03:08

      Average standard deviation of split frequencies: 0.011656

      60500 -- (-1684.509) [-1686.367] (-1681.206) (-1680.209) * (-1680.322) (-1676.753) [-1676.249] (-1686.628) -- 0:03:06
      61000 -- (-1680.444) [-1669.802] (-1681.962) (-1676.724) * (-1681.192) (-1677.228) (-1684.402) [-1672.728] -- 0:03:04
      61500 -- (-1682.328) (-1677.428) (-1676.009) [-1676.811] * (-1681.027) [-1670.868] (-1679.956) (-1676.950) -- 0:03:03
      62000 -- [-1684.425] (-1678.391) (-1673.884) (-1673.686) * (-1678.731) [-1676.750] (-1680.860) (-1676.975) -- 0:03:01
      62500 -- (-1681.262) (-1672.885) (-1674.070) [-1676.037] * (-1672.980) (-1681.581) (-1680.246) [-1678.091] -- 0:03:00
      63000 -- (-1686.234) (-1683.698) (-1672.566) [-1679.063] * (-1675.904) (-1676.361) (-1681.178) [-1681.244] -- 0:02:58
      63500 -- [-1676.875] (-1674.931) (-1679.501) (-1689.921) * (-1675.177) [-1679.111] (-1681.878) (-1683.140) -- 0:02:56
      64000 -- (-1676.715) (-1673.535) (-1691.939) [-1677.643] * [-1675.290] (-1679.553) (-1678.242) (-1683.395) -- 0:02:55
      64500 -- (-1676.346) (-1677.133) (-1691.515) [-1677.026] * (-1681.014) (-1677.574) [-1681.005] (-1686.015) -- 0:02:54
      65000 -- (-1684.896) (-1670.925) (-1681.092) [-1678.477] * (-1683.299) (-1677.511) (-1677.294) [-1679.210] -- 0:03:07

      Average standard deviation of split frequencies: 0.005952

      65500 -- (-1675.783) [-1681.310] (-1687.939) (-1680.443) * [-1683.670] (-1686.502) (-1674.708) (-1675.975) -- 0:03:05
      66000 -- (-1677.956) (-1684.721) (-1681.569) [-1683.178] * [-1680.002] (-1686.729) (-1699.992) (-1681.682) -- 0:03:03
      66500 -- (-1684.890) (-1680.452) [-1678.598] (-1681.054) * (-1678.197) (-1681.597) (-1691.169) [-1680.822] -- 0:03:02
      67000 -- (-1681.281) [-1678.333] (-1672.958) (-1677.014) * [-1673.766] (-1679.975) (-1690.078) (-1676.698) -- 0:03:01
      67500 -- (-1680.609) (-1687.937) [-1673.730] (-1671.791) * [-1680.423] (-1675.792) (-1681.182) (-1686.402) -- 0:02:59
      68000 -- (-1673.044) (-1680.063) [-1684.841] (-1677.556) * [-1682.172] (-1679.558) (-1681.437) (-1676.735) -- 0:02:58
      68500 -- [-1675.441] (-1680.803) (-1677.553) (-1676.272) * (-1680.855) (-1685.107) [-1685.325] (-1674.971) -- 0:02:56
      69000 -- (-1674.323) [-1678.290] (-1678.976) (-1680.038) * [-1681.934] (-1688.991) (-1677.511) (-1677.096) -- 0:02:55
      69500 -- (-1673.014) [-1677.012] (-1677.237) (-1678.374) * (-1672.377) (-1684.299) [-1676.037] (-1676.027) -- 0:02:54
      70000 -- (-1680.618) [-1678.085] (-1680.636) (-1682.937) * [-1674.310] (-1681.475) (-1676.586) (-1688.355) -- 0:03:06

      Average standard deviation of split frequencies: 0.008894

      70500 -- [-1675.470] (-1673.914) (-1677.846) (-1680.334) * (-1675.238) (-1680.646) [-1672.884] (-1683.356) -- 0:03:04
      71000 -- (-1681.273) [-1676.753] (-1678.309) (-1681.366) * (-1677.066) [-1678.525] (-1673.591) (-1674.202) -- 0:03:03
      71500 -- (-1678.851) (-1681.217) [-1676.844] (-1681.498) * (-1672.206) (-1681.094) [-1681.404] (-1677.911) -- 0:03:01
      72000 -- (-1687.602) (-1691.248) (-1679.168) [-1675.271] * [-1674.842] (-1682.185) (-1683.127) (-1674.515) -- 0:03:00
      72500 -- (-1680.403) (-1689.420) (-1689.017) [-1676.451] * (-1677.845) (-1678.553) (-1680.224) [-1678.713] -- 0:02:59
      73000 -- (-1677.951) (-1683.063) [-1685.643] (-1687.287) * (-1675.298) [-1678.663] (-1673.849) (-1685.289) -- 0:02:57
      73500 -- (-1678.973) (-1683.538) (-1677.204) [-1671.982] * (-1680.032) (-1684.070) [-1674.472] (-1677.645) -- 0:02:56
      74000 -- [-1683.274] (-1685.569) (-1688.219) (-1674.299) * (-1686.680) (-1689.706) (-1682.699) [-1675.078] -- 0:02:55
      74500 -- (-1677.280) (-1682.699) [-1676.149] (-1673.662) * (-1689.129) [-1677.293] (-1676.691) (-1679.720) -- 0:03:06
      75000 -- [-1678.638] (-1678.240) (-1677.842) (-1676.124) * (-1680.135) (-1680.267) [-1680.130] (-1679.462) -- 0:03:05

      Average standard deviation of split frequencies: 0.013439

      75500 -- (-1677.918) [-1674.655] (-1677.060) (-1682.118) * [-1680.681] (-1681.582) (-1675.235) (-1676.350) -- 0:03:03
      76000 -- [-1675.413] (-1673.568) (-1678.735) (-1678.068) * (-1684.732) (-1676.565) (-1678.624) [-1678.428] -- 0:03:02
      76500 -- (-1674.009) (-1680.490) [-1681.439] (-1677.036) * (-1680.718) (-1677.475) [-1678.645] (-1679.149) -- 0:03:01
      77000 -- (-1677.917) (-1683.069) (-1672.413) [-1680.428] * [-1677.536] (-1675.312) (-1676.175) (-1684.978) -- 0:02:59
      77500 -- [-1677.471] (-1676.673) (-1682.802) (-1675.618) * [-1676.886] (-1674.566) (-1686.060) (-1674.088) -- 0:02:58
      78000 -- (-1681.171) [-1681.353] (-1670.625) (-1678.229) * (-1678.402) (-1675.673) (-1679.159) [-1678.289] -- 0:02:57
      78500 -- (-1677.213) (-1680.647) [-1672.531] (-1670.395) * (-1677.626) (-1679.607) [-1684.329] (-1679.619) -- 0:02:56
      79000 -- [-1676.380] (-1669.877) (-1675.693) (-1673.611) * (-1677.104) (-1685.829) (-1675.217) [-1680.145] -- 0:02:54
      79500 -- (-1677.121) (-1678.884) [-1680.398] (-1679.789) * (-1673.134) (-1687.869) [-1677.418] (-1685.715) -- 0:03:05
      80000 -- [-1674.862] (-1676.141) (-1680.620) (-1678.213) * [-1671.100] (-1675.974) (-1679.807) (-1680.623) -- 0:03:04

      Average standard deviation of split frequencies: 0.022401

      80500 -- [-1671.618] (-1683.857) (-1681.725) (-1676.651) * (-1678.103) (-1677.445) [-1673.743] (-1680.461) -- 0:03:02
      81000 -- (-1681.271) (-1675.998) [-1684.557] (-1674.612) * (-1686.319) (-1682.146) [-1677.131] (-1680.145) -- 0:03:01
      81500 -- (-1683.887) (-1687.988) [-1676.500] (-1671.365) * (-1676.601) (-1678.059) (-1676.694) [-1674.974] -- 0:03:00
      82000 -- [-1676.467] (-1684.964) (-1683.035) (-1677.919) * [-1678.011] (-1674.727) (-1678.869) (-1675.763) -- 0:02:59
      82500 -- (-1687.059) (-1685.489) (-1691.764) [-1673.716] * (-1679.252) [-1670.552] (-1681.337) (-1684.189) -- 0:02:57
      83000 -- [-1678.396] (-1677.828) (-1687.573) (-1676.667) * (-1675.871) (-1677.982) (-1678.144) [-1681.219] -- 0:02:56
      83500 -- (-1680.993) (-1680.227) (-1671.370) [-1681.972] * (-1682.043) (-1671.575) (-1680.905) [-1677.962] -- 0:02:55
      84000 -- [-1676.338] (-1676.159) (-1672.291) (-1675.877) * (-1683.609) [-1672.798] (-1685.668) (-1676.853) -- 0:02:54
      84500 -- (-1680.663) [-1675.605] (-1676.087) (-1680.736) * (-1677.476) [-1676.260] (-1686.641) (-1673.350) -- 0:03:04
      85000 -- (-1683.495) (-1678.565) [-1677.426] (-1696.051) * (-1682.615) [-1672.549] (-1686.776) (-1674.297) -- 0:03:03

      Average standard deviation of split frequencies: 0.019185

      85500 -- [-1685.229] (-1677.805) (-1684.179) (-1682.147) * [-1674.681] (-1676.260) (-1678.082) (-1681.464) -- 0:03:01
      86000 -- [-1677.199] (-1684.622) (-1680.962) (-1677.499) * (-1689.800) (-1678.968) (-1677.455) [-1680.677] -- 0:03:00
      86500 -- (-1689.909) (-1675.478) (-1678.144) [-1682.758] * (-1687.256) (-1679.013) [-1670.048] (-1676.367) -- 0:02:59
      87000 -- (-1683.421) [-1672.198] (-1677.002) (-1688.983) * (-1685.921) [-1673.380] (-1675.700) (-1677.108) -- 0:02:58
      87500 -- (-1680.714) [-1674.582] (-1677.056) (-1676.201) * (-1681.753) (-1677.727) (-1674.563) [-1677.773] -- 0:02:57
      88000 -- [-1683.478] (-1676.202) (-1684.697) (-1684.592) * (-1690.115) [-1676.741] (-1681.409) (-1678.288) -- 0:02:56
      88500 -- (-1676.902) (-1677.135) (-1675.309) [-1673.967] * (-1678.913) [-1679.371] (-1680.887) (-1684.492) -- 0:02:55
      89000 -- (-1678.885) [-1676.100] (-1679.058) (-1678.089) * (-1680.043) (-1678.784) (-1686.409) [-1679.760] -- 0:02:54
      89500 -- [-1683.972] (-1678.598) (-1673.833) (-1682.795) * (-1687.035) (-1682.241) (-1689.126) [-1672.797] -- 0:03:03
      90000 -- (-1678.078) [-1674.340] (-1680.560) (-1679.022) * (-1678.660) [-1672.428] (-1676.263) (-1679.173) -- 0:03:02

      Average standard deviation of split frequencies: 0.016464

      90500 -- [-1672.987] (-1683.792) (-1674.650) (-1688.299) * (-1677.133) (-1670.993) (-1679.223) [-1685.025] -- 0:03:00
      91000 -- (-1677.052) (-1678.539) [-1677.759] (-1679.092) * (-1675.262) (-1673.360) [-1679.740] (-1680.526) -- 0:02:59
      91500 -- [-1671.771] (-1676.325) (-1686.561) (-1679.284) * (-1672.472) [-1679.945] (-1678.034) (-1693.977) -- 0:02:58
      92000 -- (-1674.891) (-1678.341) [-1684.947] (-1672.795) * (-1674.174) (-1687.027) (-1677.497) [-1678.603] -- 0:02:57
      92500 -- (-1684.229) (-1677.269) (-1685.778) [-1679.541] * (-1681.263) (-1692.870) (-1683.714) [-1677.618] -- 0:02:56
      93000 -- (-1673.643) [-1680.745] (-1682.793) (-1676.250) * (-1686.887) (-1683.397) [-1679.021] (-1683.440) -- 0:02:55
      93500 -- [-1682.174] (-1689.976) (-1676.638) (-1679.615) * (-1678.939) [-1684.209] (-1675.040) (-1675.627) -- 0:02:54
      94000 -- (-1680.697) [-1679.782] (-1674.034) (-1680.336) * (-1676.708) (-1677.554) [-1676.176] (-1673.543) -- 0:02:53
      94500 -- (-1680.198) (-1681.297) (-1679.237) [-1680.148] * (-1684.979) [-1676.212] (-1674.293) (-1675.197) -- 0:03:02
      95000 -- (-1676.678) (-1671.959) [-1675.554] (-1672.158) * (-1678.773) (-1674.287) (-1681.714) [-1678.354] -- 0:03:01

      Average standard deviation of split frequencies: 0.015550

      95500 -- (-1684.808) (-1686.039) [-1678.864] (-1673.316) * (-1673.426) (-1676.018) (-1691.013) [-1675.975] -- 0:02:59
      96000 -- (-1681.960) (-1677.568) (-1678.647) [-1676.356] * (-1681.569) (-1677.045) [-1672.964] (-1680.338) -- 0:02:58
      96500 -- [-1677.540] (-1679.774) (-1682.230) (-1681.048) * (-1672.694) (-1689.186) (-1675.930) [-1677.575] -- 0:02:57
      97000 -- (-1670.210) (-1689.408) [-1678.026] (-1678.576) * (-1681.080) (-1675.805) [-1674.949] (-1685.790) -- 0:02:56
      97500 -- (-1673.715) (-1687.770) [-1675.316] (-1687.050) * (-1677.852) (-1674.263) [-1676.758] (-1685.168) -- 0:02:55
      98000 -- (-1674.567) [-1677.028] (-1676.433) (-1682.943) * [-1673.174] (-1678.127) (-1672.536) (-1677.175) -- 0:02:54
      98500 -- (-1679.258) [-1677.973] (-1681.464) (-1678.811) * (-1677.519) (-1682.661) (-1672.225) [-1673.087] -- 0:02:53
      99000 -- (-1674.261) (-1675.147) (-1684.609) [-1677.308] * (-1676.170) (-1687.054) [-1673.789] (-1687.530) -- 0:02:52
      99500 -- (-1679.321) (-1677.910) [-1671.769] (-1675.611) * [-1684.729] (-1677.704) (-1678.719) (-1680.053) -- 0:03:01
      100000 -- (-1688.006) (-1684.376) (-1672.895) [-1682.837] * (-1682.216) (-1680.920) (-1680.297) [-1678.821] -- 0:03:00

      Average standard deviation of split frequencies: 0.017951

      100500 -- (-1682.356) [-1678.815] (-1671.907) (-1677.257) * (-1678.468) (-1675.650) (-1679.453) [-1677.137] -- 0:02:59
      101000 -- [-1679.689] (-1673.424) (-1676.688) (-1675.931) * (-1677.019) (-1673.900) [-1679.498] (-1679.506) -- 0:02:58
      101500 -- (-1683.226) [-1673.272] (-1688.052) (-1680.753) * (-1681.596) [-1681.526] (-1675.867) (-1678.426) -- 0:02:57
      102000 -- (-1682.830) (-1676.318) [-1673.634] (-1674.096) * (-1673.185) (-1677.603) [-1683.220] (-1682.689) -- 0:02:56
      102500 -- (-1674.918) (-1681.988) (-1679.252) [-1676.753] * (-1680.517) (-1676.027) (-1675.650) [-1680.194] -- 0:02:55
      103000 -- [-1675.121] (-1682.507) (-1675.865) (-1679.937) * (-1678.603) [-1675.228] (-1683.186) (-1680.510) -- 0:02:54
      103500 -- (-1683.447) (-1674.108) (-1678.207) [-1673.116] * (-1679.256) [-1676.875] (-1677.532) (-1683.559) -- 0:02:53
      104000 -- (-1672.621) (-1677.030) (-1681.909) [-1682.014] * [-1676.424] (-1678.567) (-1681.138) (-1684.615) -- 0:03:00
      104500 -- (-1679.404) (-1678.433) (-1673.664) [-1674.030] * (-1686.136) (-1682.105) [-1675.253] (-1685.273) -- 0:02:59
      105000 -- (-1679.716) (-1680.206) (-1675.535) [-1672.396] * [-1674.741] (-1676.370) (-1677.616) (-1686.656) -- 0:02:59

      Average standard deviation of split frequencies: 0.017048

      105500 -- (-1676.766) (-1684.471) [-1673.226] (-1678.644) * [-1681.245] (-1685.527) (-1679.640) (-1686.895) -- 0:02:58
      106000 -- [-1680.591] (-1679.586) (-1685.263) (-1674.916) * (-1687.136) (-1679.686) [-1682.791] (-1690.771) -- 0:02:57
      106500 -- (-1681.522) [-1684.140] (-1683.972) (-1676.572) * (-1686.397) (-1679.904) (-1684.607) [-1678.926] -- 0:02:56
      107000 -- (-1678.951) (-1685.115) (-1677.538) [-1679.970] * (-1676.971) (-1676.813) [-1687.838] (-1681.403) -- 0:02:55
      107500 -- (-1680.168) [-1678.791] (-1676.901) (-1686.428) * (-1682.469) (-1676.899) [-1671.973] (-1683.336) -- 0:02:54
      108000 -- (-1675.981) (-1679.618) [-1678.387] (-1685.209) * (-1680.264) (-1678.597) (-1680.837) [-1679.602] -- 0:02:53
      108500 -- (-1676.688) (-1678.463) [-1684.712] (-1680.126) * (-1690.256) (-1687.763) [-1674.240] (-1680.962) -- 0:02:52
      109000 -- [-1680.459] (-1683.430) (-1680.405) (-1681.577) * (-1683.384) (-1686.309) [-1674.763] (-1687.003) -- 0:02:59
      109500 -- (-1675.457) [-1680.362] (-1686.280) (-1681.166) * [-1681.341] (-1679.923) (-1676.597) (-1682.254) -- 0:02:58
      110000 -- [-1676.027] (-1680.899) (-1676.826) (-1671.861) * [-1680.525] (-1676.012) (-1684.468) (-1678.811) -- 0:02:58

      Average standard deviation of split frequencies: 0.022008

      110500 -- (-1684.242) (-1676.682) (-1676.253) [-1672.541] * (-1686.172) (-1683.877) [-1678.611] (-1684.292) -- 0:02:57
      111000 -- (-1679.895) (-1678.712) (-1685.816) [-1670.980] * (-1680.291) (-1684.875) [-1676.707] (-1681.720) -- 0:02:56
      111500 -- [-1671.672] (-1684.599) (-1681.133) (-1673.799) * (-1685.128) (-1681.240) [-1680.307] (-1682.808) -- 0:02:55
      112000 -- (-1682.881) (-1685.367) (-1673.034) [-1677.004] * (-1679.551) (-1679.498) (-1675.524) [-1674.520] -- 0:02:54
      112500 -- (-1683.988) [-1675.630] (-1676.602) (-1685.635) * (-1689.356) (-1680.466) [-1669.776] (-1681.365) -- 0:02:53
      113000 -- (-1677.099) [-1672.595] (-1677.004) (-1675.896) * (-1678.641) [-1678.879] (-1676.274) (-1680.873) -- 0:02:52
      113500 -- (-1683.289) (-1674.663) (-1674.744) [-1672.393] * (-1673.262) (-1675.799) (-1677.979) [-1677.645] -- 0:02:51
      114000 -- [-1680.816] (-1676.705) (-1676.795) (-1676.822) * (-1689.024) (-1682.800) [-1674.719] (-1675.089) -- 0:02:58
      114500 -- (-1676.732) (-1675.476) (-1679.920) [-1672.030] * (-1688.656) [-1674.947] (-1680.174) (-1679.844) -- 0:02:57
      115000 -- (-1678.599) [-1676.594] (-1675.964) (-1678.157) * (-1672.369) [-1675.317] (-1682.100) (-1684.681) -- 0:02:57

      Average standard deviation of split frequencies: 0.019642

      115500 -- (-1677.323) (-1680.242) [-1674.376] (-1684.115) * (-1679.290) (-1676.410) (-1676.140) [-1677.197] -- 0:02:56
      116000 -- (-1678.715) [-1688.315] (-1686.543) (-1681.023) * [-1673.767] (-1682.986) (-1677.262) (-1677.559) -- 0:02:55
      116500 -- (-1679.294) (-1680.377) [-1679.285] (-1684.168) * (-1680.831) (-1681.548) [-1677.629] (-1678.091) -- 0:02:54
      117000 -- (-1681.444) (-1685.169) [-1676.034] (-1682.441) * (-1683.155) (-1673.486) (-1679.191) [-1675.779] -- 0:02:53
      117500 -- (-1679.752) (-1672.231) [-1677.029] (-1679.685) * (-1671.179) (-1681.073) (-1685.014) [-1677.179] -- 0:02:52
      118000 -- (-1684.757) (-1680.046) [-1677.639] (-1687.627) * [-1683.150] (-1673.699) (-1674.732) (-1678.797) -- 0:02:51
      118500 -- (-1678.166) (-1680.278) (-1674.340) [-1680.155] * (-1679.479) (-1677.441) (-1681.811) [-1677.380] -- 0:02:51
      119000 -- (-1679.650) [-1676.270] (-1673.524) (-1679.848) * (-1674.239) (-1679.999) (-1674.235) [-1677.779] -- 0:02:57
      119500 -- (-1682.795) [-1684.301] (-1682.763) (-1682.167) * (-1673.395) (-1679.167) [-1671.109] (-1676.385) -- 0:02:56
      120000 -- (-1675.334) (-1677.866) [-1674.210] (-1685.907) * (-1679.959) (-1676.525) (-1680.099) [-1684.293] -- 0:02:56

      Average standard deviation of split frequencies: 0.017580

      120500 -- (-1678.313) [-1678.167] (-1679.571) (-1681.430) * (-1680.848) [-1684.899] (-1684.815) (-1677.546) -- 0:02:55
      121000 -- (-1671.199) [-1671.880] (-1677.840) (-1685.174) * (-1677.982) (-1684.384) [-1674.589] (-1675.940) -- 0:02:54
      121500 -- (-1680.383) [-1673.302] (-1685.301) (-1677.942) * [-1679.577] (-1680.740) (-1676.651) (-1679.172) -- 0:02:53
      122000 -- (-1683.163) (-1682.739) [-1681.171] (-1676.248) * (-1674.924) (-1683.272) [-1679.017] (-1683.877) -- 0:02:52
      122500 -- (-1675.072) [-1675.044] (-1684.388) (-1680.737) * (-1692.160) (-1679.581) (-1675.793) [-1675.179] -- 0:02:51
      123000 -- [-1678.388] (-1683.628) (-1683.906) (-1679.449) * (-1679.119) (-1677.527) [-1678.685] (-1677.389) -- 0:02:51
      123500 -- (-1673.472) [-1672.479] (-1679.038) (-1679.756) * [-1677.488] (-1689.499) (-1672.144) (-1683.352) -- 0:02:50
      124000 -- (-1682.230) (-1674.218) [-1675.325] (-1677.124) * (-1679.675) (-1684.190) [-1676.829] (-1675.749) -- 0:02:56
      124500 -- (-1686.309) (-1678.616) (-1676.208) [-1678.735] * (-1677.657) (-1677.104) [-1670.995] (-1677.879) -- 0:02:55
      125000 -- (-1680.951) [-1677.567] (-1675.321) (-1689.840) * (-1677.264) [-1677.934] (-1675.888) (-1677.931) -- 0:02:55

      Average standard deviation of split frequencies: 0.018707

      125500 -- (-1674.684) [-1674.952] (-1677.425) (-1693.827) * (-1682.052) (-1680.304) (-1672.865) [-1677.202] -- 0:02:54
      126000 -- (-1680.664) (-1674.650) (-1692.420) [-1687.018] * (-1679.209) (-1682.863) (-1685.528) [-1684.889] -- 0:02:53
      126500 -- (-1683.345) (-1687.416) (-1682.199) [-1671.920] * (-1677.658) [-1678.268] (-1680.912) (-1680.881) -- 0:02:52
      127000 -- [-1679.050] (-1682.068) (-1675.335) (-1675.231) * [-1680.467] (-1678.813) (-1671.755) (-1680.330) -- 0:02:51
      127500 -- (-1680.151) (-1683.693) (-1679.211) [-1674.928] * [-1684.246] (-1691.944) (-1680.005) (-1690.115) -- 0:02:51
      128000 -- (-1687.096) (-1679.094) (-1680.809) [-1677.587] * [-1684.731] (-1678.010) (-1683.763) (-1685.810) -- 0:02:50
      128500 -- (-1676.917) [-1674.690] (-1674.045) (-1679.933) * (-1676.612) [-1673.100] (-1675.587) (-1688.739) -- 0:02:49
      129000 -- [-1681.639] (-1680.425) (-1679.409) (-1674.062) * (-1684.006) [-1673.180] (-1676.191) (-1680.765) -- 0:02:55
      129500 -- (-1679.919) (-1684.102) [-1678.470] (-1675.459) * (-1675.349) [-1679.177] (-1676.215) (-1683.080) -- 0:02:54
      130000 -- (-1682.020) (-1689.798) [-1679.207] (-1683.108) * (-1681.327) (-1680.037) [-1674.667] (-1677.519) -- 0:02:54

      Average standard deviation of split frequencies: 0.016836

      130500 -- [-1678.696] (-1677.248) (-1675.993) (-1680.859) * (-1681.369) (-1681.236) [-1676.674] (-1678.723) -- 0:02:53
      131000 -- (-1681.199) (-1673.646) (-1673.868) [-1680.823] * (-1676.435) [-1671.923] (-1680.845) (-1676.415) -- 0:02:52
      131500 -- (-1692.052) (-1678.510) [-1673.361] (-1687.452) * (-1676.729) (-1683.016) [-1678.225] (-1679.705) -- 0:02:51
      132000 -- [-1674.406] (-1677.342) (-1678.740) (-1678.450) * (-1677.717) [-1674.823] (-1684.064) (-1677.224) -- 0:02:50
      132500 -- (-1677.548) [-1677.965] (-1678.779) (-1677.644) * (-1674.772) [-1672.625] (-1682.476) (-1682.990) -- 0:02:50
      133000 -- (-1678.614) (-1674.959) [-1673.917] (-1681.189) * [-1677.522] (-1686.835) (-1690.591) (-1678.843) -- 0:02:49
      133500 -- (-1681.701) [-1673.552] (-1679.797) (-1681.656) * (-1680.583) [-1676.059] (-1688.994) (-1678.918) -- 0:02:48
      134000 -- (-1679.849) (-1682.447) [-1682.141] (-1681.095) * (-1676.070) (-1675.536) (-1677.951) [-1677.480] -- 0:02:54
      134500 -- (-1674.906) (-1678.311) (-1676.921) [-1680.609] * [-1676.152] (-1678.669) (-1670.192) (-1676.168) -- 0:02:53
      135000 -- (-1678.919) (-1678.436) (-1696.612) [-1676.984] * [-1677.321] (-1680.805) (-1677.043) (-1673.615) -- 0:02:53

      Average standard deviation of split frequencies: 0.013865

      135500 -- [-1673.552] (-1674.764) (-1678.956) (-1686.505) * (-1682.305) (-1691.820) (-1677.939) [-1672.497] -- 0:02:52
      136000 -- (-1678.101) [-1679.929] (-1672.509) (-1685.050) * (-1677.470) [-1677.440] (-1681.520) (-1671.109) -- 0:02:51
      136500 -- (-1673.927) (-1678.227) (-1680.108) [-1687.737] * (-1687.450) [-1677.100] (-1691.708) (-1671.216) -- 0:02:50
      137000 -- (-1682.237) (-1677.426) (-1681.460) [-1679.594] * (-1679.839) (-1673.594) [-1676.124] (-1674.989) -- 0:02:50
      137500 -- [-1678.813] (-1680.336) (-1685.318) (-1695.076) * (-1679.654) [-1672.171] (-1681.797) (-1674.943) -- 0:02:49
      138000 -- (-1674.729) [-1676.879] (-1676.085) (-1677.682) * (-1672.174) (-1672.518) [-1677.379] (-1686.470) -- 0:02:48
      138500 -- (-1678.097) (-1675.392) (-1688.413) [-1675.860] * (-1680.972) (-1677.898) [-1671.786] (-1681.203) -- 0:02:47
      139000 -- [-1678.495] (-1675.703) (-1684.109) (-1682.854) * (-1692.114) (-1693.921) (-1673.084) [-1678.177] -- 0:02:53
      139500 -- [-1675.945] (-1678.313) (-1677.887) (-1689.117) * (-1687.054) (-1676.529) (-1682.890) [-1678.168] -- 0:02:52
      140000 -- (-1677.995) (-1682.739) [-1678.704] (-1674.063) * (-1681.879) (-1677.815) [-1676.613] (-1680.600) -- 0:02:52

      Average standard deviation of split frequencies: 0.013405

      140500 -- [-1674.100] (-1686.253) (-1681.134) (-1673.735) * (-1680.163) (-1684.751) [-1674.807] (-1679.815) -- 0:02:51
      141000 -- (-1675.548) (-1682.571) (-1682.146) [-1673.329] * [-1675.062] (-1681.192) (-1680.869) (-1673.709) -- 0:02:50
      141500 -- [-1674.561] (-1674.264) (-1677.335) (-1678.075) * (-1685.280) (-1674.628) (-1676.841) [-1674.296] -- 0:02:49
      142000 -- [-1678.511] (-1674.844) (-1689.791) (-1679.853) * [-1675.020] (-1680.579) (-1680.156) (-1686.613) -- 0:02:49
      142500 -- (-1680.843) (-1678.337) (-1686.946) [-1672.399] * (-1683.523) [-1672.458] (-1686.223) (-1679.969) -- 0:02:48
      143000 -- (-1681.349) (-1679.544) [-1679.746] (-1677.609) * (-1681.415) [-1673.970] (-1675.015) (-1679.075) -- 0:02:47
      143500 -- (-1686.634) [-1682.777] (-1683.712) (-1683.711) * (-1679.310) (-1679.530) [-1674.241] (-1675.999) -- 0:02:47
      144000 -- (-1685.731) (-1697.644) (-1678.807) [-1675.037] * [-1681.206] (-1680.055) (-1678.667) (-1676.020) -- 0:02:52
      144500 -- (-1673.548) [-1682.385] (-1676.292) (-1680.360) * (-1678.044) (-1682.235) (-1675.148) [-1678.772] -- 0:02:51
      145000 -- [-1676.543] (-1682.781) (-1678.346) (-1673.162) * (-1678.821) (-1677.592) [-1679.924] (-1680.998) -- 0:02:51

      Average standard deviation of split frequencies: 0.012915

      145500 -- (-1679.939) (-1685.533) [-1676.791] (-1677.111) * [-1675.187] (-1681.592) (-1673.990) (-1671.414) -- 0:02:50
      146000 -- (-1676.672) (-1683.903) [-1678.548] (-1675.225) * (-1673.339) (-1676.712) (-1676.634) [-1678.720] -- 0:02:49
      146500 -- [-1674.617] (-1682.768) (-1678.652) (-1680.280) * (-1673.552) [-1683.334] (-1680.759) (-1674.130) -- 0:02:48
      147000 -- [-1674.580] (-1679.915) (-1683.938) (-1680.469) * [-1674.698] (-1679.874) (-1679.249) (-1681.532) -- 0:02:48
      147500 -- (-1670.803) (-1677.319) (-1679.484) [-1679.155] * (-1676.435) (-1673.430) [-1677.592] (-1678.270) -- 0:02:47
      148000 -- (-1673.008) (-1686.826) (-1679.973) [-1683.798] * (-1681.826) (-1681.110) [-1682.600] (-1688.298) -- 0:02:46
      148500 -- [-1682.569] (-1686.365) (-1674.495) (-1679.094) * (-1673.716) [-1680.317] (-1677.401) (-1679.861) -- 0:02:46
      149000 -- (-1683.303) (-1674.106) (-1680.659) [-1675.698] * [-1676.922] (-1685.225) (-1684.195) (-1677.475) -- 0:02:51
      149500 -- (-1679.658) (-1688.099) (-1686.365) [-1680.570] * (-1686.216) [-1681.625] (-1673.732) (-1679.186) -- 0:02:50
      150000 -- (-1673.846) [-1670.285] (-1683.875) (-1684.042) * (-1678.885) [-1675.033] (-1677.132) (-1682.267) -- 0:02:50

      Average standard deviation of split frequencies: 0.013558

      150500 -- [-1673.671] (-1682.234) (-1678.575) (-1684.013) * (-1675.609) [-1683.277] (-1680.769) (-1675.905) -- 0:02:49
      151000 -- (-1679.604) [-1676.692] (-1675.283) (-1673.032) * (-1676.275) (-1698.313) [-1673.254] (-1672.979) -- 0:02:48
      151500 -- [-1681.411] (-1674.421) (-1674.559) (-1678.891) * [-1687.200] (-1680.490) (-1680.694) (-1690.961) -- 0:02:48
      152000 -- [-1679.697] (-1678.487) (-1677.321) (-1675.706) * [-1674.088] (-1682.980) (-1685.796) (-1687.660) -- 0:02:47
      152500 -- (-1679.274) (-1695.466) [-1676.065] (-1678.877) * (-1685.398) [-1686.791] (-1688.141) (-1677.351) -- 0:02:46
      153000 -- (-1677.757) (-1682.238) [-1680.776] (-1686.437) * (-1677.525) (-1682.949) [-1674.018] (-1679.920) -- 0:02:46
      153500 -- (-1683.518) (-1681.535) [-1672.446] (-1676.018) * [-1672.728] (-1675.903) (-1676.336) (-1677.790) -- 0:02:45
      154000 -- (-1687.360) [-1678.504] (-1675.749) (-1671.577) * (-1672.615) [-1677.673] (-1675.704) (-1682.618) -- 0:02:50
      154500 -- (-1682.507) [-1678.211] (-1684.351) (-1677.770) * [-1677.075] (-1686.636) (-1679.650) (-1677.719) -- 0:02:49
      155000 -- (-1684.860) (-1672.038) [-1675.285] (-1678.588) * (-1674.577) (-1688.386) (-1682.900) [-1677.354] -- 0:02:49

      Average standard deviation of split frequencies: 0.014102

      155500 -- (-1685.846) [-1677.703] (-1677.037) (-1674.583) * (-1676.266) [-1678.014] (-1683.513) (-1687.444) -- 0:02:48
      156000 -- (-1676.908) (-1676.670) (-1679.465) [-1677.831] * (-1674.136) [-1678.595] (-1675.302) (-1678.322) -- 0:02:47
      156500 -- (-1677.434) (-1677.774) (-1676.558) [-1680.862] * (-1684.136) [-1672.355] (-1676.494) (-1681.092) -- 0:02:47
      157000 -- (-1677.211) [-1682.154] (-1676.143) (-1687.802) * (-1686.598) [-1677.817] (-1677.038) (-1685.082) -- 0:02:46
      157500 -- (-1678.735) (-1676.295) [-1676.461] (-1688.415) * (-1676.876) [-1675.709] (-1678.012) (-1673.392) -- 0:02:45
      158000 -- (-1680.752) [-1674.295] (-1681.706) (-1689.920) * (-1682.562) (-1684.460) [-1675.338] (-1675.728) -- 0:02:45
      158500 -- [-1678.214] (-1673.244) (-1676.738) (-1684.533) * (-1678.718) (-1688.042) (-1677.645) [-1679.103] -- 0:02:44
      159000 -- [-1679.579] (-1676.617) (-1688.432) (-1689.212) * (-1690.929) (-1671.046) [-1677.521] (-1674.348) -- 0:02:49
      159500 -- (-1679.593) [-1682.493] (-1675.598) (-1678.880) * [-1677.555] (-1678.719) (-1678.507) (-1673.348) -- 0:02:48
      160000 -- (-1682.723) (-1679.696) (-1681.674) [-1681.433] * (-1684.013) (-1676.083) (-1680.523) [-1677.526] -- 0:02:48

      Average standard deviation of split frequencies: 0.013203

      160500 -- (-1675.650) (-1682.279) [-1681.805] (-1674.457) * (-1674.593) (-1673.080) (-1675.916) [-1672.805] -- 0:02:47
      161000 -- [-1676.316] (-1678.508) (-1677.777) (-1673.328) * (-1679.296) (-1677.524) [-1673.658] (-1684.644) -- 0:02:46
      161500 -- (-1673.398) (-1681.066) (-1677.316) [-1675.393] * (-1679.547) (-1677.275) [-1679.174] (-1677.006) -- 0:02:46
      162000 -- (-1676.980) (-1688.588) (-1677.118) [-1680.932] * (-1679.022) (-1684.080) [-1673.843] (-1675.793) -- 0:02:45
      162500 -- (-1682.111) (-1683.926) (-1671.775) [-1671.113] * (-1684.834) [-1676.559] (-1681.229) (-1677.397) -- 0:02:44
      163000 -- (-1674.348) (-1677.261) (-1675.793) [-1673.290] * (-1682.057) (-1678.020) (-1679.610) [-1672.101] -- 0:02:44
      163500 -- (-1672.393) (-1676.976) [-1675.934] (-1678.102) * (-1685.131) [-1671.018] (-1687.943) (-1676.619) -- 0:02:43
      164000 -- [-1677.707] (-1678.163) (-1681.928) (-1678.086) * (-1679.936) (-1682.004) (-1675.168) [-1678.869] -- 0:02:48
      164500 -- (-1681.176) (-1675.588) (-1671.456) [-1677.438] * (-1679.375) (-1675.689) [-1675.468] (-1679.538) -- 0:02:47
      165000 -- [-1677.095] (-1685.733) (-1677.002) (-1694.113) * (-1682.243) (-1676.208) (-1672.508) [-1674.331] -- 0:02:47

      Average standard deviation of split frequencies: 0.010886

      165500 -- (-1676.387) (-1683.686) [-1675.743] (-1675.960) * (-1681.300) (-1678.495) [-1679.965] (-1674.115) -- 0:02:46
      166000 -- (-1677.672) (-1677.991) [-1674.979] (-1686.185) * (-1681.752) (-1680.307) (-1674.434) [-1679.908] -- 0:02:45
      166500 -- (-1680.801) (-1677.960) (-1682.155) [-1679.092] * (-1687.913) [-1681.629] (-1674.805) (-1677.315) -- 0:02:45
      167000 -- [-1676.712] (-1685.883) (-1679.135) (-1678.342) * [-1679.475] (-1673.651) (-1680.785) (-1676.638) -- 0:02:44
      167500 -- (-1685.887) [-1676.991] (-1678.607) (-1675.810) * (-1683.977) [-1679.255] (-1684.229) (-1678.417) -- 0:02:44
      168000 -- (-1679.059) [-1683.225] (-1682.392) (-1677.945) * (-1683.861) [-1677.929] (-1680.732) (-1677.526) -- 0:02:43
      168500 -- [-1672.931] (-1679.721) (-1685.021) (-1688.900) * [-1673.450] (-1675.645) (-1681.077) (-1675.200) -- 0:02:42
      169000 -- (-1681.712) (-1677.522) [-1681.259] (-1684.667) * (-1685.038) [-1672.719] (-1678.278) (-1688.205) -- 0:02:47
      169500 -- (-1676.347) [-1678.565] (-1684.068) (-1680.870) * (-1680.302) (-1678.108) (-1676.651) [-1678.300] -- 0:02:46
      170000 -- [-1676.895] (-1683.212) (-1675.482) (-1671.260) * (-1678.336) [-1680.261] (-1676.989) (-1677.690) -- 0:02:46

      Average standard deviation of split frequencies: 0.011509

      170500 -- (-1673.383) (-1677.039) [-1686.992] (-1675.014) * (-1681.566) [-1677.886] (-1684.164) (-1672.572) -- 0:02:45
      171000 -- [-1670.491] (-1686.818) (-1684.815) (-1675.923) * [-1683.767] (-1683.487) (-1677.704) (-1677.168) -- 0:02:44
      171500 -- (-1679.704) [-1679.158] (-1681.379) (-1675.246) * (-1683.698) (-1675.871) (-1678.304) [-1672.945] -- 0:02:44
      172000 -- [-1677.158] (-1677.940) (-1675.873) (-1676.848) * (-1682.815) (-1671.956) [-1671.814] (-1675.382) -- 0:02:43
      172500 -- (-1684.688) (-1689.409) (-1678.518) [-1682.305] * [-1675.353] (-1675.967) (-1689.355) (-1683.068) -- 0:02:43
      173000 -- [-1675.561] (-1682.148) (-1676.699) (-1682.301) * (-1678.635) [-1672.428] (-1680.987) (-1678.483) -- 0:02:42
      173500 -- (-1673.816) (-1680.155) [-1675.863] (-1682.252) * (-1682.150) [-1673.106] (-1685.835) (-1674.384) -- 0:02:41
      174000 -- (-1686.939) (-1676.061) (-1684.430) [-1678.545] * (-1682.555) (-1671.700) (-1677.035) [-1675.318] -- 0:02:46
      174500 -- [-1676.375] (-1683.329) (-1681.124) (-1680.418) * (-1681.373) [-1675.711] (-1671.073) (-1676.055) -- 0:02:45
      175000 -- (-1678.008) (-1674.822) (-1683.044) [-1682.640] * (-1685.690) [-1674.650] (-1679.186) (-1676.996) -- 0:02:45

      Average standard deviation of split frequencies: 0.011160

      175500 -- (-1684.578) (-1680.524) (-1678.226) [-1687.429] * (-1688.883) (-1680.204) (-1680.730) [-1675.435] -- 0:02:44
      176000 -- (-1677.849) [-1673.874] (-1686.012) (-1678.810) * (-1685.363) (-1677.680) (-1675.088) [-1688.155] -- 0:02:43
      176500 -- (-1683.660) [-1680.416] (-1682.985) (-1673.837) * (-1683.808) [-1679.724] (-1676.332) (-1680.893) -- 0:02:43
      177000 -- (-1679.430) [-1672.064] (-1674.051) (-1678.062) * (-1678.487) (-1681.729) [-1678.849] (-1686.381) -- 0:02:42
      177500 -- (-1684.348) [-1675.374] (-1674.768) (-1679.444) * [-1676.424] (-1678.164) (-1679.341) (-1673.922) -- 0:02:42
      178000 -- (-1685.632) (-1677.693) (-1680.133) [-1675.083] * (-1678.018) (-1678.644) (-1673.486) [-1673.039] -- 0:02:41
      178500 -- (-1688.145) (-1681.114) [-1675.016] (-1677.385) * (-1676.491) (-1677.013) [-1672.936] (-1672.927) -- 0:02:41
      179000 -- (-1685.384) (-1677.653) (-1673.399) [-1674.563] * (-1678.331) (-1682.901) [-1676.585] (-1680.976) -- 0:02:45
      179500 -- (-1684.526) (-1683.001) [-1671.697] (-1674.349) * (-1681.784) [-1679.390] (-1673.985) (-1682.757) -- 0:02:44
      180000 -- (-1678.156) (-1674.925) (-1674.605) [-1677.470] * (-1676.886) (-1673.954) [-1676.371] (-1684.229) -- 0:02:44

      Average standard deviation of split frequencies: 0.010002

      180500 -- [-1672.383] (-1677.597) (-1677.503) (-1678.395) * (-1676.007) [-1674.515] (-1678.910) (-1676.212) -- 0:02:43
      181000 -- (-1681.419) (-1677.320) [-1671.724] (-1688.408) * (-1686.306) (-1678.779) (-1675.242) [-1672.925] -- 0:02:42
      181500 -- (-1681.591) (-1688.750) [-1673.931] (-1684.649) * (-1679.223) (-1676.671) (-1674.378) [-1681.762] -- 0:02:42
      182000 -- (-1677.871) (-1674.605) (-1674.205) [-1676.406] * (-1685.355) [-1673.936] (-1676.056) (-1680.606) -- 0:02:41
      182500 -- (-1676.385) [-1678.885] (-1677.681) (-1685.987) * (-1682.382) [-1674.451] (-1685.140) (-1679.013) -- 0:02:41
      183000 -- (-1677.890) [-1679.966] (-1675.831) (-1673.672) * (-1681.767) (-1678.500) (-1683.484) [-1681.736] -- 0:02:40
      183500 -- (-1680.224) [-1680.540] (-1673.136) (-1681.989) * (-1677.542) (-1689.207) [-1673.570] (-1680.469) -- 0:02:44
      184000 -- (-1675.931) [-1682.091] (-1686.926) (-1677.710) * (-1680.329) [-1676.954] (-1673.246) (-1680.264) -- 0:02:44
      184500 -- (-1676.312) (-1685.152) [-1677.414] (-1681.012) * [-1672.983] (-1679.103) (-1675.663) (-1674.440) -- 0:02:43
      185000 -- (-1677.610) (-1675.699) [-1672.369] (-1680.597) * (-1681.253) (-1680.231) [-1673.172] (-1686.752) -- 0:02:43

      Average standard deviation of split frequencies: 0.009715

      185500 -- (-1675.069) (-1683.847) [-1674.535] (-1680.209) * (-1676.655) (-1683.796) (-1674.296) [-1672.934] -- 0:02:42
      186000 -- [-1678.457] (-1693.798) (-1674.634) (-1685.790) * (-1682.602) (-1678.435) [-1683.188] (-1678.547) -- 0:02:41
      186500 -- (-1680.528) [-1672.980] (-1685.396) (-1678.618) * [-1675.420] (-1679.496) (-1679.592) (-1679.659) -- 0:02:41
      187000 -- [-1684.604] (-1678.440) (-1678.941) (-1689.128) * (-1675.903) [-1683.696] (-1674.086) (-1672.327) -- 0:02:40
      187500 -- (-1677.804) [-1679.168] (-1689.832) (-1683.237) * (-1676.942) (-1679.641) [-1674.226] (-1689.714) -- 0:02:40
      188000 -- (-1683.955) [-1680.271] (-1681.787) (-1669.067) * (-1685.533) [-1674.783] (-1676.879) (-1683.178) -- 0:02:39
      188500 -- (-1677.886) (-1684.389) (-1683.899) [-1686.316] * (-1684.557) (-1680.388) (-1679.698) [-1675.041] -- 0:02:39
      189000 -- (-1674.135) [-1675.570] (-1676.865) (-1682.445) * (-1677.127) [-1674.833] (-1686.362) (-1676.715) -- 0:02:43
      189500 -- [-1678.315] (-1678.884) (-1684.129) (-1678.980) * [-1674.076] (-1679.843) (-1679.806) (-1677.605) -- 0:02:42
      190000 -- (-1677.879) (-1679.341) [-1677.808] (-1684.923) * [-1677.158] (-1678.082) (-1681.433) (-1684.153) -- 0:02:42

      Average standard deviation of split frequencies: 0.011950

      190500 -- [-1683.067] (-1676.500) (-1685.793) (-1681.772) * [-1679.083] (-1676.104) (-1685.858) (-1677.631) -- 0:02:41
      191000 -- (-1677.773) (-1678.248) [-1678.493] (-1675.957) * (-1677.890) (-1679.560) (-1676.710) [-1679.066] -- 0:02:40
      191500 -- (-1681.953) [-1676.976] (-1685.842) (-1675.660) * (-1674.484) (-1675.350) (-1677.606) [-1676.181] -- 0:02:40
      192000 -- (-1672.358) [-1672.719] (-1680.994) (-1675.846) * (-1675.569) [-1673.803] (-1682.569) (-1674.595) -- 0:02:39
      192500 -- [-1670.694] (-1682.205) (-1680.354) (-1676.967) * [-1671.708] (-1673.578) (-1681.333) (-1674.857) -- 0:02:39
      193000 -- [-1674.030] (-1683.298) (-1679.044) (-1675.587) * (-1671.976) (-1682.712) [-1679.715] (-1681.026) -- 0:02:38
      193500 -- (-1674.909) [-1682.256] (-1681.800) (-1678.555) * (-1675.241) [-1676.503] (-1686.775) (-1677.365) -- 0:02:42
      194000 -- (-1676.966) (-1679.488) (-1685.954) [-1674.908] * [-1671.153] (-1685.811) (-1675.989) (-1679.157) -- 0:02:42
      194500 -- [-1673.646] (-1674.904) (-1674.691) (-1686.411) * (-1675.814) [-1678.225] (-1675.998) (-1682.633) -- 0:02:41
      195000 -- (-1678.370) [-1676.766] (-1678.232) (-1678.546) * (-1673.200) [-1679.164] (-1679.722) (-1681.161) -- 0:02:41

      Average standard deviation of split frequencies: 0.012426

      195500 -- (-1676.020) [-1675.458] (-1677.429) (-1684.612) * (-1677.128) (-1677.769) (-1684.905) [-1685.175] -- 0:02:40
      196000 -- (-1674.891) (-1679.483) [-1678.442] (-1684.891) * (-1681.069) (-1674.931) [-1677.054] (-1675.216) -- 0:02:39
      196500 -- (-1677.677) (-1680.458) (-1678.195) [-1677.374] * (-1681.512) (-1674.242) (-1676.138) [-1679.503] -- 0:02:39
      197000 -- (-1685.974) (-1676.131) (-1681.853) [-1681.512] * [-1672.924] (-1678.367) (-1688.139) (-1691.173) -- 0:02:38
      197500 -- (-1682.263) [-1675.906] (-1679.375) (-1674.353) * [-1679.836] (-1681.998) (-1683.107) (-1678.773) -- 0:02:38
      198000 -- (-1682.115) (-1680.388) (-1695.989) [-1672.221] * [-1672.332] (-1675.565) (-1675.093) (-1680.717) -- 0:02:37
      198500 -- (-1676.033) (-1671.867) (-1683.677) [-1676.707] * (-1680.786) (-1675.333) [-1677.903] (-1681.502) -- 0:02:41
      199000 -- (-1674.023) [-1675.174] (-1689.093) (-1678.759) * (-1674.559) (-1679.781) [-1676.700] (-1684.514) -- 0:02:41
      199500 -- (-1678.781) (-1672.280) (-1684.203) [-1673.740] * (-1682.654) [-1672.557] (-1678.895) (-1685.511) -- 0:02:40
      200000 -- [-1686.105] (-1674.123) (-1676.331) (-1683.077) * (-1680.851) (-1674.422) (-1681.941) [-1679.944] -- 0:02:40

      Average standard deviation of split frequencies: 0.012921

      200500 -- [-1686.328] (-1684.004) (-1686.932) (-1669.808) * (-1688.049) (-1672.176) [-1675.713] (-1673.228) -- 0:02:39
      201000 -- (-1682.187) [-1677.477] (-1677.722) (-1677.020) * (-1681.288) [-1674.988] (-1682.196) (-1675.277) -- 0:02:39
      201500 -- [-1676.834] (-1683.585) (-1678.755) (-1686.536) * (-1677.971) (-1682.497) [-1689.999] (-1671.983) -- 0:02:38
      202000 -- (-1676.747) (-1676.627) [-1686.205] (-1672.261) * [-1681.703] (-1675.263) (-1683.147) (-1678.084) -- 0:02:38
      202500 -- (-1686.749) (-1670.582) [-1674.228] (-1679.119) * (-1681.602) (-1685.121) [-1681.560] (-1677.451) -- 0:02:37
      203000 -- [-1680.161] (-1675.579) (-1687.258) (-1684.443) * (-1681.666) (-1690.030) (-1677.432) [-1676.538] -- 0:02:37
      203500 -- (-1678.558) (-1674.002) [-1670.778] (-1681.882) * (-1674.770) [-1675.612] (-1681.274) (-1681.374) -- 0:02:40
      204000 -- (-1674.039) [-1677.577] (-1679.119) (-1683.001) * (-1674.844) [-1675.742] (-1675.925) (-1674.079) -- 0:02:39
      204500 -- [-1670.473] (-1687.248) (-1689.893) (-1671.692) * [-1682.781] (-1679.787) (-1675.086) (-1678.735) -- 0:02:39
      205000 -- (-1675.716) (-1678.856) (-1676.023) [-1668.232] * [-1675.967] (-1680.952) (-1682.645) (-1676.974) -- 0:02:39

      Average standard deviation of split frequencies: 0.013349

      205500 -- [-1676.015] (-1676.634) (-1677.354) (-1675.163) * (-1672.906) (-1677.071) [-1675.237] (-1679.472) -- 0:02:38
      206000 -- (-1681.139) (-1685.054) (-1678.023) [-1672.337] * (-1685.399) (-1674.751) (-1671.430) [-1672.656] -- 0:02:38
      206500 -- (-1677.526) [-1682.174] (-1681.544) (-1676.022) * (-1684.097) (-1676.053) [-1676.604] (-1678.677) -- 0:02:37
      207000 -- (-1677.117) (-1680.578) [-1674.850] (-1680.248) * (-1675.581) [-1675.816] (-1677.198) (-1673.159) -- 0:02:37
      207500 -- (-1676.574) (-1675.094) (-1683.238) [-1675.548] * [-1681.990] (-1686.250) (-1675.915) (-1678.677) -- 0:02:36
      208000 -- (-1680.139) (-1678.292) (-1677.432) [-1677.014] * (-1680.866) [-1679.744] (-1679.344) (-1679.458) -- 0:02:36
      208500 -- (-1681.714) (-1677.358) [-1680.137] (-1693.121) * (-1677.956) (-1677.715) [-1677.010] (-1679.119) -- 0:02:39
      209000 -- (-1677.634) (-1680.815) (-1681.615) [-1680.805] * [-1673.161] (-1678.493) (-1675.271) (-1678.918) -- 0:02:38
      209500 -- (-1685.920) [-1676.425] (-1674.700) (-1674.071) * (-1686.532) [-1674.299] (-1678.387) (-1679.018) -- 0:02:38
      210000 -- (-1684.714) [-1676.205] (-1680.008) (-1677.539) * (-1687.558) [-1675.445] (-1683.147) (-1676.035) -- 0:02:38

      Average standard deviation of split frequencies: 0.011561

      210500 -- [-1683.896] (-1670.587) (-1679.600) (-1680.867) * (-1682.034) [-1678.437] (-1681.723) (-1676.207) -- 0:02:37
      211000 -- (-1688.565) (-1679.908) (-1680.689) [-1683.317] * (-1679.996) [-1679.178] (-1680.265) (-1677.687) -- 0:02:37
      211500 -- (-1685.962) [-1680.962] (-1682.066) (-1671.076) * (-1683.551) [-1671.525] (-1682.240) (-1680.561) -- 0:02:36
      212000 -- (-1683.580) [-1676.947] (-1677.788) (-1675.768) * (-1674.819) (-1674.128) [-1673.786] (-1682.098) -- 0:02:36
      212500 -- (-1680.361) [-1674.750] (-1678.884) (-1676.513) * (-1674.266) (-1682.952) [-1678.570] (-1679.710) -- 0:02:35
      213000 -- [-1677.024] (-1686.672) (-1679.550) (-1676.672) * (-1675.765) [-1682.723] (-1678.500) (-1690.200) -- 0:02:38
      213500 -- (-1680.778) [-1677.303] (-1675.902) (-1679.051) * [-1676.637] (-1679.235) (-1679.783) (-1686.861) -- 0:02:38
      214000 -- (-1687.716) (-1676.826) (-1692.818) [-1683.843] * [-1673.628] (-1679.974) (-1673.780) (-1687.784) -- 0:02:37
      214500 -- (-1674.967) (-1694.547) [-1681.569] (-1685.083) * [-1681.500] (-1679.077) (-1683.284) (-1681.992) -- 0:02:37
      215000 -- (-1682.197) (-1677.612) (-1675.726) [-1677.528] * (-1680.409) (-1672.269) [-1678.963] (-1687.191) -- 0:02:37

      Average standard deviation of split frequencies: 0.011276

      215500 -- (-1675.378) (-1677.246) (-1674.574) [-1676.217] * (-1686.484) [-1677.422] (-1671.205) (-1691.195) -- 0:02:36
      216000 -- (-1687.584) (-1680.612) (-1677.755) [-1677.175] * [-1681.319] (-1681.609) (-1674.396) (-1679.685) -- 0:02:36
      216500 -- (-1679.452) [-1677.356] (-1679.088) (-1677.524) * (-1684.557) (-1683.991) [-1675.722] (-1677.661) -- 0:02:35
      217000 -- (-1687.984) (-1672.273) [-1671.851] (-1680.399) * (-1683.100) [-1673.939] (-1678.893) (-1688.316) -- 0:02:35
      217500 -- (-1679.304) (-1682.390) [-1681.450] (-1677.919) * (-1678.165) (-1677.369) (-1675.223) [-1678.974] -- 0:02:34
      218000 -- (-1677.501) [-1673.578] (-1675.817) (-1685.114) * [-1674.973] (-1675.576) (-1677.688) (-1680.469) -- 0:02:37
      218500 -- (-1679.940) [-1679.651] (-1682.868) (-1670.317) * (-1676.267) [-1678.860] (-1677.136) (-1694.019) -- 0:02:37
      219000 -- (-1683.273) (-1676.688) [-1670.555] (-1679.546) * (-1677.496) [-1673.785] (-1676.220) (-1674.880) -- 0:02:36
      219500 -- (-1685.544) (-1681.456) (-1674.708) [-1675.110] * (-1677.362) (-1683.041) [-1678.056] (-1682.087) -- 0:02:36
      220000 -- [-1671.329] (-1674.197) (-1676.222) (-1677.417) * [-1677.911] (-1681.467) (-1675.686) (-1682.600) -- 0:02:36

      Average standard deviation of split frequencies: 0.011037

      220500 -- (-1676.660) (-1675.624) (-1686.279) [-1677.008] * (-1671.901) (-1686.754) [-1676.685] (-1679.319) -- 0:02:35
      221000 -- (-1675.242) [-1671.729] (-1673.252) (-1678.433) * (-1680.020) (-1679.599) [-1674.675] (-1675.989) -- 0:02:35
      221500 -- [-1681.468] (-1669.975) (-1678.308) (-1672.207) * (-1680.909) (-1680.734) [-1670.834] (-1675.478) -- 0:02:34
      222000 -- (-1685.018) (-1675.549) (-1683.946) [-1673.393] * [-1675.604] (-1677.372) (-1676.820) (-1675.201) -- 0:02:34
      222500 -- (-1683.949) (-1680.028) (-1679.314) [-1670.849] * (-1675.513) (-1676.279) (-1684.192) [-1679.901] -- 0:02:33
      223000 -- (-1682.548) (-1671.955) (-1691.289) [-1676.801] * [-1681.591] (-1681.265) (-1674.822) (-1676.235) -- 0:02:36
      223500 -- [-1675.599] (-1675.923) (-1679.000) (-1675.126) * (-1679.879) (-1685.022) (-1676.364) [-1675.220] -- 0:02:36
      224000 -- [-1678.368] (-1688.136) (-1675.408) (-1677.173) * (-1676.366) (-1677.746) (-1676.735) [-1676.996] -- 0:02:35
      224500 -- (-1680.368) (-1680.642) (-1674.959) [-1681.414] * (-1673.480) [-1677.810] (-1683.567) (-1676.157) -- 0:02:35
      225000 -- (-1679.158) (-1680.476) (-1680.527) [-1679.037] * (-1682.366) (-1688.432) [-1675.914] (-1678.204) -- 0:02:35

      Average standard deviation of split frequencies: 0.011472

      225500 -- (-1677.392) [-1673.643] (-1683.168) (-1675.140) * (-1681.447) (-1681.038) (-1674.268) [-1674.879] -- 0:02:34
      226000 -- (-1678.410) [-1678.275] (-1675.684) (-1678.698) * (-1683.555) (-1675.542) [-1678.339] (-1679.817) -- 0:02:34
      226500 -- (-1680.358) [-1679.314] (-1683.557) (-1679.761) * (-1684.589) [-1674.587] (-1688.083) (-1676.590) -- 0:02:33
      227000 -- (-1675.450) (-1675.758) (-1681.361) [-1679.055] * (-1676.225) (-1677.441) (-1696.045) [-1680.079] -- 0:02:33
      227500 -- (-1683.188) (-1679.044) [-1680.760] (-1678.876) * (-1672.391) [-1673.819] (-1688.036) (-1679.648) -- 0:02:32
      228000 -- [-1675.442] (-1679.892) (-1681.426) (-1676.717) * (-1687.444) (-1676.935) [-1676.869] (-1679.550) -- 0:02:35
      228500 -- (-1678.004) (-1679.539) (-1671.255) [-1679.983] * (-1680.538) [-1679.966] (-1674.149) (-1678.560) -- 0:02:35
      229000 -- (-1681.831) (-1683.324) (-1678.582) [-1685.485] * (-1676.371) (-1680.177) [-1674.114] (-1674.675) -- 0:02:34
      229500 -- (-1676.047) (-1683.006) (-1676.257) [-1674.332] * [-1672.013] (-1683.193) (-1679.666) (-1688.921) -- 0:02:34
      230000 -- (-1679.650) (-1682.033) [-1674.791] (-1680.916) * (-1675.673) (-1685.713) [-1675.908] (-1675.776) -- 0:02:34

      Average standard deviation of split frequencies: 0.011240

      230500 -- (-1682.538) [-1669.728] (-1684.435) (-1677.918) * [-1669.904] (-1680.444) (-1679.153) (-1674.721) -- 0:02:33
      231000 -- [-1678.327] (-1676.694) (-1679.357) (-1683.529) * (-1679.209) [-1677.831] (-1674.162) (-1676.433) -- 0:02:33
      231500 -- (-1681.180) (-1689.050) (-1681.808) [-1684.863] * (-1672.897) (-1678.364) [-1679.066] (-1684.029) -- 0:02:32
      232000 -- (-1682.329) (-1684.471) (-1677.166) [-1676.082] * [-1677.230] (-1683.752) (-1690.514) (-1681.870) -- 0:02:32
      232500 -- [-1675.506] (-1686.575) (-1676.849) (-1679.061) * [-1676.858] (-1691.680) (-1694.125) (-1676.609) -- 0:02:31
      233000 -- (-1675.002) (-1675.558) [-1674.029] (-1677.923) * (-1679.327) [-1672.347] (-1692.373) (-1676.055) -- 0:02:34
      233500 -- (-1678.240) [-1671.693] (-1676.445) (-1674.497) * (-1684.944) (-1672.462) [-1678.701] (-1689.109) -- 0:02:34
      234000 -- (-1677.489) (-1676.450) [-1675.282] (-1683.104) * (-1681.124) (-1680.968) (-1677.998) [-1671.441] -- 0:02:33
      234500 -- (-1678.721) (-1680.365) [-1679.584] (-1673.030) * (-1682.463) (-1677.941) (-1670.115) [-1676.427] -- 0:02:33
      235000 -- [-1673.372] (-1680.965) (-1672.622) (-1676.554) * (-1683.664) (-1684.426) [-1676.837] (-1672.807) -- 0:02:33

      Average standard deviation of split frequencies: 0.008989

      235500 -- [-1673.980] (-1680.929) (-1676.055) (-1674.029) * (-1685.123) (-1680.375) [-1673.386] (-1676.854) -- 0:02:32
      236000 -- (-1678.561) (-1678.597) (-1679.003) [-1674.729] * [-1675.367] (-1679.692) (-1678.732) (-1678.181) -- 0:02:32
      236500 -- (-1683.235) (-1677.113) [-1672.160] (-1677.610) * (-1680.077) (-1676.080) [-1671.750] (-1678.803) -- 0:02:31
      237000 -- (-1686.492) (-1689.167) (-1684.543) [-1679.692] * (-1683.197) (-1679.735) [-1676.494] (-1672.821) -- 0:02:31
      237500 -- (-1687.466) (-1671.508) (-1682.706) [-1675.587] * [-1671.500] (-1676.240) (-1675.788) (-1673.971) -- 0:02:34
      238000 -- (-1684.231) [-1672.517] (-1682.078) (-1677.325) * (-1677.185) (-1676.074) [-1675.549] (-1678.114) -- 0:02:33
      238500 -- (-1687.678) [-1672.352] (-1680.384) (-1681.146) * (-1683.384) (-1672.492) [-1675.437] (-1682.228) -- 0:02:33
      239000 -- (-1683.099) [-1685.315] (-1672.787) (-1691.666) * (-1681.576) (-1684.696) (-1681.789) [-1675.039] -- 0:02:32
      239500 -- (-1681.584) (-1680.315) [-1674.294] (-1675.351) * (-1679.805) (-1674.194) [-1682.612] (-1679.685) -- 0:02:32
      240000 -- [-1677.957] (-1676.230) (-1684.865) (-1684.847) * (-1675.804) [-1676.187] (-1675.521) (-1682.102) -- 0:02:32

      Average standard deviation of split frequencies: 0.008814

      240500 -- [-1678.949] (-1676.721) (-1676.765) (-1674.755) * (-1684.333) (-1676.856) [-1689.646] (-1683.333) -- 0:02:31
      241000 -- (-1679.601) (-1671.926) (-1679.606) [-1674.169] * [-1677.168] (-1685.839) (-1683.180) (-1681.955) -- 0:02:31
      241500 -- (-1687.101) [-1674.271] (-1686.302) (-1679.016) * (-1683.072) [-1679.957] (-1681.759) (-1685.824) -- 0:02:30
      242000 -- (-1683.947) (-1684.318) (-1684.044) [-1675.269] * [-1681.770] (-1678.379) (-1687.649) (-1675.731) -- 0:02:30
      242500 -- [-1677.703] (-1674.170) (-1682.898) (-1676.862) * (-1679.885) (-1675.209) [-1676.646] (-1681.231) -- 0:02:33
      243000 -- [-1681.301] (-1681.587) (-1681.403) (-1670.843) * (-1682.415) [-1675.130] (-1678.705) (-1691.999) -- 0:02:32
      243500 -- [-1679.716] (-1678.535) (-1685.750) (-1682.412) * [-1676.979] (-1677.538) (-1689.441) (-1680.838) -- 0:02:32
      244000 -- (-1690.951) (-1684.596) [-1678.802] (-1690.489) * (-1679.900) (-1676.330) (-1680.691) [-1677.963] -- 0:02:31
      244500 -- (-1673.388) (-1683.414) [-1671.450] (-1681.461) * (-1682.671) (-1676.607) [-1680.880] (-1680.627) -- 0:02:31
      245000 -- [-1680.177] (-1674.375) (-1676.573) (-1683.849) * (-1684.300) [-1678.410] (-1674.592) (-1690.391) -- 0:02:31

      Average standard deviation of split frequencies: 0.008623

      245500 -- (-1680.384) (-1677.284) (-1687.534) [-1678.241] * (-1672.788) (-1676.970) [-1677.453] (-1689.371) -- 0:02:30
      246000 -- (-1675.513) (-1680.537) [-1680.891] (-1679.428) * (-1685.813) [-1677.194] (-1677.666) (-1689.422) -- 0:02:30
      246500 -- [-1674.235] (-1681.372) (-1681.485) (-1679.434) * (-1678.803) (-1680.676) [-1672.249] (-1692.052) -- 0:02:29
      247000 -- (-1684.425) (-1682.001) [-1678.554] (-1681.863) * [-1680.584] (-1674.809) (-1675.754) (-1695.426) -- 0:02:29
      247500 -- [-1677.628] (-1681.956) (-1679.992) (-1678.115) * (-1680.296) [-1674.044] (-1681.332) (-1678.479) -- 0:02:32
      248000 -- [-1677.750] (-1681.005) (-1678.078) (-1675.300) * (-1677.858) [-1682.109] (-1674.427) (-1675.453) -- 0:02:31
      248500 -- (-1679.403) (-1670.853) (-1678.450) [-1677.288] * (-1684.416) [-1679.685] (-1673.577) (-1684.376) -- 0:02:31
      249000 -- (-1680.339) [-1671.547] (-1676.400) (-1677.702) * (-1682.345) [-1675.871] (-1691.229) (-1680.374) -- 0:02:30
      249500 -- (-1679.022) [-1669.018] (-1679.121) (-1675.409) * (-1687.920) (-1680.642) (-1674.810) [-1675.530] -- 0:02:30
      250000 -- (-1675.678) (-1671.474) (-1673.564) [-1685.162] * (-1685.353) [-1673.651] (-1681.199) (-1683.019) -- 0:02:30

      Average standard deviation of split frequencies: 0.008463

      250500 -- (-1681.218) (-1675.033) [-1679.328] (-1683.650) * (-1687.068) [-1683.407] (-1681.341) (-1678.324) -- 0:02:29
      251000 -- (-1680.799) [-1672.677] (-1679.815) (-1683.198) * (-1681.010) (-1674.783) (-1676.781) [-1673.018] -- 0:02:29
      251500 -- (-1674.819) (-1684.504) [-1678.646] (-1688.827) * (-1683.067) [-1673.707] (-1676.355) (-1675.238) -- 0:02:28
      252000 -- (-1679.582) [-1680.999] (-1682.901) (-1691.381) * [-1671.030] (-1680.719) (-1683.697) (-1674.992) -- 0:02:28
      252500 -- (-1675.817) [-1674.129] (-1675.775) (-1684.073) * [-1677.124] (-1673.255) (-1691.991) (-1684.393) -- 0:02:30
      253000 -- (-1681.149) (-1679.540) (-1675.817) [-1683.221] * (-1676.261) (-1679.587) (-1689.537) [-1671.561] -- 0:02:30
      253500 -- [-1679.902] (-1688.570) (-1675.216) (-1680.675) * (-1677.820) [-1676.210] (-1675.495) (-1674.679) -- 0:02:30
      254000 -- [-1681.749] (-1676.232) (-1675.910) (-1675.004) * (-1677.939) (-1674.260) (-1682.947) [-1671.626] -- 0:02:29
      254500 -- (-1674.971) (-1673.373) (-1690.328) [-1686.373] * (-1681.725) (-1677.960) (-1677.215) [-1677.282] -- 0:02:29
      255000 -- (-1684.604) (-1674.412) (-1683.977) [-1679.014] * (-1677.896) (-1674.031) (-1681.849) [-1677.742] -- 0:02:29

      Average standard deviation of split frequencies: 0.008900

      255500 -- (-1688.593) (-1671.274) [-1680.483] (-1685.563) * (-1682.565) [-1679.280] (-1675.317) (-1682.713) -- 0:02:28
      256000 -- (-1682.003) [-1670.197] (-1683.584) (-1683.971) * (-1678.785) [-1675.946] (-1680.982) (-1680.836) -- 0:02:28
      256500 -- (-1674.293) (-1680.323) [-1680.796] (-1678.055) * (-1677.367) (-1679.217) [-1678.415] (-1679.333) -- 0:02:27
      257000 -- [-1676.946] (-1681.965) (-1685.330) (-1680.732) * (-1674.616) (-1674.617) [-1679.237] (-1675.243) -- 0:02:30
      257500 -- (-1682.912) (-1674.428) [-1681.527] (-1676.290) * (-1675.498) (-1679.856) [-1677.037] (-1675.143) -- 0:02:29
      258000 -- (-1688.257) [-1670.120] (-1681.682) (-1677.694) * (-1684.365) (-1684.691) [-1682.206] (-1675.756) -- 0:02:29
      258500 -- (-1676.600) [-1672.336] (-1677.844) (-1677.791) * (-1675.016) (-1684.518) [-1680.771] (-1674.898) -- 0:02:29
      259000 -- (-1679.591) [-1673.618] (-1679.261) (-1679.679) * (-1674.808) (-1695.285) [-1675.395] (-1675.232) -- 0:02:28
      259500 -- (-1681.463) [-1672.224] (-1683.601) (-1688.686) * (-1682.584) (-1688.068) [-1678.085] (-1681.200) -- 0:02:28
      260000 -- [-1681.317] (-1673.770) (-1681.097) (-1673.901) * (-1684.151) (-1684.844) (-1672.928) [-1673.690] -- 0:02:28

      Average standard deviation of split frequencies: 0.008138

      260500 -- (-1683.841) [-1682.814] (-1682.291) (-1685.762) * (-1677.165) (-1683.540) (-1675.001) [-1682.888] -- 0:02:27
      261000 -- [-1684.269] (-1679.185) (-1682.967) (-1683.350) * (-1677.732) [-1676.939] (-1681.114) (-1680.826) -- 0:02:27
      261500 -- (-1675.255) [-1674.534] (-1679.774) (-1677.332) * (-1673.943) (-1674.325) [-1673.464] (-1674.073) -- 0:02:26
      262000 -- (-1689.105) (-1676.575) (-1679.221) [-1679.259] * (-1684.914) (-1679.559) (-1676.255) [-1671.477] -- 0:02:29
      262500 -- (-1682.008) (-1683.118) (-1681.130) [-1675.835] * (-1677.528) (-1684.009) (-1680.712) [-1674.306] -- 0:02:28
      263000 -- (-1678.948) (-1688.687) (-1682.194) [-1679.565] * (-1674.587) [-1678.084] (-1673.996) (-1672.208) -- 0:02:28
      263500 -- (-1682.032) [-1684.541] (-1679.725) (-1679.843) * [-1677.164] (-1677.344) (-1688.050) (-1680.148) -- 0:02:28
      264000 -- (-1693.083) [-1686.713] (-1678.904) (-1679.062) * [-1672.595] (-1681.025) (-1680.471) (-1675.715) -- 0:02:27
      264500 -- (-1678.418) (-1688.372) [-1679.064] (-1674.363) * [-1680.136] (-1678.949) (-1682.084) (-1675.995) -- 0:02:27
      265000 -- [-1678.557] (-1685.701) (-1681.793) (-1679.692) * (-1678.073) (-1683.374) (-1682.690) [-1678.802] -- 0:02:27

      Average standard deviation of split frequencies: 0.008861

      265500 -- (-1680.671) [-1679.889] (-1674.211) (-1672.902) * (-1682.415) (-1682.909) (-1679.763) [-1683.919] -- 0:02:26
      266000 -- (-1681.861) (-1680.143) (-1682.574) [-1677.621] * (-1675.257) (-1683.101) [-1676.502] (-1687.047) -- 0:02:26
      266500 -- [-1680.273] (-1678.590) (-1673.962) (-1681.547) * [-1674.471] (-1685.775) (-1686.473) (-1671.751) -- 0:02:25
      267000 -- [-1683.333] (-1682.924) (-1674.252) (-1678.988) * [-1676.060] (-1674.587) (-1678.721) (-1682.803) -- 0:02:28
      267500 -- [-1678.265] (-1682.473) (-1673.407) (-1675.077) * (-1676.273) [-1677.039] (-1676.753) (-1680.613) -- 0:02:27
      268000 -- (-1681.501) [-1687.639] (-1677.851) (-1678.117) * (-1680.175) (-1682.505) [-1676.095] (-1679.035) -- 0:02:27
      268500 -- [-1680.790] (-1679.358) (-1674.518) (-1678.913) * (-1683.002) [-1681.164] (-1677.690) (-1689.919) -- 0:02:27
      269000 -- (-1678.666) (-1673.312) (-1684.104) [-1673.141] * [-1676.975] (-1677.870) (-1675.173) (-1675.728) -- 0:02:26
      269500 -- (-1682.198) (-1673.909) (-1682.102) [-1678.854] * (-1682.158) [-1673.629] (-1677.620) (-1682.608) -- 0:02:26
      270000 -- (-1676.521) (-1680.178) (-1676.630) [-1675.158] * (-1676.515) [-1673.341] (-1679.954) (-1685.393) -- 0:02:26

      Average standard deviation of split frequencies: 0.008708

      270500 -- (-1675.239) [-1671.429] (-1674.544) (-1675.489) * (-1685.100) (-1679.435) [-1679.886] (-1686.366) -- 0:02:25
      271000 -- (-1676.416) (-1679.620) [-1673.067] (-1681.929) * (-1672.555) (-1682.288) [-1676.562] (-1679.273) -- 0:02:25
      271500 -- [-1675.839] (-1680.459) (-1675.221) (-1680.469) * (-1678.959) (-1692.481) [-1673.670] (-1682.408) -- 0:02:27
      272000 -- (-1674.713) (-1683.049) [-1678.885] (-1679.372) * (-1680.077) (-1673.984) (-1678.346) [-1680.376] -- 0:02:27
      272500 -- [-1677.795] (-1687.083) (-1680.519) (-1685.973) * [-1678.254] (-1692.761) (-1674.771) (-1680.880) -- 0:02:26
      273000 -- (-1678.398) (-1681.731) [-1677.806] (-1681.830) * (-1675.645) (-1685.518) [-1677.497] (-1680.008) -- 0:02:26
      273500 -- (-1679.700) [-1681.820] (-1685.374) (-1671.122) * (-1678.374) (-1685.412) (-1682.558) [-1673.552] -- 0:02:26
      274000 -- (-1681.563) (-1686.881) (-1680.051) [-1676.676] * (-1678.371) (-1684.250) (-1678.028) [-1675.711] -- 0:02:25
      274500 -- [-1675.968] (-1682.662) (-1682.585) (-1670.739) * [-1678.083] (-1678.630) (-1679.430) (-1682.460) -- 0:02:25
      275000 -- [-1671.798] (-1683.472) (-1675.136) (-1680.653) * (-1674.754) (-1675.811) (-1680.568) [-1674.446] -- 0:02:25

      Average standard deviation of split frequencies: 0.007401

      275500 -- [-1677.734] (-1678.975) (-1674.764) (-1682.494) * (-1672.995) (-1674.461) [-1675.502] (-1687.515) -- 0:02:24
      276000 -- (-1675.558) (-1681.627) (-1673.788) [-1679.285] * (-1676.730) [-1679.042] (-1676.968) (-1680.440) -- 0:02:24
      276500 -- [-1675.001] (-1680.956) (-1686.080) (-1679.136) * (-1680.306) [-1678.618] (-1678.998) (-1684.586) -- 0:02:26
      277000 -- [-1680.774] (-1680.397) (-1678.757) (-1685.455) * (-1672.997) [-1678.572] (-1680.284) (-1683.806) -- 0:02:26
      277500 -- (-1674.624) (-1681.872) [-1676.717] (-1680.984) * (-1677.016) (-1681.317) [-1680.943] (-1678.320) -- 0:02:25
      278000 -- (-1687.289) (-1677.637) (-1678.718) [-1675.514] * (-1674.417) (-1678.924) (-1685.182) [-1680.201] -- 0:02:25
      278500 -- [-1682.820] (-1678.392) (-1683.079) (-1679.443) * (-1681.282) (-1680.276) [-1678.184] (-1685.814) -- 0:02:25
      279000 -- (-1680.147) [-1674.586] (-1680.520) (-1676.449) * [-1679.433] (-1680.067) (-1676.012) (-1683.806) -- 0:02:24
      279500 -- (-1679.160) [-1679.675] (-1682.586) (-1676.410) * [-1681.868] (-1683.788) (-1674.860) (-1684.043) -- 0:02:24
      280000 -- (-1682.491) [-1675.732] (-1687.528) (-1678.245) * (-1675.214) (-1674.151) [-1675.443] (-1675.194) -- 0:02:24

      Average standard deviation of split frequencies: 0.006158

      280500 -- (-1674.312) (-1683.364) [-1681.691] (-1674.801) * [-1681.803] (-1680.089) (-1679.996) (-1670.527) -- 0:02:23
      281000 -- [-1674.647] (-1679.658) (-1680.679) (-1676.085) * [-1678.898] (-1676.350) (-1674.007) (-1676.109) -- 0:02:23
      281500 -- (-1680.701) [-1673.298] (-1690.001) (-1677.452) * (-1687.240) (-1675.272) [-1676.093] (-1681.965) -- 0:02:25
      282000 -- (-1678.021) (-1685.507) (-1684.693) [-1676.246] * [-1676.217] (-1681.597) (-1677.779) (-1685.786) -- 0:02:25
      282500 -- (-1682.126) (-1683.498) (-1682.988) [-1675.052] * [-1677.211] (-1679.575) (-1681.361) (-1694.554) -- 0:02:24
      283000 -- [-1671.511] (-1685.855) (-1685.498) (-1673.849) * (-1676.311) [-1678.129] (-1682.667) (-1681.028) -- 0:02:24
      283500 -- [-1686.717] (-1673.615) (-1687.205) (-1675.942) * (-1686.657) [-1675.589] (-1687.703) (-1674.243) -- 0:02:24
      284000 -- (-1692.311) [-1678.157] (-1693.432) (-1683.305) * (-1673.049) [-1673.560] (-1685.710) (-1676.791) -- 0:02:23
      284500 -- [-1677.541] (-1678.220) (-1682.137) (-1676.701) * (-1675.578) [-1672.212] (-1686.684) (-1683.709) -- 0:02:23
      285000 -- (-1673.153) [-1676.412] (-1677.984) (-1680.184) * (-1676.592) [-1676.884] (-1679.200) (-1683.092) -- 0:02:23

      Average standard deviation of split frequencies: 0.004945

      285500 -- (-1680.916) [-1676.260] (-1679.850) (-1678.310) * [-1681.090] (-1679.660) (-1684.604) (-1682.741) -- 0:02:22
      286000 -- [-1674.581] (-1681.295) (-1675.786) (-1676.574) * [-1669.612] (-1679.685) (-1685.002) (-1675.936) -- 0:02:22
      286500 -- (-1678.677) (-1679.487) (-1682.009) [-1675.128] * (-1682.193) (-1676.398) (-1682.651) [-1679.755] -- 0:02:24
      287000 -- (-1680.139) (-1673.213) [-1681.184] (-1682.065) * [-1685.917] (-1677.930) (-1674.277) (-1677.334) -- 0:02:24
      287500 -- (-1681.543) [-1674.791] (-1677.236) (-1679.450) * (-1677.062) (-1678.803) (-1680.979) [-1679.186] -- 0:02:23
      288000 -- [-1675.586] (-1674.003) (-1677.403) (-1676.440) * [-1677.339] (-1677.876) (-1676.215) (-1679.373) -- 0:02:23
      288500 -- [-1677.968] (-1677.036) (-1683.158) (-1682.169) * [-1674.937] (-1686.656) (-1673.705) (-1681.544) -- 0:02:23
      289000 -- (-1680.148) (-1683.783) (-1682.766) [-1678.873] * (-1672.854) [-1679.575] (-1673.851) (-1682.166) -- 0:02:22
      289500 -- (-1675.421) (-1680.412) (-1675.496) [-1681.440] * (-1676.281) [-1676.185] (-1676.166) (-1677.507) -- 0:02:22
      290000 -- (-1680.144) [-1677.473] (-1680.088) (-1684.205) * (-1682.662) [-1672.697] (-1685.876) (-1677.665) -- 0:02:22

      Average standard deviation of split frequencies: 0.004325

      290500 -- (-1675.419) (-1681.313) [-1673.486] (-1679.482) * (-1677.084) [-1675.071] (-1680.896) (-1691.047) -- 0:02:21
      291000 -- (-1682.167) [-1677.739] (-1681.448) (-1684.127) * (-1682.726) (-1681.995) [-1675.402] (-1673.993) -- 0:02:23
      291500 -- [-1675.489] (-1686.596) (-1676.410) (-1680.414) * (-1674.818) [-1676.277] (-1675.822) (-1671.774) -- 0:02:23
      292000 -- (-1676.635) (-1685.903) [-1675.790] (-1679.904) * (-1678.929) (-1675.999) (-1683.628) [-1673.296] -- 0:02:23
      292500 -- [-1671.467] (-1681.590) (-1689.695) (-1677.172) * (-1678.440) [-1677.045] (-1676.806) (-1678.687) -- 0:02:22
      293000 -- [-1674.247] (-1672.948) (-1682.008) (-1675.908) * (-1675.663) (-1684.503) [-1678.317] (-1692.145) -- 0:02:22
      293500 -- (-1675.242) (-1673.909) (-1682.249) [-1676.659] * (-1674.778) (-1682.280) [-1672.810] (-1680.747) -- 0:02:22
      294000 -- (-1674.849) (-1685.608) [-1675.303] (-1682.864) * [-1678.396] (-1678.313) (-1680.540) (-1677.782) -- 0:02:21
      294500 -- (-1678.893) [-1672.862] (-1683.862) (-1681.894) * (-1677.293) (-1679.263) (-1697.769) [-1675.144] -- 0:02:21
      295000 -- [-1680.747] (-1680.824) (-1698.185) (-1673.162) * [-1678.050] (-1676.991) (-1680.524) (-1689.024) -- 0:02:21

      Average standard deviation of split frequencies: 0.003716

      295500 -- (-1685.974) [-1673.920] (-1682.018) (-1678.112) * (-1684.367) (-1680.647) (-1681.314) [-1677.028] -- 0:02:20
      296000 -- (-1688.676) [-1674.274] (-1684.391) (-1690.781) * (-1676.029) (-1676.178) (-1679.816) [-1677.497] -- 0:02:22
      296500 -- (-1687.645) [-1675.238] (-1681.158) (-1684.901) * [-1672.579] (-1677.788) (-1682.125) (-1675.461) -- 0:02:22
      297000 -- (-1684.361) (-1679.295) (-1682.650) [-1686.410] * [-1674.453] (-1684.600) (-1679.495) (-1676.349) -- 0:02:22
      297500 -- [-1679.336] (-1679.266) (-1677.009) (-1677.171) * (-1673.460) (-1677.990) [-1681.468] (-1682.229) -- 0:02:21
      298000 -- (-1686.858) [-1672.796] (-1682.388) (-1678.817) * [-1676.337] (-1684.165) (-1677.195) (-1680.366) -- 0:02:21
      298500 -- (-1681.996) [-1676.827] (-1678.490) (-1688.659) * [-1674.616] (-1678.851) (-1677.540) (-1677.632) -- 0:02:21
      299000 -- (-1674.628) (-1682.086) [-1684.050] (-1678.756) * (-1681.637) [-1679.627] (-1672.987) (-1684.938) -- 0:02:20
      299500 -- (-1678.942) (-1682.864) [-1676.758] (-1678.407) * (-1672.526) (-1681.037) (-1682.266) [-1681.551] -- 0:02:20
      300000 -- [-1677.282] (-1679.017) (-1675.700) (-1682.486) * [-1674.954] (-1678.696) (-1679.847) (-1681.156) -- 0:02:20

      Average standard deviation of split frequencies: 0.002613

      300500 -- [-1677.721] (-1677.301) (-1678.624) (-1678.351) * (-1683.045) (-1679.938) [-1677.017] (-1677.216) -- 0:02:21
      301000 -- (-1679.185) (-1683.717) [-1669.983] (-1678.665) * (-1681.801) (-1684.029) (-1678.302) [-1674.023] -- 0:02:21
      301500 -- (-1680.488) (-1689.241) (-1672.269) [-1674.357] * (-1675.435) (-1683.235) [-1679.575] (-1683.627) -- 0:02:21
      302000 -- (-1678.745) (-1685.050) (-1678.407) [-1672.633] * (-1674.442) [-1674.681] (-1669.078) (-1681.644) -- 0:02:20
      302500 -- (-1680.404) (-1679.556) [-1679.181] (-1673.044) * (-1674.377) (-1676.471) (-1681.493) [-1679.844] -- 0:02:20
      303000 -- [-1673.656] (-1675.667) (-1678.915) (-1676.025) * (-1679.328) (-1675.298) (-1679.301) [-1677.157] -- 0:02:20
      303500 -- (-1685.065) (-1675.308) [-1674.596] (-1679.220) * [-1676.499] (-1676.514) (-1675.173) (-1678.760) -- 0:02:19
      304000 -- (-1678.461) [-1677.200] (-1676.849) (-1678.350) * (-1673.531) [-1681.002] (-1680.205) (-1676.132) -- 0:02:19
      304500 -- [-1683.715] (-1678.097) (-1675.950) (-1674.706) * (-1677.550) (-1684.102) (-1683.593) [-1683.831] -- 0:02:19
      305000 -- (-1682.004) [-1680.853] (-1679.658) (-1677.453) * (-1681.519) (-1682.675) [-1685.922] (-1681.883) -- 0:02:19

      Average standard deviation of split frequencies: 0.001541

      305500 -- (-1678.495) [-1679.624] (-1678.275) (-1674.143) * (-1679.970) (-1681.899) (-1677.595) [-1681.897] -- 0:02:20
      306000 -- (-1676.826) [-1676.954] (-1680.811) (-1687.573) * (-1684.254) (-1696.303) (-1676.890) [-1674.005] -- 0:02:20
      306500 -- [-1669.779] (-1679.975) (-1678.403) (-1689.633) * [-1675.933] (-1687.785) (-1684.694) (-1673.499) -- 0:02:20
      307000 -- (-1678.540) (-1680.077) (-1684.944) [-1674.608] * (-1672.551) (-1686.739) [-1675.822] (-1673.570) -- 0:02:19
      307500 -- (-1685.273) [-1675.793] (-1674.953) (-1679.255) * [-1675.944] (-1683.401) (-1674.989) (-1684.813) -- 0:02:19
      308000 -- (-1681.459) (-1687.087) [-1675.795] (-1680.766) * [-1672.933] (-1674.770) (-1680.246) (-1683.362) -- 0:02:19
      308500 -- (-1686.197) (-1682.010) (-1673.493) [-1677.637] * (-1681.389) [-1674.235] (-1677.543) (-1675.393) -- 0:02:18
      309000 -- (-1681.122) (-1687.262) [-1671.441] (-1685.663) * (-1678.973) [-1677.994] (-1676.870) (-1684.022) -- 0:02:18
      309500 -- (-1683.649) (-1676.926) (-1679.356) [-1672.348] * (-1687.908) (-1673.353) (-1680.725) [-1674.849] -- 0:02:18
      310000 -- (-1679.884) (-1676.923) (-1673.793) [-1677.390] * [-1675.236] (-1682.816) (-1674.966) (-1681.684) -- 0:02:18

      Average standard deviation of split frequencies: 0.001517

      310500 -- [-1677.798] (-1688.278) (-1673.905) (-1689.035) * [-1674.438] (-1675.237) (-1685.623) (-1675.274) -- 0:02:19
      311000 -- [-1675.677] (-1682.978) (-1680.151) (-1676.987) * (-1691.702) (-1673.993) (-1680.624) [-1672.216] -- 0:02:19
      311500 -- (-1680.695) (-1677.028) [-1672.490] (-1682.214) * (-1678.169) (-1672.604) [-1675.795] (-1681.451) -- 0:02:19
      312000 -- [-1681.310] (-1684.483) (-1674.499) (-1677.904) * (-1690.425) [-1678.004] (-1685.831) (-1675.910) -- 0:02:18
      312500 -- (-1673.942) (-1692.837) (-1677.141) [-1676.839] * (-1676.116) [-1680.692] (-1678.715) (-1684.276) -- 0:02:18
      313000 -- (-1676.151) (-1688.204) (-1671.711) [-1679.365] * (-1679.299) (-1686.538) [-1674.972] (-1673.566) -- 0:02:18
      313500 -- (-1686.064) (-1686.359) [-1676.718] (-1685.902) * (-1672.700) (-1681.060) (-1679.481) [-1682.119] -- 0:02:17
      314000 -- [-1676.357] (-1683.105) (-1682.503) (-1683.781) * (-1674.839) (-1679.488) [-1678.245] (-1674.127) -- 0:02:17
      314500 -- (-1676.395) [-1678.412] (-1681.241) (-1684.540) * (-1675.383) (-1677.606) [-1675.452] (-1679.544) -- 0:02:17
      315000 -- [-1676.061] (-1676.505) (-1679.540) (-1679.432) * [-1683.046] (-1675.086) (-1675.448) (-1676.242) -- 0:02:19

      Average standard deviation of split frequencies: 0.001989

      315500 -- (-1683.105) (-1680.227) [-1674.587] (-1680.253) * [-1682.423] (-1673.751) (-1678.729) (-1683.286) -- 0:02:18
      316000 -- (-1678.120) (-1674.791) (-1674.096) [-1678.595] * (-1686.392) [-1679.485] (-1674.075) (-1679.149) -- 0:02:18
      316500 -- (-1679.420) (-1677.681) (-1679.967) [-1676.968] * (-1683.095) (-1677.587) (-1676.509) [-1677.530] -- 0:02:18
      317000 -- (-1678.129) [-1676.295] (-1692.258) (-1685.226) * (-1685.181) [-1690.081] (-1679.701) (-1677.507) -- 0:02:17
      317500 -- [-1674.139] (-1679.151) (-1687.791) (-1671.320) * (-1679.932) [-1671.057] (-1676.748) (-1678.481) -- 0:02:17
      318000 -- [-1677.973] (-1678.438) (-1676.605) (-1675.123) * (-1672.527) (-1679.713) [-1676.425] (-1675.128) -- 0:02:17
      318500 -- (-1676.661) (-1673.320) (-1677.033) [-1675.464] * (-1678.494) [-1679.284] (-1674.258) (-1676.762) -- 0:02:16
      319000 -- (-1680.934) [-1673.829] (-1680.353) (-1680.116) * (-1680.030) (-1673.053) [-1679.183] (-1690.590) -- 0:02:16
      319500 -- (-1677.795) (-1683.463) [-1681.835] (-1674.678) * [-1676.234] (-1677.334) (-1679.868) (-1676.968) -- 0:02:16
      320000 -- [-1683.487] (-1677.845) (-1679.220) (-1682.867) * (-1677.296) [-1676.610] (-1679.709) (-1670.256) -- 0:02:18

      Average standard deviation of split frequencies: 0.002940

      320500 -- (-1681.783) (-1679.632) [-1673.181] (-1676.391) * [-1678.990] (-1686.512) (-1682.341) (-1680.030) -- 0:02:17
      321000 -- [-1672.587] (-1675.344) (-1674.672) (-1680.716) * [-1677.071] (-1679.596) (-1677.182) (-1677.099) -- 0:02:17
      321500 -- (-1673.128) [-1677.493] (-1678.393) (-1674.969) * (-1682.137) (-1682.878) [-1678.711] (-1686.452) -- 0:02:17
      322000 -- (-1677.838) (-1687.224) (-1681.138) [-1679.599] * (-1678.670) [-1687.151] (-1672.569) (-1684.434) -- 0:02:16
      322500 -- [-1673.661] (-1674.605) (-1678.909) (-1692.798) * (-1676.445) (-1677.893) (-1675.671) [-1680.171] -- 0:02:16
      323000 -- (-1685.690) (-1675.123) (-1679.359) [-1680.054] * (-1676.801) [-1679.126] (-1679.270) (-1678.677) -- 0:02:16
      323500 -- (-1684.832) (-1675.287) (-1697.357) [-1677.475] * (-1680.598) [-1675.316] (-1684.611) (-1678.396) -- 0:02:15
      324000 -- (-1680.431) (-1675.519) [-1674.453] (-1671.345) * (-1678.007) [-1673.641] (-1681.834) (-1684.290) -- 0:02:15
      324500 -- [-1671.582] (-1677.205) (-1675.706) (-1679.358) * [-1673.842] (-1688.877) (-1672.982) (-1685.913) -- 0:02:15
      325000 -- [-1674.370] (-1681.192) (-1679.581) (-1678.014) * [-1678.751] (-1676.820) (-1684.540) (-1681.023) -- 0:02:17

      Average standard deviation of split frequencies: 0.002892

      325500 -- (-1685.777) [-1677.970] (-1681.028) (-1684.885) * (-1676.678) [-1684.898] (-1682.533) (-1676.081) -- 0:02:16
      326000 -- (-1671.550) (-1683.957) (-1683.513) [-1677.711] * (-1678.492) (-1679.332) (-1677.574) [-1674.479] -- 0:02:16
      326500 -- (-1678.415) (-1677.574) [-1676.807] (-1682.209) * (-1681.163) (-1689.934) (-1681.870) [-1680.114] -- 0:02:16
      327000 -- (-1676.242) (-1677.438) (-1679.220) [-1676.902] * (-1681.769) (-1694.577) (-1675.414) [-1677.017] -- 0:02:15
      327500 -- (-1682.532) [-1681.606] (-1674.418) (-1674.384) * (-1673.564) (-1678.902) (-1673.902) [-1670.760] -- 0:02:15
      328000 -- (-1676.216) (-1693.656) (-1679.396) [-1677.396] * (-1676.997) (-1677.915) (-1672.272) [-1677.173] -- 0:02:15
      328500 -- (-1685.290) (-1691.480) [-1677.358] (-1684.098) * [-1675.045] (-1681.479) (-1678.068) (-1690.670) -- 0:02:14
      329000 -- (-1688.432) (-1671.965) (-1679.872) [-1679.110] * (-1676.214) [-1673.975] (-1674.801) (-1678.298) -- 0:02:14
      329500 -- [-1676.499] (-1676.414) (-1687.216) (-1677.750) * [-1676.470] (-1677.588) (-1681.649) (-1680.248) -- 0:02:14
      330000 -- (-1681.196) (-1680.226) (-1679.223) [-1678.116] * (-1680.405) (-1676.990) (-1679.865) [-1678.052] -- 0:02:16

      Average standard deviation of split frequencies: 0.003802

      330500 -- (-1685.272) [-1675.453] (-1675.380) (-1684.264) * (-1681.092) (-1680.751) (-1681.520) [-1675.657] -- 0:02:15
      331000 -- [-1682.103] (-1675.597) (-1677.887) (-1676.805) * (-1676.652) (-1681.469) (-1689.641) [-1682.939] -- 0:02:15
      331500 -- (-1678.131) (-1678.801) [-1675.567] (-1675.238) * (-1676.042) (-1676.098) [-1683.764] (-1683.673) -- 0:02:15
      332000 -- (-1686.453) [-1677.748] (-1683.136) (-1674.697) * (-1675.682) (-1678.781) (-1688.782) [-1674.773] -- 0:02:14
      332500 -- (-1687.623) [-1676.331] (-1682.804) (-1677.067) * (-1676.842) (-1678.967) [-1674.137] (-1675.903) -- 0:02:14
      333000 -- (-1690.910) [-1677.531] (-1677.626) (-1677.944) * (-1680.796) (-1681.670) (-1674.414) [-1674.339] -- 0:02:14
      333500 -- (-1676.949) (-1680.688) (-1675.533) [-1676.420] * (-1682.722) (-1681.873) (-1680.357) [-1678.159] -- 0:02:13
      334000 -- (-1681.446) (-1681.098) (-1676.700) [-1681.586] * (-1683.806) (-1685.639) [-1682.396] (-1679.382) -- 0:02:13
      334500 -- [-1681.547] (-1678.068) (-1683.008) (-1681.880) * (-1678.684) (-1677.800) (-1684.974) [-1673.545] -- 0:02:13
      335000 -- [-1670.489] (-1682.604) (-1684.964) (-1685.728) * (-1672.485) [-1680.492] (-1684.179) (-1682.125) -- 0:02:14

      Average standard deviation of split frequencies: 0.004209

      335500 -- (-1680.022) (-1686.887) [-1679.936] (-1681.678) * [-1679.288] (-1676.706) (-1683.903) (-1674.433) -- 0:02:14
      336000 -- (-1678.258) (-1676.058) (-1676.289) [-1679.353] * (-1679.866) (-1683.058) [-1681.748] (-1674.943) -- 0:02:14
      336500 -- [-1679.548] (-1680.143) (-1675.455) (-1678.837) * (-1678.570) [-1682.953] (-1682.144) (-1678.468) -- 0:02:14
      337000 -- (-1672.697) [-1674.020] (-1681.810) (-1677.730) * (-1683.355) (-1680.959) [-1674.634] (-1678.756) -- 0:02:13
      337500 -- (-1680.986) (-1673.836) [-1673.787] (-1679.513) * (-1687.599) (-1678.222) (-1684.488) [-1676.321] -- 0:02:13
      338000 -- (-1682.740) [-1676.541] (-1684.770) (-1670.839) * [-1675.206] (-1680.186) (-1678.993) (-1678.213) -- 0:02:13
      338500 -- (-1670.839) [-1675.198] (-1678.086) (-1679.959) * (-1681.892) [-1672.880] (-1679.938) (-1682.666) -- 0:02:12
      339000 -- (-1678.637) (-1677.554) [-1675.029] (-1682.593) * (-1680.563) [-1673.753] (-1682.079) (-1680.149) -- 0:02:12
      339500 -- (-1684.668) (-1683.421) [-1670.463] (-1674.535) * (-1681.272) (-1683.679) [-1680.974] (-1683.742) -- 0:02:12
      340000 -- (-1675.811) (-1676.705) [-1680.308] (-1675.909) * (-1678.482) (-1686.071) [-1680.280] (-1688.196) -- 0:02:13

      Average standard deviation of split frequencies: 0.004613

      340500 -- (-1678.124) (-1686.773) (-1681.211) [-1679.997] * (-1685.069) [-1677.022] (-1679.068) (-1682.419) -- 0:02:13
      341000 -- (-1680.452) (-1674.717) (-1679.104) [-1679.209] * [-1678.530] (-1673.292) (-1681.459) (-1681.956) -- 0:02:13
      341500 -- [-1679.960] (-1680.306) (-1682.346) (-1679.654) * (-1679.067) [-1675.664] (-1676.456) (-1680.803) -- 0:02:13
      342000 -- (-1679.969) (-1679.920) [-1678.009] (-1673.630) * [-1674.804] (-1681.143) (-1676.805) (-1682.171) -- 0:02:12
      342500 -- (-1686.003) [-1674.350] (-1686.751) (-1677.140) * [-1676.377] (-1678.884) (-1675.219) (-1685.131) -- 0:02:12
      343000 -- [-1676.104] (-1675.740) (-1682.351) (-1679.047) * (-1672.862) (-1680.497) (-1675.009) [-1677.391] -- 0:02:12
      343500 -- [-1675.564] (-1676.152) (-1673.053) (-1685.905) * (-1675.522) (-1679.668) [-1671.834] (-1677.672) -- 0:02:11
      344000 -- (-1674.720) [-1680.375] (-1674.601) (-1675.800) * (-1673.410) [-1671.322] (-1674.108) (-1678.694) -- 0:02:11
      344500 -- (-1675.973) [-1671.253] (-1676.480) (-1692.247) * [-1677.505] (-1674.906) (-1680.602) (-1680.087) -- 0:02:11
      345000 -- [-1676.145] (-1681.576) (-1681.765) (-1676.422) * [-1676.524] (-1673.611) (-1683.269) (-1679.850) -- 0:02:12

      Average standard deviation of split frequencies: 0.004541

      345500 -- (-1678.011) (-1678.966) [-1685.467] (-1675.642) * (-1676.950) (-1695.139) (-1677.640) [-1679.076] -- 0:02:12
      346000 -- (-1681.702) (-1680.324) (-1684.337) [-1675.478] * (-1676.221) [-1679.689] (-1671.838) (-1687.111) -- 0:02:12
      346500 -- (-1680.861) (-1684.306) [-1674.573] (-1679.105) * (-1679.604) [-1676.954] (-1674.556) (-1681.789) -- 0:02:12
      347000 -- (-1679.338) [-1675.163] (-1675.022) (-1676.881) * (-1678.307) (-1674.981) (-1675.789) [-1672.027] -- 0:02:11
      347500 -- (-1684.671) (-1676.818) (-1679.755) [-1680.976] * [-1676.133] (-1689.830) (-1677.677) (-1677.090) -- 0:02:11
      348000 -- (-1683.011) (-1674.105) (-1678.579) [-1677.634] * [-1678.429] (-1698.071) (-1674.725) (-1676.522) -- 0:02:11
      348500 -- (-1680.290) [-1673.362] (-1683.593) (-1679.760) * (-1681.836) (-1689.220) [-1677.772] (-1671.969) -- 0:02:10
      349000 -- (-1681.057) (-1674.173) [-1677.351] (-1684.726) * (-1678.924) (-1687.258) [-1680.017] (-1679.456) -- 0:02:10
      349500 -- (-1675.628) [-1674.609] (-1671.143) (-1680.409) * (-1677.890) (-1684.058) (-1679.153) [-1672.519] -- 0:02:10
      350000 -- (-1683.230) (-1679.028) [-1672.046] (-1681.572) * (-1684.907) (-1675.186) (-1680.886) [-1680.844] -- 0:02:11

      Average standard deviation of split frequencies: 0.003585

      350500 -- (-1680.077) (-1678.641) (-1679.427) [-1675.072] * (-1680.052) [-1672.382] (-1677.403) (-1677.153) -- 0:02:11
      351000 -- (-1675.969) (-1677.362) (-1681.797) [-1673.855] * (-1682.716) [-1675.428] (-1680.202) (-1679.768) -- 0:02:11
      351500 -- [-1677.324] (-1676.795) (-1686.715) (-1682.740) * (-1681.391) (-1675.929) [-1681.693] (-1685.544) -- 0:02:10
      352000 -- (-1686.940) (-1682.729) [-1676.309] (-1681.404) * (-1680.431) [-1680.987] (-1676.231) (-1684.993) -- 0:02:10
      352500 -- [-1676.639] (-1675.189) (-1678.961) (-1675.235) * (-1678.618) [-1679.055] (-1688.314) (-1677.192) -- 0:02:10
      353000 -- (-1693.790) (-1682.502) [-1680.231] (-1675.417) * (-1675.911) (-1670.028) [-1673.617] (-1680.010) -- 0:02:10
      353500 -- [-1677.489] (-1681.878) (-1683.274) (-1681.099) * (-1674.673) (-1681.662) (-1682.084) [-1681.217] -- 0:02:09
      354000 -- (-1674.401) (-1682.021) (-1673.427) [-1671.954] * (-1675.587) (-1682.957) (-1675.808) [-1673.598] -- 0:02:09
      354500 -- [-1675.042] (-1684.325) (-1672.473) (-1671.515) * (-1675.911) (-1689.409) [-1676.445] (-1678.311) -- 0:02:11
      355000 -- (-1674.542) (-1679.788) (-1683.561) [-1680.630] * (-1686.682) (-1678.561) [-1678.841] (-1678.199) -- 0:02:10

      Average standard deviation of split frequencies: 0.003531

      355500 -- (-1679.349) (-1679.164) [-1673.067] (-1681.802) * (-1677.769) (-1674.617) [-1670.705] (-1679.222) -- 0:02:10
      356000 -- [-1676.000] (-1677.316) (-1677.773) (-1683.448) * (-1676.942) (-1676.783) [-1676.999] (-1691.043) -- 0:02:10
      356500 -- (-1676.019) (-1688.216) [-1673.907] (-1677.183) * (-1675.002) [-1674.262] (-1679.271) (-1690.772) -- 0:02:09
      357000 -- (-1675.945) (-1681.724) (-1678.935) [-1678.000] * (-1673.715) (-1680.433) [-1676.659] (-1686.435) -- 0:02:09
      357500 -- (-1674.956) (-1675.482) (-1673.208) [-1679.903] * [-1675.861] (-1674.117) (-1678.050) (-1682.976) -- 0:02:09
      358000 -- (-1674.571) (-1680.835) (-1679.811) [-1678.971] * (-1678.632) [-1673.898] (-1682.014) (-1676.608) -- 0:02:09
      358500 -- (-1681.954) (-1676.350) [-1671.333] (-1679.110) * [-1677.670] (-1674.851) (-1672.160) (-1681.703) -- 0:02:08
      359000 -- (-1677.906) [-1680.420] (-1673.462) (-1678.898) * (-1677.363) [-1674.754] (-1675.602) (-1678.665) -- 0:02:08
      359500 -- (-1685.743) [-1681.827] (-1678.395) (-1675.456) * (-1682.888) (-1675.108) [-1673.521] (-1687.279) -- 0:02:10
      360000 -- (-1681.744) [-1677.851] (-1678.244) (-1680.940) * (-1680.312) (-1673.710) [-1672.462] (-1686.066) -- 0:02:09

      Average standard deviation of split frequencies: 0.005228

      360500 -- [-1674.017] (-1679.287) (-1680.351) (-1682.442) * [-1673.790] (-1675.474) (-1683.446) (-1678.982) -- 0:02:09
      361000 -- (-1683.491) (-1676.729) (-1690.147) [-1678.865] * (-1685.817) [-1676.413] (-1683.366) (-1676.523) -- 0:02:09
      361500 -- [-1681.352] (-1680.802) (-1680.550) (-1682.178) * (-1675.256) (-1682.798) (-1674.381) [-1677.561] -- 0:02:08
      362000 -- (-1679.529) [-1679.876] (-1676.628) (-1683.659) * [-1676.756] (-1682.621) (-1688.858) (-1686.344) -- 0:02:08
      362500 -- (-1690.730) (-1691.316) (-1677.828) [-1676.326] * (-1673.854) [-1681.478] (-1681.410) (-1682.790) -- 0:02:08
      363000 -- [-1677.443] (-1680.036) (-1675.485) (-1678.884) * (-1673.886) (-1681.078) (-1682.546) [-1674.454] -- 0:02:08
      363500 -- (-1682.111) [-1675.581] (-1678.322) (-1689.915) * (-1672.418) (-1674.504) [-1676.916] (-1673.561) -- 0:02:07
      364000 -- (-1680.541) (-1672.827) [-1680.644] (-1679.874) * (-1674.727) [-1674.033] (-1683.259) (-1676.828) -- 0:02:07
      364500 -- (-1687.433) (-1680.548) [-1679.558] (-1680.252) * (-1680.114) (-1683.608) (-1684.366) [-1675.423] -- 0:02:09
      365000 -- (-1673.632) (-1689.710) [-1685.565] (-1677.870) * (-1681.427) (-1679.985) (-1684.147) [-1674.048] -- 0:02:08

      Average standard deviation of split frequencies: 0.004293

      365500 -- (-1673.527) [-1672.714] (-1674.856) (-1678.773) * (-1678.321) [-1678.915] (-1684.104) (-1674.260) -- 0:02:08
      366000 -- (-1671.237) (-1673.511) [-1672.259] (-1684.930) * (-1675.732) (-1679.947) (-1681.618) [-1681.322] -- 0:02:08
      366500 -- [-1677.637] (-1683.628) (-1672.541) (-1670.553) * (-1679.728) (-1671.906) [-1683.624] (-1678.365) -- 0:02:07
      367000 -- [-1675.741] (-1674.091) (-1686.015) (-1677.239) * (-1677.323) (-1673.220) (-1681.408) [-1677.374] -- 0:02:07
      367500 -- (-1676.783) [-1679.085] (-1683.295) (-1677.626) * [-1676.968] (-1680.370) (-1679.755) (-1681.647) -- 0:02:07
      368000 -- (-1681.270) (-1676.522) (-1682.905) [-1674.172] * (-1681.307) (-1676.570) (-1693.196) [-1673.898] -- 0:02:07
      368500 -- (-1676.481) [-1676.197] (-1690.988) (-1685.075) * [-1673.961] (-1675.798) (-1685.633) (-1680.231) -- 0:02:06
      369000 -- (-1684.461) [-1671.611] (-1678.720) (-1676.875) * (-1675.971) [-1680.054] (-1685.771) (-1680.679) -- 0:02:08
      369500 -- (-1685.246) [-1679.992] (-1678.689) (-1676.341) * (-1684.306) (-1682.611) (-1686.311) [-1684.963] -- 0:02:07
      370000 -- [-1675.148] (-1677.296) (-1688.303) (-1673.471) * [-1681.829] (-1677.484) (-1687.335) (-1685.712) -- 0:02:07

      Average standard deviation of split frequencies: 0.005511

      370500 -- (-1681.412) (-1674.775) (-1686.124) [-1676.245] * [-1674.885] (-1676.046) (-1677.477) (-1675.623) -- 0:02:07
      371000 -- (-1675.667) [-1679.955] (-1689.120) (-1676.809) * (-1673.759) (-1685.718) [-1671.275] (-1681.774) -- 0:02:07
      371500 -- (-1676.218) (-1684.609) [-1684.844] (-1673.106) * [-1676.760] (-1683.381) (-1677.700) (-1671.944) -- 0:02:06
      372000 -- [-1674.150] (-1680.994) (-1688.686) (-1672.541) * [-1684.031] (-1682.959) (-1678.296) (-1686.117) -- 0:02:06
      372500 -- (-1672.963) (-1679.849) (-1685.930) [-1674.082] * [-1679.836] (-1680.346) (-1679.939) (-1692.242) -- 0:02:06
      373000 -- (-1685.225) (-1686.852) [-1686.939] (-1677.602) * [-1677.052] (-1688.280) (-1677.573) (-1684.672) -- 0:02:06
      373500 -- [-1673.922] (-1681.892) (-1677.147) (-1677.212) * (-1677.076) [-1677.148] (-1686.588) (-1677.233) -- 0:02:05
      374000 -- (-1671.219) (-1673.741) [-1676.010] (-1678.720) * (-1679.617) (-1684.227) [-1679.880] (-1680.899) -- 0:02:07
      374500 -- (-1674.487) (-1684.904) [-1671.649] (-1681.660) * (-1678.302) [-1678.595] (-1682.844) (-1678.047) -- 0:02:06
      375000 -- (-1680.870) (-1678.122) [-1676.271] (-1677.777) * (-1674.911) [-1681.909] (-1683.318) (-1679.920) -- 0:02:06

      Average standard deviation of split frequencies: 0.005433

      375500 -- (-1672.810) [-1681.273] (-1679.203) (-1681.972) * (-1678.046) (-1684.798) (-1676.618) [-1682.408] -- 0:02:06
      376000 -- (-1681.821) (-1680.365) (-1674.081) [-1684.458] * [-1672.116] (-1685.791) (-1682.183) (-1684.099) -- 0:02:06
      376500 -- (-1683.559) (-1678.030) [-1672.719] (-1674.633) * (-1679.982) [-1675.886] (-1680.594) (-1682.012) -- 0:02:05
      377000 -- (-1675.747) (-1676.661) (-1675.422) [-1678.318] * (-1680.759) (-1684.672) (-1681.951) [-1678.003] -- 0:02:05
      377500 -- (-1685.269) [-1670.680] (-1682.133) (-1679.599) * (-1684.507) (-1682.978) [-1669.317] (-1684.769) -- 0:02:05
      378000 -- [-1677.552] (-1682.137) (-1675.966) (-1691.538) * (-1673.479) [-1674.502] (-1680.942) (-1678.825) -- 0:02:05
      378500 -- (-1676.746) (-1686.707) (-1681.809) [-1685.733] * (-1681.226) (-1676.859) [-1675.440] (-1679.200) -- 0:02:06
      379000 -- (-1687.639) (-1683.172) [-1678.234] (-1679.876) * (-1677.159) [-1686.328] (-1674.871) (-1683.199) -- 0:02:06
      379500 -- (-1682.517) (-1682.542) (-1677.684) [-1672.704] * (-1683.612) [-1676.901] (-1680.000) (-1687.094) -- 0:02:05
      380000 -- (-1695.156) (-1683.236) (-1677.315) [-1671.612] * (-1676.443) [-1671.261] (-1675.643) (-1686.140) -- 0:02:05

      Average standard deviation of split frequencies: 0.004953

      380500 -- (-1675.394) (-1684.115) (-1673.454) [-1675.434] * (-1680.932) (-1675.749) [-1680.070] (-1680.656) -- 0:02:05
      381000 -- (-1676.539) (-1678.450) (-1680.153) [-1672.105] * (-1683.603) (-1674.489) [-1678.623] (-1675.619) -- 0:02:05
      381500 -- (-1682.153) (-1685.118) (-1683.677) [-1675.871] * [-1675.794] (-1676.647) (-1685.121) (-1679.303) -- 0:02:04
      382000 -- (-1680.652) (-1677.719) (-1677.850) [-1675.856] * (-1680.205) (-1680.073) [-1673.799] (-1676.172) -- 0:02:04
      382500 -- (-1683.761) (-1681.439) (-1681.691) [-1672.729] * (-1682.381) [-1673.568] (-1692.334) (-1674.442) -- 0:02:04
      383000 -- [-1683.646] (-1674.571) (-1677.785) (-1675.870) * (-1679.683) (-1683.094) [-1677.736] (-1681.277) -- 0:02:04
      383500 -- (-1693.207) (-1673.992) [-1677.767] (-1675.402) * (-1675.791) (-1683.473) (-1680.775) [-1671.927] -- 0:02:05
      384000 -- (-1678.778) (-1677.650) [-1676.141] (-1681.820) * (-1682.484) (-1676.819) (-1680.480) [-1682.246] -- 0:02:05
      384500 -- [-1679.112] (-1676.026) (-1674.014) (-1687.953) * (-1675.058) [-1675.521] (-1689.222) (-1678.268) -- 0:02:04
      385000 -- [-1680.381] (-1677.198) (-1680.746) (-1679.694) * (-1676.302) (-1673.883) [-1676.960] (-1677.735) -- 0:02:04

      Average standard deviation of split frequencies: 0.005699

      385500 -- (-1684.559) (-1676.953) [-1676.100] (-1682.971) * [-1674.103] (-1677.101) (-1675.217) (-1676.263) -- 0:02:04
      386000 -- (-1676.796) (-1678.962) [-1671.392] (-1679.623) * (-1674.125) [-1675.531] (-1673.689) (-1676.540) -- 0:02:04
      386500 -- (-1680.338) (-1690.999) [-1674.473] (-1675.375) * (-1683.069) (-1675.186) [-1678.493] (-1674.291) -- 0:02:03
      387000 -- (-1673.324) (-1679.806) (-1680.210) [-1684.958] * (-1682.943) (-1677.723) [-1677.212] (-1671.474) -- 0:02:03
      387500 -- (-1681.744) (-1676.676) (-1678.593) [-1678.759] * (-1684.786) (-1676.473) (-1675.575) [-1671.848] -- 0:02:03
      388000 -- [-1676.132] (-1675.423) (-1678.231) (-1677.903) * (-1680.698) (-1686.947) (-1684.378) [-1676.821] -- 0:02:03
      388500 -- (-1680.395) (-1675.680) [-1678.344] (-1673.039) * (-1678.527) [-1676.782] (-1678.470) (-1675.237) -- 0:02:04
      389000 -- (-1678.582) (-1674.382) [-1681.999] (-1684.326) * (-1686.199) (-1673.199) (-1680.466) [-1672.656] -- 0:02:04
      389500 -- (-1671.421) (-1671.594) (-1679.723) [-1678.865] * (-1676.775) (-1679.832) (-1679.659) [-1676.581] -- 0:02:03
      390000 -- (-1685.826) [-1679.893] (-1680.538) (-1681.302) * [-1674.023] (-1684.721) (-1682.361) (-1679.142) -- 0:02:03

      Average standard deviation of split frequencies: 0.007642

      390500 -- (-1676.441) (-1679.041) (-1682.413) [-1674.654] * (-1678.806) (-1678.024) [-1675.172] (-1680.897) -- 0:02:03
      391000 -- (-1678.768) (-1678.486) (-1679.591) [-1674.808] * (-1674.910) [-1675.928] (-1682.830) (-1683.714) -- 0:02:03
      391500 -- (-1685.284) (-1684.003) (-1672.323) [-1675.590] * (-1679.382) (-1685.671) (-1690.133) [-1681.736] -- 0:02:02
      392000 -- (-1684.587) (-1679.735) [-1679.761] (-1678.536) * (-1689.633) [-1672.828] (-1676.611) (-1681.345) -- 0:02:02
      392500 -- (-1686.729) (-1682.627) [-1675.812] (-1672.887) * (-1674.378) (-1675.001) (-1671.362) [-1680.515] -- 0:02:02
      393000 -- (-1686.662) [-1672.435] (-1683.474) (-1679.545) * (-1671.380) (-1678.357) [-1675.793] (-1677.999) -- 0:02:03
      393500 -- (-1688.001) (-1681.009) [-1683.006] (-1681.509) * (-1672.446) (-1679.197) [-1677.773] (-1673.109) -- 0:02:03
      394000 -- (-1684.465) [-1675.379] (-1676.231) (-1685.177) * (-1679.523) [-1678.618] (-1682.841) (-1683.358) -- 0:02:03
      394500 -- (-1677.107) (-1685.965) (-1675.311) [-1678.964] * (-1678.156) (-1673.895) [-1676.932] (-1680.317) -- 0:02:02
      395000 -- (-1680.070) (-1679.416) (-1685.597) [-1680.988] * (-1674.583) [-1683.612] (-1674.641) (-1674.971) -- 0:02:02

      Average standard deviation of split frequencies: 0.008333

      395500 -- (-1678.207) [-1681.112] (-1683.960) (-1691.437) * [-1674.626] (-1681.270) (-1684.639) (-1684.067) -- 0:02:02
      396000 -- (-1688.059) (-1677.899) (-1673.776) [-1674.492] * (-1683.925) (-1674.939) [-1672.465] (-1678.920) -- 0:02:02
      396500 -- [-1679.220] (-1682.608) (-1673.884) (-1678.197) * [-1676.912] (-1677.449) (-1674.482) (-1678.797) -- 0:02:01
      397000 -- (-1679.443) [-1672.358] (-1684.625) (-1678.858) * [-1677.660] (-1676.811) (-1682.147) (-1684.176) -- 0:02:01
      397500 -- (-1674.587) [-1674.642] (-1672.638) (-1677.906) * (-1687.506) (-1676.627) (-1675.049) [-1682.687] -- 0:02:01
      398000 -- [-1675.683] (-1680.664) (-1677.507) (-1676.724) * (-1678.366) (-1673.894) (-1672.460) [-1676.756] -- 0:02:02
      398500 -- (-1681.494) (-1684.120) [-1680.162] (-1675.699) * (-1682.502) (-1674.188) [-1681.893] (-1679.523) -- 0:02:02
      399000 -- (-1687.121) (-1672.674) [-1672.393] (-1675.323) * [-1681.932] (-1676.607) (-1676.083) (-1677.193) -- 0:02:02
      399500 -- (-1677.142) (-1674.342) [-1678.764] (-1675.408) * [-1680.272] (-1680.993) (-1681.762) (-1679.451) -- 0:02:01
      400000 -- [-1677.477] (-1671.561) (-1677.322) (-1679.863) * (-1677.069) [-1678.552] (-1680.195) (-1678.670) -- 0:02:01

      Average standard deviation of split frequencies: 0.007844

      400500 -- (-1677.064) (-1676.073) (-1676.594) [-1677.496] * [-1676.749] (-1683.877) (-1684.140) (-1672.972) -- 0:02:01
      401000 -- (-1675.522) [-1675.095] (-1675.443) (-1686.838) * (-1685.669) (-1683.434) (-1685.399) [-1671.865] -- 0:02:00
      401500 -- (-1689.069) (-1679.635) [-1671.992] (-1682.894) * (-1682.831) (-1677.930) [-1675.823] (-1683.454) -- 0:02:00
      402000 -- (-1681.339) (-1675.182) [-1673.332] (-1689.588) * (-1685.179) (-1673.731) [-1682.517] (-1675.901) -- 0:02:00
      402500 -- (-1675.388) (-1676.357) (-1684.361) [-1680.423] * (-1680.940) (-1675.663) (-1684.973) [-1673.632] -- 0:02:00
      403000 -- (-1673.319) (-1681.275) (-1677.875) [-1675.179] * (-1677.817) [-1680.584] (-1683.368) (-1677.089) -- 0:02:01
      403500 -- (-1674.886) [-1674.070] (-1681.002) (-1685.046) * (-1686.590) (-1676.484) (-1679.962) [-1679.161] -- 0:02:01
      404000 -- [-1671.527] (-1676.161) (-1678.108) (-1680.663) * (-1680.653) (-1676.465) (-1674.999) [-1674.558] -- 0:02:00
      404500 -- (-1676.169) [-1675.959] (-1689.861) (-1684.689) * (-1672.910) (-1678.061) (-1677.232) [-1675.587] -- 0:02:00
      405000 -- (-1673.948) (-1674.627) [-1680.985] (-1678.757) * (-1675.879) [-1678.975] (-1681.136) (-1679.323) -- 0:02:00

      Average standard deviation of split frequencies: 0.008515

      405500 -- (-1677.781) (-1676.441) [-1672.748] (-1684.828) * (-1680.290) [-1682.129] (-1671.524) (-1685.125) -- 0:02:00
      406000 -- (-1677.313) (-1681.203) (-1681.666) [-1679.515] * (-1676.740) (-1678.047) (-1679.489) [-1678.724] -- 0:01:59
      406500 -- (-1687.588) [-1674.986] (-1681.081) (-1676.173) * (-1684.162) [-1676.390] (-1676.585) (-1679.624) -- 0:01:59
      407000 -- (-1684.612) [-1675.905] (-1677.357) (-1682.993) * [-1677.367] (-1680.934) (-1676.091) (-1677.007) -- 0:01:59
      407500 -- (-1677.498) (-1679.245) [-1682.523] (-1681.745) * [-1675.978] (-1690.571) (-1676.922) (-1683.400) -- 0:02:00
      408000 -- (-1686.182) [-1685.460] (-1677.294) (-1677.955) * (-1680.983) [-1682.477] (-1680.296) (-1674.979) -- 0:02:00
      408500 -- (-1685.273) (-1678.201) (-1680.791) [-1677.276] * (-1678.006) (-1688.039) (-1675.059) [-1677.363] -- 0:02:00
      409000 -- (-1680.500) (-1682.573) (-1700.072) [-1676.765] * (-1677.131) (-1679.316) [-1673.863] (-1678.694) -- 0:01:59
      409500 -- (-1681.659) (-1682.880) (-1681.098) [-1677.133] * [-1676.359] (-1679.221) (-1679.946) (-1679.428) -- 0:01:59
      410000 -- (-1685.588) [-1674.798] (-1676.063) (-1678.876) * (-1679.845) (-1675.127) [-1692.740] (-1680.161) -- 0:01:59

      Average standard deviation of split frequencies: 0.006122

      410500 -- [-1676.187] (-1676.127) (-1679.324) (-1677.871) * (-1676.802) (-1687.360) (-1679.490) [-1680.803] -- 0:01:59
      411000 -- (-1680.757) (-1679.441) [-1681.782] (-1681.574) * (-1680.634) (-1675.900) (-1685.373) [-1672.368] -- 0:01:58
      411500 -- (-1681.411) [-1675.019] (-1675.791) (-1686.428) * (-1681.906) (-1675.363) (-1687.682) [-1676.602] -- 0:01:58
      412000 -- [-1681.787] (-1682.672) (-1680.560) (-1678.837) * (-1690.012) [-1677.833] (-1686.645) (-1683.878) -- 0:01:58
      412500 -- (-1685.407) (-1677.456) [-1674.280] (-1675.733) * (-1694.113) (-1681.383) (-1684.126) [-1684.317] -- 0:01:59
      413000 -- (-1677.945) (-1672.737) [-1674.148] (-1674.541) * (-1682.051) (-1674.137) (-1671.572) [-1676.166] -- 0:01:59
      413500 -- (-1681.266) (-1679.498) (-1673.240) [-1672.222] * (-1676.920) (-1677.705) [-1676.325] (-1679.462) -- 0:01:59
      414000 -- (-1678.163) (-1680.048) [-1680.422] (-1678.413) * (-1679.364) [-1679.197] (-1683.093) (-1674.321) -- 0:01:58
      414500 -- (-1682.352) (-1682.679) [-1675.998] (-1680.375) * (-1677.248) (-1686.719) [-1674.114] (-1675.710) -- 0:01:58
      415000 -- (-1679.254) (-1679.429) (-1678.802) [-1678.845] * (-1677.242) (-1683.182) (-1675.396) [-1679.422] -- 0:01:58

      Average standard deviation of split frequencies: 0.007932

      415500 -- [-1675.511] (-1690.363) (-1683.846) (-1673.142) * (-1679.494) [-1674.264] (-1675.613) (-1686.590) -- 0:01:58
      416000 -- (-1680.627) [-1681.186] (-1685.840) (-1681.048) * (-1672.836) [-1682.335] (-1674.596) (-1676.967) -- 0:01:57
      416500 -- (-1683.446) [-1680.206] (-1688.497) (-1675.525) * [-1674.586] (-1676.403) (-1676.303) (-1674.698) -- 0:01:57
      417000 -- (-1688.071) (-1678.344) (-1677.285) [-1689.231] * (-1686.180) (-1684.625) (-1675.022) [-1676.390] -- 0:01:58
      417500 -- (-1678.899) [-1687.136] (-1674.053) (-1678.379) * (-1671.292) (-1676.220) (-1678.263) [-1673.332] -- 0:01:58
      418000 -- [-1678.254] (-1684.589) (-1676.894) (-1679.255) * (-1679.583) (-1682.356) [-1680.007] (-1677.984) -- 0:01:58
      418500 -- (-1678.178) (-1682.130) (-1682.146) [-1676.366] * [-1674.968] (-1679.591) (-1680.997) (-1680.584) -- 0:01:58
      419000 -- [-1675.703] (-1678.980) (-1681.443) (-1684.899) * (-1674.527) [-1677.158] (-1679.257) (-1675.838) -- 0:01:57
      419500 -- [-1676.836] (-1679.798) (-1677.534) (-1677.328) * (-1675.061) (-1678.538) [-1679.560] (-1681.707) -- 0:01:57
      420000 -- (-1680.203) [-1682.249] (-1673.864) (-1681.461) * (-1681.022) [-1679.895] (-1676.330) (-1678.102) -- 0:01:57

      Average standard deviation of split frequencies: 0.008965

      420500 -- (-1678.835) (-1682.000) [-1673.486] (-1673.815) * [-1678.013] (-1680.296) (-1674.805) (-1679.182) -- 0:01:57
      421000 -- [-1676.196] (-1680.912) (-1677.988) (-1680.843) * (-1686.573) (-1675.749) [-1680.542] (-1684.408) -- 0:01:56
      421500 -- (-1675.577) (-1683.580) (-1674.178) [-1682.579] * (-1672.485) [-1680.454] (-1682.621) (-1682.551) -- 0:01:56
      422000 -- (-1676.905) (-1678.269) [-1678.904] (-1681.729) * (-1679.905) (-1680.908) [-1679.035] (-1683.366) -- 0:01:57
      422500 -- (-1680.718) (-1680.015) (-1675.999) [-1676.328] * (-1676.448) (-1694.539) (-1673.155) [-1679.684] -- 0:01:57
      423000 -- (-1684.495) (-1675.653) [-1672.771] (-1678.928) * [-1677.936] (-1689.219) (-1678.427) (-1681.636) -- 0:01:57
      423500 -- (-1679.969) (-1680.207) [-1673.424] (-1678.664) * (-1678.516) [-1679.756] (-1680.446) (-1684.876) -- 0:01:57
      424000 -- (-1676.491) [-1672.078] (-1678.857) (-1679.063) * [-1678.608] (-1684.454) (-1672.685) (-1684.539) -- 0:01:56
      424500 -- [-1678.233] (-1676.950) (-1685.968) (-1671.191) * (-1675.775) (-1678.228) (-1673.910) [-1678.948] -- 0:01:56
      425000 -- [-1681.432] (-1683.132) (-1674.705) (-1678.003) * [-1673.180] (-1677.673) (-1679.603) (-1680.137) -- 0:01:56

      Average standard deviation of split frequencies: 0.008853

      425500 -- (-1679.687) (-1676.884) (-1680.751) [-1672.747] * (-1675.188) [-1676.216] (-1671.463) (-1679.087) -- 0:01:56
      426000 -- (-1683.313) (-1678.008) [-1683.292] (-1677.065) * (-1676.343) [-1684.654] (-1671.316) (-1686.927) -- 0:01:55
      426500 -- (-1676.594) (-1680.816) (-1686.129) [-1679.703] * (-1673.146) (-1686.090) (-1685.988) [-1680.481] -- 0:01:56
      427000 -- [-1687.061] (-1681.240) (-1678.421) (-1673.576) * [-1674.865] (-1682.314) (-1679.721) (-1684.238) -- 0:01:56
      427500 -- (-1688.980) (-1671.567) (-1674.466) [-1671.058] * (-1678.470) (-1691.678) [-1675.817] (-1684.027) -- 0:01:56
      428000 -- [-1682.138] (-1674.594) (-1683.717) (-1677.838) * (-1677.777) (-1689.108) [-1679.065] (-1686.822) -- 0:01:56
      428500 -- (-1686.753) (-1676.441) [-1681.227] (-1678.987) * (-1682.777) (-1685.695) [-1676.208] (-1681.192) -- 0:01:56
      429000 -- [-1676.844] (-1678.385) (-1683.138) (-1674.838) * (-1676.192) [-1680.379] (-1676.259) (-1684.577) -- 0:01:55
      429500 -- (-1683.139) [-1675.601] (-1677.618) (-1674.638) * (-1678.043) (-1696.035) [-1675.811] (-1681.910) -- 0:01:55
      430000 -- (-1673.923) [-1676.517] (-1676.093) (-1681.678) * [-1679.086] (-1693.405) (-1678.780) (-1682.907) -- 0:01:55

      Average standard deviation of split frequencies: 0.009851

      430500 -- (-1677.828) (-1682.465) [-1674.780] (-1677.059) * (-1675.079) (-1688.393) (-1683.693) [-1678.777] -- 0:01:55
      431000 -- (-1686.344) (-1672.932) [-1675.212] (-1676.067) * (-1680.131) (-1687.463) (-1679.797) [-1683.583] -- 0:01:54
      431500 -- (-1679.474) (-1676.318) [-1680.670] (-1679.252) * [-1681.911] (-1701.353) (-1677.249) (-1677.741) -- 0:01:55
      432000 -- (-1676.043) [-1673.944] (-1679.550) (-1672.405) * (-1680.697) (-1680.402) [-1683.104] (-1676.794) -- 0:01:55
      432500 -- (-1683.226) [-1676.702] (-1682.178) (-1675.416) * (-1685.721) (-1673.144) [-1676.923] (-1684.838) -- 0:01:55
      433000 -- (-1679.779) (-1671.111) (-1674.625) [-1670.737] * (-1676.768) [-1674.210] (-1683.434) (-1675.278) -- 0:01:55
      433500 -- [-1673.915] (-1685.220) (-1677.998) (-1678.581) * (-1679.844) (-1678.124) (-1677.156) [-1672.572] -- 0:01:54
      434000 -- (-1680.105) (-1682.139) [-1676.019] (-1678.240) * (-1674.003) [-1677.627] (-1683.654) (-1681.954) -- 0:01:54
      434500 -- [-1681.617] (-1686.611) (-1677.694) (-1675.090) * (-1681.364) (-1682.403) [-1684.110] (-1682.516) -- 0:01:54
      435000 -- (-1677.832) (-1680.115) (-1673.338) [-1672.194] * [-1679.039] (-1680.412) (-1676.226) (-1679.976) -- 0:01:54

      Average standard deviation of split frequencies: 0.009731

      435500 -- (-1676.805) (-1678.398) (-1679.970) [-1673.901] * (-1671.315) (-1677.253) (-1675.319) [-1676.613] -- 0:01:54
      436000 -- (-1674.946) (-1677.938) (-1687.343) [-1675.874] * (-1678.414) (-1682.868) [-1673.802] (-1679.419) -- 0:01:53
      436500 -- (-1687.387) (-1676.507) (-1677.782) [-1683.222] * (-1682.484) [-1678.545] (-1680.426) (-1679.183) -- 0:01:54
      437000 -- (-1673.483) (-1678.539) (-1674.691) [-1673.718] * (-1675.835) [-1677.193] (-1680.694) (-1682.956) -- 0:01:54
      437500 -- [-1674.092] (-1683.286) (-1679.928) (-1682.125) * (-1673.404) (-1675.823) [-1683.574] (-1678.067) -- 0:01:54
      438000 -- [-1672.546] (-1679.833) (-1672.430) (-1684.604) * [-1674.449] (-1678.820) (-1678.978) (-1676.038) -- 0:01:54
      438500 -- (-1674.778) [-1675.666] (-1677.250) (-1684.996) * [-1680.066] (-1682.957) (-1683.303) (-1673.549) -- 0:01:53
      439000 -- (-1678.285) [-1672.380] (-1677.941) (-1684.794) * (-1675.388) [-1675.427] (-1687.112) (-1679.645) -- 0:01:53
      439500 -- (-1678.810) [-1676.331] (-1677.328) (-1679.451) * (-1682.867) (-1679.069) (-1674.696) [-1675.734] -- 0:01:53
      440000 -- (-1687.264) [-1674.916] (-1681.264) (-1675.195) * (-1681.425) (-1673.267) [-1682.231] (-1675.173) -- 0:01:53

      Average standard deviation of split frequencies: 0.011054

      440500 -- (-1681.899) [-1673.912] (-1686.475) (-1678.124) * (-1677.113) (-1677.957) (-1671.494) [-1679.407] -- 0:01:53
      441000 -- (-1686.243) (-1672.999) (-1683.071) [-1675.291] * (-1677.350) [-1680.974] (-1683.088) (-1683.031) -- 0:01:54
      441500 -- (-1695.218) (-1677.641) [-1678.773] (-1671.833) * (-1687.798) (-1674.050) (-1688.107) [-1676.396] -- 0:01:53
      442000 -- (-1690.277) [-1677.052] (-1680.504) (-1671.915) * (-1680.253) (-1676.606) (-1685.501) [-1672.241] -- 0:01:53
      442500 -- (-1686.294) (-1686.608) (-1679.379) [-1678.952] * (-1677.315) (-1687.075) [-1681.415] (-1679.652) -- 0:01:53
      443000 -- [-1688.366] (-1691.604) (-1681.984) (-1676.725) * (-1687.557) [-1671.854] (-1679.255) (-1676.983) -- 0:01:53
      443500 -- [-1688.066] (-1687.115) (-1675.988) (-1695.447) * (-1679.588) [-1671.223] (-1681.813) (-1675.201) -- 0:01:52
      444000 -- (-1677.510) (-1688.427) [-1676.719] (-1680.153) * [-1674.932] (-1675.482) (-1682.788) (-1689.759) -- 0:01:52
      444500 -- (-1678.604) (-1693.205) [-1678.007] (-1690.092) * [-1674.000] (-1677.953) (-1679.592) (-1677.709) -- 0:01:52
      445000 -- (-1686.086) [-1676.895] (-1672.894) (-1682.126) * (-1681.752) [-1673.245] (-1681.165) (-1674.904) -- 0:01:52

      Average standard deviation of split frequencies: 0.010922

      445500 -- [-1675.021] (-1680.632) (-1674.892) (-1675.470) * [-1673.450] (-1672.999) (-1683.020) (-1685.970) -- 0:01:52
      446000 -- (-1678.473) [-1669.432] (-1674.996) (-1675.759) * [-1675.428] (-1673.117) (-1684.451) (-1676.910) -- 0:01:53
      446500 -- (-1673.095) (-1672.364) [-1681.355] (-1683.326) * [-1681.976] (-1681.606) (-1676.443) (-1677.041) -- 0:01:52
      447000 -- (-1674.799) [-1675.949] (-1679.234) (-1679.332) * (-1684.075) (-1674.086) [-1678.081] (-1677.583) -- 0:01:52
      447500 -- [-1675.588] (-1681.519) (-1675.359) (-1678.849) * [-1685.663] (-1678.344) (-1685.560) (-1678.682) -- 0:01:52
      448000 -- (-1678.849) (-1675.842) (-1672.301) [-1676.360] * (-1680.997) (-1686.090) [-1677.088] (-1678.361) -- 0:01:52
      448500 -- (-1674.954) [-1677.602] (-1684.732) (-1681.204) * (-1679.262) (-1674.441) (-1679.889) [-1678.457] -- 0:01:51
      449000 -- [-1675.817] (-1676.505) (-1672.654) (-1674.132) * [-1678.131] (-1674.068) (-1677.485) (-1680.245) -- 0:01:51
      449500 -- (-1677.970) [-1674.304] (-1677.128) (-1681.078) * [-1676.153] (-1682.609) (-1693.986) (-1681.247) -- 0:01:51
      450000 -- [-1670.485] (-1673.734) (-1680.269) (-1680.420) * (-1674.795) (-1681.477) (-1678.228) [-1676.623] -- 0:01:51

      Average standard deviation of split frequencies: 0.010809

      450500 -- (-1680.199) (-1680.353) [-1684.174] (-1677.474) * [-1682.202] (-1678.761) (-1683.383) (-1684.021) -- 0:01:52
      451000 -- (-1680.584) [-1678.434] (-1684.933) (-1682.223) * (-1683.587) (-1681.230) [-1680.536] (-1678.643) -- 0:01:51
      451500 -- (-1687.174) (-1672.181) (-1671.863) [-1677.236] * [-1677.913] (-1679.552) (-1689.031) (-1681.711) -- 0:01:51
      452000 -- (-1679.049) (-1676.922) [-1682.843] (-1677.515) * (-1671.651) [-1675.910] (-1687.914) (-1684.418) -- 0:01:51
      452500 -- (-1680.328) (-1676.528) [-1679.066] (-1681.117) * (-1678.646) (-1682.525) (-1680.071) [-1674.509] -- 0:01:51
      453000 -- (-1676.415) (-1689.959) [-1677.620] (-1677.321) * [-1679.755] (-1683.782) (-1691.208) (-1679.377) -- 0:01:51
      453500 -- [-1670.921] (-1682.529) (-1679.280) (-1679.253) * (-1675.222) (-1675.533) (-1678.597) [-1676.496] -- 0:01:50
      454000 -- [-1675.092] (-1686.842) (-1675.117) (-1679.983) * [-1671.265] (-1678.433) (-1673.680) (-1678.248) -- 0:01:50
      454500 -- [-1679.113] (-1678.877) (-1675.530) (-1685.766) * (-1686.628) (-1678.377) [-1674.101] (-1674.114) -- 0:01:50
      455000 -- [-1673.739] (-1674.782) (-1683.762) (-1675.918) * (-1683.097) (-1686.668) (-1676.827) [-1678.999] -- 0:01:50

      Average standard deviation of split frequencies: 0.010682

      455500 -- (-1676.182) [-1682.075] (-1678.661) (-1676.168) * (-1680.851) [-1680.013] (-1682.808) (-1676.566) -- 0:01:51
      456000 -- (-1678.199) [-1678.163] (-1687.286) (-1679.424) * (-1688.322) (-1673.653) [-1674.498] (-1687.444) -- 0:01:50
      456500 -- (-1671.433) [-1676.939] (-1678.172) (-1673.706) * (-1675.515) (-1683.763) [-1678.233] (-1679.939) -- 0:01:50
      457000 -- (-1671.438) [-1679.494] (-1681.950) (-1678.433) * [-1676.203] (-1681.496) (-1678.368) (-1677.945) -- 0:01:50
      457500 -- (-1677.404) (-1681.861) [-1681.144] (-1677.074) * (-1676.257) (-1683.021) [-1683.530] (-1677.453) -- 0:01:50
      458000 -- (-1684.250) (-1684.827) (-1687.556) [-1677.135] * (-1676.445) [-1678.007] (-1682.111) (-1682.218) -- 0:01:50
      458500 -- (-1683.254) (-1678.877) (-1676.542) [-1675.835] * (-1682.315) [-1678.782] (-1678.567) (-1677.622) -- 0:01:49
      459000 -- (-1676.239) [-1680.099] (-1677.180) (-1680.064) * (-1680.291) (-1690.073) [-1678.440] (-1675.831) -- 0:01:49
      459500 -- (-1675.656) (-1675.060) [-1679.531] (-1676.165) * (-1676.235) (-1677.596) (-1678.990) [-1680.489] -- 0:01:49
      460000 -- (-1679.015) [-1673.801] (-1680.562) (-1673.682) * (-1682.812) [-1682.120] (-1675.225) (-1677.116) -- 0:01:50

      Average standard deviation of split frequencies: 0.010745

      460500 -- (-1678.222) (-1677.077) (-1680.258) [-1680.121] * (-1683.913) (-1681.879) [-1683.836] (-1679.985) -- 0:01:50
      461000 -- (-1675.699) (-1682.456) (-1675.304) [-1684.355] * (-1679.331) (-1684.257) (-1683.233) [-1680.296] -- 0:01:49
      461500 -- (-1675.824) [-1674.968] (-1671.183) (-1672.252) * (-1681.929) [-1674.198] (-1680.773) (-1687.190) -- 0:01:49
      462000 -- (-1684.460) (-1677.262) (-1684.981) [-1675.288] * (-1680.731) (-1676.725) [-1673.142] (-1685.531) -- 0:01:49
      462500 -- (-1677.038) [-1675.145] (-1681.690) (-1677.521) * [-1676.402] (-1686.768) (-1684.259) (-1693.742) -- 0:01:49
      463000 -- (-1684.364) (-1675.617) [-1680.133] (-1685.391) * (-1675.539) (-1682.544) [-1677.409] (-1685.591) -- 0:01:49
      463500 -- [-1677.606] (-1675.699) (-1677.190) (-1684.693) * (-1690.981) (-1674.823) (-1681.322) [-1677.347] -- 0:01:48
      464000 -- [-1682.763] (-1675.193) (-1698.157) (-1681.357) * (-1683.952) (-1679.881) [-1681.641] (-1675.353) -- 0:01:48
      464500 -- (-1672.578) [-1676.301] (-1676.042) (-1681.357) * (-1678.181) (-1676.548) (-1675.590) [-1678.061] -- 0:01:48
      465000 -- (-1688.527) [-1679.905] (-1680.953) (-1682.654) * (-1679.932) [-1679.478] (-1679.546) (-1681.777) -- 0:01:49

      Average standard deviation of split frequencies: 0.010959

      465500 -- (-1677.646) [-1675.556] (-1679.023) (-1675.931) * [-1676.294] (-1682.421) (-1675.737) (-1674.634) -- 0:01:49
      466000 -- [-1677.269] (-1684.342) (-1686.799) (-1677.469) * [-1692.742] (-1682.473) (-1672.751) (-1674.984) -- 0:01:48
      466500 -- (-1683.062) (-1683.824) [-1678.148] (-1683.164) * (-1686.663) (-1679.566) [-1672.567] (-1672.366) -- 0:01:48
      467000 -- [-1674.365] (-1686.632) (-1687.417) (-1677.288) * (-1689.322) (-1681.373) (-1679.176) [-1673.129] -- 0:01:48
      467500 -- (-1674.714) [-1679.076] (-1683.510) (-1678.063) * (-1674.140) (-1684.202) [-1677.658] (-1686.552) -- 0:01:48
      468000 -- (-1685.033) (-1679.761) (-1676.822) [-1672.154] * (-1675.624) [-1677.303] (-1677.704) (-1673.044) -- 0:01:47
      468500 -- [-1680.224] (-1676.461) (-1685.386) (-1672.508) * (-1688.097) (-1681.774) (-1683.296) [-1670.562] -- 0:01:47
      469000 -- (-1687.592) (-1679.010) [-1675.590] (-1683.151) * (-1685.190) (-1681.968) [-1679.056] (-1671.283) -- 0:01:47
      469500 -- (-1687.762) [-1674.359] (-1684.753) (-1677.927) * (-1684.212) (-1680.594) (-1675.662) [-1674.834] -- 0:01:47
      470000 -- [-1678.477] (-1683.734) (-1680.722) (-1680.036) * (-1675.456) (-1674.950) (-1680.021) [-1679.647] -- 0:01:48

      Average standard deviation of split frequencies: 0.010183

      470500 -- (-1674.676) [-1676.498] (-1685.707) (-1679.417) * (-1677.401) (-1679.342) (-1679.393) [-1675.189] -- 0:01:48
      471000 -- (-1675.313) [-1677.172] (-1675.950) (-1678.991) * (-1676.595) (-1679.564) [-1677.212] (-1678.791) -- 0:01:47
      471500 -- [-1685.911] (-1683.856) (-1680.748) (-1674.281) * (-1676.176) (-1682.296) (-1679.411) [-1675.091] -- 0:01:47
      472000 -- (-1674.985) (-1684.982) [-1680.288] (-1668.722) * (-1680.794) (-1681.388) (-1681.837) [-1680.037] -- 0:01:47
      472500 -- (-1679.595) (-1668.869) (-1679.050) [-1677.410] * [-1678.209] (-1686.605) (-1680.102) (-1677.322) -- 0:01:47
      473000 -- (-1681.447) [-1678.263] (-1680.916) (-1685.017) * (-1677.964) (-1683.918) (-1678.553) [-1678.261] -- 0:01:46
      473500 -- (-1683.838) (-1683.109) [-1675.162] (-1679.421) * (-1675.292) (-1679.001) [-1672.510] (-1675.358) -- 0:01:46
      474000 -- (-1679.451) (-1675.484) (-1675.343) [-1676.268] * (-1685.279) (-1681.811) [-1674.851] (-1683.589) -- 0:01:46
      474500 -- (-1682.346) (-1678.920) [-1675.918] (-1682.282) * (-1684.005) (-1679.106) [-1680.812] (-1678.048) -- 0:01:47
      475000 -- (-1684.349) (-1679.229) [-1679.441] (-1684.890) * (-1678.543) (-1686.892) (-1681.552) [-1676.856] -- 0:01:47

      Average standard deviation of split frequencies: 0.010399

      475500 -- (-1677.739) (-1682.307) [-1670.222] (-1677.381) * (-1676.593) (-1691.058) [-1675.108] (-1676.248) -- 0:01:46
      476000 -- [-1681.864] (-1679.713) (-1675.900) (-1680.069) * [-1679.860] (-1676.985) (-1675.668) (-1671.887) -- 0:01:46
      476500 -- (-1684.925) [-1680.217] (-1677.814) (-1687.695) * (-1675.421) (-1681.610) (-1688.442) [-1678.391] -- 0:01:46
      477000 -- (-1675.594) (-1679.044) (-1680.325) [-1679.114] * (-1681.360) [-1675.913] (-1677.959) (-1677.888) -- 0:01:46
      477500 -- (-1675.671) [-1680.023] (-1682.801) (-1677.558) * (-1681.433) (-1679.445) [-1676.822] (-1687.150) -- 0:01:46
      478000 -- [-1675.490] (-1672.507) (-1673.018) (-1676.603) * (-1677.966) (-1671.359) [-1672.499] (-1684.692) -- 0:01:45
      478500 -- (-1676.755) (-1686.039) (-1675.929) [-1676.515] * (-1686.759) [-1678.870] (-1674.995) (-1673.953) -- 0:01:45
      479000 -- (-1680.972) (-1679.635) [-1677.846] (-1681.105) * [-1688.057] (-1675.692) (-1671.736) (-1678.207) -- 0:01:45
      479500 -- [-1677.868] (-1687.008) (-1687.092) (-1678.597) * (-1674.281) [-1671.554] (-1673.538) (-1672.101) -- 0:01:46
      480000 -- (-1677.152) (-1683.546) (-1670.925) [-1681.959] * (-1681.356) [-1680.944] (-1678.020) (-1681.853) -- 0:01:46

      Average standard deviation of split frequencies: 0.010298

      480500 -- (-1676.691) [-1679.262] (-1684.043) (-1677.969) * [-1680.408] (-1680.225) (-1683.769) (-1682.839) -- 0:01:45
      481000 -- [-1676.656] (-1674.430) (-1677.193) (-1685.342) * (-1676.923) (-1680.476) [-1672.869] (-1677.346) -- 0:01:45
      481500 -- [-1675.853] (-1674.995) (-1676.101) (-1678.710) * [-1673.670] (-1677.823) (-1678.184) (-1685.666) -- 0:01:45
      482000 -- (-1678.851) [-1679.611] (-1679.279) (-1681.088) * (-1676.928) (-1679.779) [-1682.785] (-1680.483) -- 0:01:45
      482500 -- (-1679.263) [-1672.071] (-1675.121) (-1685.545) * [-1675.314] (-1683.471) (-1674.653) (-1684.033) -- 0:01:45
      483000 -- (-1683.899) (-1679.984) (-1678.233) [-1676.700] * (-1680.791) (-1673.711) (-1673.770) [-1677.868] -- 0:01:44
      483500 -- (-1686.256) [-1677.519] (-1678.148) (-1687.781) * (-1690.639) (-1689.176) [-1682.150] (-1683.113) -- 0:01:44
      484000 -- [-1676.543] (-1676.749) (-1678.393) (-1680.759) * [-1680.836] (-1675.533) (-1680.258) (-1678.330) -- 0:01:44
      484500 -- [-1673.399] (-1684.926) (-1682.272) (-1685.841) * [-1676.899] (-1673.797) (-1678.994) (-1681.329) -- 0:01:45
      485000 -- (-1673.532) (-1687.755) [-1675.932] (-1681.900) * (-1681.815) [-1673.110] (-1678.477) (-1685.199) -- 0:01:45

      Average standard deviation of split frequencies: 0.010508

      485500 -- (-1678.296) (-1674.989) [-1676.677] (-1681.449) * (-1677.274) (-1671.486) [-1681.057] (-1683.032) -- 0:01:44
      486000 -- (-1690.613) [-1672.649] (-1674.078) (-1675.025) * [-1673.535] (-1681.770) (-1678.858) (-1685.038) -- 0:01:44
      486500 -- (-1683.615) [-1674.194] (-1678.414) (-1680.064) * (-1675.060) (-1691.258) (-1675.996) [-1679.236] -- 0:01:44
      487000 -- (-1676.024) (-1683.452) (-1678.441) [-1672.604] * (-1675.905) [-1672.899] (-1678.340) (-1674.547) -- 0:01:44
      487500 -- (-1677.751) (-1672.502) (-1682.230) [-1677.782] * (-1677.188) [-1677.048] (-1680.808) (-1676.661) -- 0:01:44
      488000 -- (-1674.133) [-1672.586] (-1676.568) (-1674.110) * [-1676.073] (-1684.391) (-1679.255) (-1678.902) -- 0:01:43
      488500 -- (-1686.193) [-1674.132] (-1681.575) (-1683.576) * (-1679.305) (-1676.662) (-1681.510) [-1679.111] -- 0:01:43
      489000 -- (-1675.112) [-1672.471] (-1678.963) (-1678.294) * (-1675.705) (-1683.991) [-1677.356] (-1681.715) -- 0:01:44
      489500 -- (-1677.740) [-1676.736] (-1677.371) (-1670.766) * [-1676.902] (-1689.407) (-1673.364) (-1686.391) -- 0:01:44
      490000 -- [-1681.596] (-1678.538) (-1689.095) (-1676.622) * [-1681.491] (-1682.697) (-1677.421) (-1681.887) -- 0:01:44

      Average standard deviation of split frequencies: 0.011209

      490500 -- [-1684.524] (-1678.574) (-1680.741) (-1682.028) * (-1681.448) (-1679.750) (-1676.081) [-1671.162] -- 0:01:43
      491000 -- (-1682.148) [-1679.760] (-1676.071) (-1672.635) * (-1673.511) (-1679.877) [-1677.529] (-1679.081) -- 0:01:43
      491500 -- (-1689.021) [-1676.254] (-1673.622) (-1676.833) * (-1686.610) (-1681.270) (-1677.728) [-1677.224] -- 0:01:43
      492000 -- (-1688.819) (-1676.421) [-1682.065] (-1676.040) * (-1681.459) (-1678.068) (-1679.120) [-1675.222] -- 0:01:43
      492500 -- (-1678.624) (-1675.895) [-1673.181] (-1684.132) * (-1685.197) (-1679.034) [-1681.688] (-1681.161) -- 0:01:43
      493000 -- [-1678.382] (-1683.330) (-1678.091) (-1680.302) * (-1676.270) (-1678.247) [-1674.826] (-1688.758) -- 0:01:42
      493500 -- (-1678.563) (-1677.641) (-1683.895) [-1682.438] * (-1680.862) [-1676.397] (-1683.062) (-1684.091) -- 0:01:42
      494000 -- (-1678.614) (-1689.875) (-1677.553) [-1674.486] * (-1679.477) (-1673.969) (-1674.415) [-1672.009] -- 0:01:43
      494500 -- (-1676.259) [-1679.847] (-1678.106) (-1678.139) * (-1680.652) (-1676.238) [-1675.833] (-1683.289) -- 0:01:43
      495000 -- [-1677.656] (-1674.347) (-1675.847) (-1676.137) * (-1674.814) [-1674.102] (-1672.914) (-1683.499) -- 0:01:43

      Average standard deviation of split frequencies: 0.010138

      495500 -- (-1688.339) [-1675.487] (-1682.331) (-1676.438) * [-1676.082] (-1677.554) (-1676.484) (-1681.300) -- 0:01:42
      496000 -- (-1694.587) (-1676.095) [-1682.385] (-1694.850) * (-1687.325) [-1674.111] (-1674.386) (-1674.570) -- 0:01:42
      496500 -- (-1677.160) [-1674.973] (-1680.453) (-1673.135) * (-1690.952) [-1676.778] (-1680.876) (-1683.700) -- 0:01:42
      497000 -- (-1684.457) (-1672.847) (-1679.291) [-1672.922] * (-1693.136) (-1685.307) [-1675.529] (-1683.845) -- 0:01:42
      497500 -- (-1679.217) (-1681.165) [-1675.829] (-1689.524) * (-1681.362) (-1677.273) [-1686.327] (-1683.148) -- 0:01:42
      498000 -- (-1686.456) [-1677.368] (-1674.430) (-1671.264) * (-1676.823) (-1689.495) (-1686.618) [-1688.156] -- 0:01:41
      498500 -- (-1681.397) (-1680.654) (-1675.920) [-1673.438] * [-1684.514] (-1677.159) (-1676.684) (-1678.556) -- 0:01:41
      499000 -- [-1676.218] (-1684.994) (-1683.342) (-1678.071) * (-1675.583) (-1683.178) [-1674.710] (-1680.709) -- 0:01:42
      499500 -- [-1683.199] (-1680.123) (-1679.908) (-1678.139) * (-1683.777) (-1679.768) [-1677.245] (-1683.083) -- 0:01:42
      500000 -- [-1672.631] (-1681.748) (-1679.686) (-1674.005) * [-1681.378] (-1681.838) (-1675.948) (-1688.743) -- 0:01:42

      Average standard deviation of split frequencies: 0.009102

      500500 -- (-1673.854) (-1678.948) (-1679.193) [-1672.499] * (-1676.038) (-1681.232) [-1674.694] (-1680.191) -- 0:01:41
      501000 -- (-1670.567) (-1673.412) [-1676.012] (-1675.032) * (-1685.022) (-1682.765) [-1676.055] (-1677.815) -- 0:01:41
      501500 -- [-1678.407] (-1677.524) (-1679.070) (-1679.282) * (-1677.191) (-1678.717) [-1679.112] (-1683.885) -- 0:01:41
      502000 -- (-1682.528) (-1688.689) (-1681.693) [-1671.701] * (-1682.424) (-1680.068) (-1677.802) [-1679.851] -- 0:01:41
      502500 -- [-1685.778] (-1678.447) (-1685.240) (-1673.508) * (-1681.308) (-1678.755) [-1673.026] (-1682.420) -- 0:01:40
      503000 -- (-1684.567) (-1678.363) (-1675.048) [-1679.539] * (-1678.717) (-1674.603) [-1676.734] (-1687.509) -- 0:01:40
      503500 -- [-1682.856] (-1676.218) (-1676.249) (-1677.893) * [-1682.633] (-1678.533) (-1685.866) (-1677.606) -- 0:01:41
      504000 -- (-1678.576) (-1682.253) (-1680.195) [-1683.864] * [-1683.169] (-1674.453) (-1679.750) (-1687.564) -- 0:01:41
      504500 -- (-1679.491) (-1674.354) [-1680.120] (-1677.422) * (-1678.360) (-1675.230) [-1676.571] (-1683.304) -- 0:01:41
      505000 -- [-1674.715] (-1677.613) (-1681.394) (-1678.942) * (-1679.077) [-1673.175] (-1681.660) (-1678.997) -- 0:01:40

      Average standard deviation of split frequencies: 0.009316

      505500 -- (-1674.297) (-1676.246) [-1673.948] (-1679.580) * (-1675.477) (-1675.510) [-1673.274] (-1677.288) -- 0:01:40
      506000 -- [-1683.254] (-1681.458) (-1679.827) (-1674.720) * (-1681.601) [-1681.321] (-1684.225) (-1682.811) -- 0:01:40
      506500 -- (-1678.843) (-1675.859) (-1677.960) [-1672.629] * (-1672.448) (-1677.792) [-1676.335] (-1681.288) -- 0:01:40
      507000 -- (-1677.844) [-1677.346] (-1681.084) (-1677.919) * [-1675.080] (-1677.564) (-1674.191) (-1676.126) -- 0:01:40
      507500 -- (-1673.334) [-1673.607] (-1680.846) (-1681.155) * (-1684.496) (-1677.541) [-1676.307] (-1681.554) -- 0:01:39
      508000 -- (-1685.531) [-1671.025] (-1681.180) (-1677.944) * (-1677.308) (-1680.515) (-1676.659) [-1672.666] -- 0:01:39
      508500 -- (-1675.891) (-1685.151) [-1681.675] (-1677.822) * (-1680.920) [-1675.679] (-1675.147) (-1671.809) -- 0:01:40
      509000 -- (-1675.633) [-1678.124] (-1688.635) (-1682.706) * [-1671.947] (-1684.027) (-1672.326) (-1684.315) -- 0:01:40
      509500 -- (-1682.071) (-1678.837) (-1675.329) [-1676.785] * (-1679.341) (-1682.695) (-1680.352) [-1674.632] -- 0:01:40
      510000 -- (-1679.247) (-1676.108) [-1677.866] (-1686.203) * (-1678.789) (-1681.599) (-1674.069) [-1673.218] -- 0:01:39

      Average standard deviation of split frequencies: 0.008923

      510500 -- (-1674.155) (-1687.961) [-1675.193] (-1675.655) * (-1680.360) (-1683.155) (-1676.168) [-1676.759] -- 0:01:39
      511000 -- [-1674.567] (-1677.499) (-1676.844) (-1677.866) * (-1674.813) (-1679.851) [-1678.587] (-1677.494) -- 0:01:39
      511500 -- (-1676.477) (-1673.738) [-1683.137] (-1685.950) * (-1684.796) (-1674.127) [-1672.536] (-1674.443) -- 0:01:39
      512000 -- [-1678.875] (-1679.155) (-1683.347) (-1688.827) * (-1684.478) [-1673.275] (-1676.387) (-1680.419) -- 0:01:39
      512500 -- (-1689.355) [-1679.496] (-1678.797) (-1684.064) * (-1680.498) [-1680.587] (-1680.448) (-1678.023) -- 0:01:38
      513000 -- (-1677.294) (-1682.753) [-1673.849] (-1678.104) * (-1675.018) (-1679.488) (-1687.813) [-1673.845] -- 0:01:38
      513500 -- [-1674.986] (-1683.190) (-1679.392) (-1679.111) * [-1674.582] (-1680.479) (-1675.116) (-1683.750) -- 0:01:39
      514000 -- (-1682.271) [-1680.046] (-1673.461) (-1676.757) * (-1686.338) [-1681.641] (-1680.715) (-1677.788) -- 0:01:39
      514500 -- (-1679.078) [-1678.315] (-1672.695) (-1681.414) * (-1676.991) (-1683.165) (-1678.858) [-1679.514] -- 0:01:39
      515000 -- (-1677.934) (-1677.234) (-1676.755) [-1675.415] * (-1685.220) [-1681.275] (-1678.082) (-1678.779) -- 0:01:38

      Average standard deviation of split frequencies: 0.010049

      515500 -- (-1679.758) (-1674.772) (-1677.306) [-1675.700] * (-1685.191) (-1673.765) (-1682.029) [-1678.007] -- 0:01:38
      516000 -- (-1674.574) [-1675.571] (-1676.095) (-1677.563) * (-1683.691) (-1679.226) (-1674.057) [-1676.203] -- 0:01:38
      516500 -- (-1676.877) [-1674.539] (-1680.415) (-1686.704) * (-1686.633) (-1686.449) (-1674.066) [-1682.458] -- 0:01:38
      517000 -- (-1673.988) [-1678.893] (-1674.846) (-1673.891) * (-1692.520) [-1678.472] (-1675.195) (-1687.526) -- 0:01:38
      517500 -- (-1682.995) (-1678.110) [-1678.198] (-1684.827) * (-1680.992) [-1675.672] (-1675.847) (-1686.140) -- 0:01:37
      518000 -- (-1687.946) [-1676.587] (-1675.298) (-1676.811) * [-1677.227] (-1680.761) (-1680.640) (-1680.878) -- 0:01:38
      518500 -- (-1687.496) (-1678.532) [-1685.752] (-1680.035) * (-1680.606) (-1684.109) (-1674.387) [-1683.253] -- 0:01:38
      519000 -- (-1681.955) (-1679.385) [-1675.912] (-1680.221) * [-1674.273] (-1677.149) (-1678.261) (-1680.959) -- 0:01:38
      519500 -- (-1679.730) [-1676.080] (-1677.643) (-1675.585) * [-1678.017] (-1676.122) (-1671.994) (-1674.944) -- 0:01:38
      520000 -- [-1675.717] (-1683.506) (-1683.494) (-1679.782) * (-1679.779) (-1678.582) [-1677.284] (-1684.106) -- 0:01:37

      Average standard deviation of split frequencies: 0.009959

      520500 -- (-1681.613) (-1678.852) [-1680.545] (-1675.094) * (-1676.051) (-1675.424) [-1674.928] (-1683.011) -- 0:01:37
      521000 -- (-1691.841) (-1674.547) (-1682.139) [-1679.390] * (-1676.304) (-1686.122) (-1676.758) [-1680.608] -- 0:01:37
      521500 -- (-1677.032) (-1677.993) [-1672.644] (-1675.361) * (-1677.080) (-1683.311) [-1679.470] (-1684.013) -- 0:01:37
      522000 -- (-1680.153) (-1673.760) [-1673.570] (-1682.526) * (-1680.320) (-1692.349) [-1674.766] (-1675.428) -- 0:01:37
      522500 -- (-1682.910) (-1682.096) [-1672.821] (-1679.063) * [-1678.461] (-1676.890) (-1675.719) (-1674.892) -- 0:01:36
      523000 -- (-1681.966) (-1681.141) (-1676.011) [-1674.785] * [-1674.456] (-1688.041) (-1674.914) (-1678.245) -- 0:01:37
      523500 -- (-1679.560) (-1682.662) (-1677.496) [-1679.867] * (-1683.741) (-1675.780) [-1675.923] (-1674.215) -- 0:01:37
      524000 -- [-1683.187] (-1680.098) (-1675.096) (-1680.314) * (-1677.163) (-1680.540) [-1678.998] (-1676.406) -- 0:01:37
      524500 -- (-1681.096) [-1673.417] (-1687.182) (-1678.962) * (-1682.619) [-1675.504] (-1674.946) (-1674.763) -- 0:01:37
      525000 -- [-1681.047] (-1674.581) (-1683.254) (-1681.614) * (-1682.052) [-1679.289] (-1678.654) (-1678.208) -- 0:01:36

      Average standard deviation of split frequencies: 0.009560

      525500 -- (-1676.778) (-1674.107) (-1678.424) [-1673.720] * (-1683.743) (-1680.055) (-1677.132) [-1673.733] -- 0:01:36
      526000 -- [-1675.591] (-1686.049) (-1680.886) (-1677.140) * (-1674.662) (-1681.563) [-1677.064] (-1676.787) -- 0:01:36
      526500 -- [-1671.282] (-1668.979) (-1677.287) (-1685.939) * (-1676.052) (-1675.592) [-1678.784] (-1679.888) -- 0:01:36
      527000 -- (-1675.656) [-1673.671] (-1680.404) (-1694.320) * (-1681.669) [-1670.918] (-1678.766) (-1678.186) -- 0:01:36
      527500 -- [-1680.832] (-1681.784) (-1678.742) (-1680.347) * [-1676.167] (-1680.215) (-1675.408) (-1674.217) -- 0:01:35
      528000 -- (-1684.413) (-1674.482) [-1673.572] (-1678.130) * (-1684.498) [-1679.653] (-1672.932) (-1680.851) -- 0:01:36
      528500 -- [-1675.169] (-1681.060) (-1685.898) (-1679.429) * (-1678.347) (-1676.981) (-1683.960) [-1677.705] -- 0:01:36
      529000 -- (-1677.614) [-1674.033] (-1678.680) (-1677.934) * [-1674.767] (-1673.067) (-1679.148) (-1680.836) -- 0:01:36
      529500 -- (-1672.556) [-1672.491] (-1682.325) (-1671.811) * (-1675.464) (-1686.759) (-1673.225) [-1677.491] -- 0:01:35
      530000 -- (-1677.128) (-1677.022) (-1682.544) [-1670.283] * (-1684.788) [-1676.387] (-1679.048) (-1679.659) -- 0:01:35

      Average standard deviation of split frequencies: 0.009475

      530500 -- (-1687.948) [-1676.129] (-1678.822) (-1675.501) * (-1682.921) [-1679.170] (-1674.309) (-1677.741) -- 0:01:35
      531000 -- (-1684.738) (-1681.985) (-1682.239) [-1672.133] * (-1681.411) [-1677.504] (-1679.467) (-1678.737) -- 0:01:35
      531500 -- (-1680.010) (-1679.728) (-1677.235) [-1679.802] * (-1675.685) [-1674.359] (-1684.547) (-1685.827) -- 0:01:35
      532000 -- [-1675.318] (-1681.390) (-1680.067) (-1675.984) * [-1674.070] (-1679.837) (-1671.719) (-1675.544) -- 0:01:35
      532500 -- (-1677.014) [-1677.339] (-1684.338) (-1676.045) * [-1676.691] (-1680.592) (-1674.051) (-1686.477) -- 0:01:35
      533000 -- (-1676.505) [-1675.766] (-1684.176) (-1678.409) * (-1683.113) (-1679.279) [-1673.741] (-1672.737) -- 0:01:35
      533500 -- [-1677.047] (-1680.902) (-1675.861) (-1680.447) * (-1676.347) (-1674.307) [-1675.468] (-1687.465) -- 0:01:35
      534000 -- [-1680.012] (-1682.023) (-1676.705) (-1673.600) * (-1683.213) [-1677.184] (-1689.574) (-1681.832) -- 0:01:35
      534500 -- [-1668.201] (-1687.577) (-1672.467) (-1682.066) * (-1675.172) (-1681.133) (-1675.353) [-1674.839] -- 0:01:34
      535000 -- (-1673.872) (-1687.512) [-1671.483] (-1682.904) * (-1679.750) (-1680.822) [-1676.999] (-1682.152) -- 0:01:34

      Average standard deviation of split frequencies: 0.010261

      535500 -- [-1677.615] (-1678.961) (-1674.656) (-1677.184) * (-1680.378) [-1681.998] (-1680.451) (-1676.946) -- 0:01:34
      536000 -- (-1678.329) (-1670.534) (-1675.818) [-1677.799] * (-1674.889) [-1679.262] (-1678.050) (-1680.808) -- 0:01:34
      536500 -- (-1687.273) (-1676.697) [-1676.037] (-1686.105) * [-1677.051] (-1678.637) (-1687.135) (-1676.239) -- 0:01:34
      537000 -- [-1678.636] (-1683.385) (-1679.037) (-1680.626) * [-1677.295] (-1682.972) (-1681.067) (-1685.366) -- 0:01:33
      537500 -- (-1683.284) [-1677.385] (-1676.976) (-1672.526) * (-1680.355) [-1678.167] (-1678.506) (-1673.483) -- 0:01:34
      538000 -- (-1679.234) (-1685.156) [-1675.745] (-1680.376) * (-1672.907) (-1677.046) (-1680.110) [-1676.098] -- 0:01:34
      538500 -- [-1673.724] (-1675.091) (-1672.588) (-1680.864) * (-1671.623) (-1681.315) (-1681.137) [-1681.616] -- 0:01:34
      539000 -- (-1677.894) [-1676.094] (-1674.394) (-1675.819) * (-1678.392) (-1680.000) (-1688.158) [-1682.101] -- 0:01:34
      539500 -- (-1683.594) (-1688.383) [-1681.399] (-1682.273) * [-1676.727] (-1676.473) (-1681.211) (-1689.356) -- 0:01:33
      540000 -- (-1677.753) [-1677.894] (-1684.808) (-1680.073) * (-1680.707) (-1681.235) [-1676.196] (-1674.279) -- 0:01:33

      Average standard deviation of split frequencies: 0.010463

      540500 -- [-1671.706] (-1677.049) (-1681.372) (-1672.386) * (-1674.854) (-1676.808) (-1686.174) [-1674.865] -- 0:01:33
      541000 -- (-1690.165) (-1681.182) (-1689.822) [-1677.481] * (-1675.871) (-1677.984) (-1680.831) [-1676.845] -- 0:01:33
      541500 -- (-1680.581) (-1676.517) (-1681.209) [-1678.088] * [-1669.072] (-1682.578) (-1677.826) (-1685.585) -- 0:01:33
      542000 -- (-1675.853) (-1678.342) (-1676.539) [-1677.189] * [-1674.698] (-1684.602) (-1677.216) (-1681.977) -- 0:01:33
      542500 -- (-1679.219) (-1678.794) [-1671.769] (-1678.272) * (-1678.486) [-1676.542] (-1679.231) (-1671.666) -- 0:01:33
      543000 -- (-1690.036) [-1679.681] (-1670.379) (-1683.309) * (-1678.589) [-1673.543] (-1673.944) (-1679.680) -- 0:01:33
      543500 -- [-1673.731] (-1677.872) (-1680.728) (-1673.595) * (-1674.684) (-1679.214) (-1681.368) [-1676.747] -- 0:01:33
      544000 -- (-1684.117) (-1674.192) (-1674.563) [-1673.030] * (-1679.602) (-1672.195) [-1677.413] (-1674.952) -- 0:01:33
      544500 -- (-1690.667) (-1686.976) (-1682.684) [-1677.104] * (-1678.975) (-1681.964) (-1677.920) [-1680.313] -- 0:01:32
      545000 -- (-1677.966) [-1673.335] (-1677.523) (-1689.347) * [-1673.437] (-1678.355) (-1675.894) (-1682.331) -- 0:01:32

      Average standard deviation of split frequencies: 0.010504

      545500 -- (-1675.594) (-1683.155) (-1680.074) [-1674.832] * (-1671.927) [-1680.197] (-1681.945) (-1680.546) -- 0:01:32
      546000 -- (-1679.248) (-1676.840) (-1685.545) [-1675.384] * (-1676.304) [-1681.793] (-1682.138) (-1678.518) -- 0:01:32
      546500 -- (-1680.205) [-1672.503] (-1681.832) (-1685.399) * (-1692.820) [-1679.393] (-1680.701) (-1681.420) -- 0:01:32
      547000 -- (-1686.878) [-1673.506] (-1676.997) (-1680.007) * (-1677.498) (-1675.279) (-1676.946) [-1677.612] -- 0:01:32
      547500 -- [-1679.757] (-1676.665) (-1679.306) (-1689.896) * (-1680.204) (-1674.274) [-1678.990] (-1679.550) -- 0:01:32
      548000 -- [-1674.599] (-1680.506) (-1680.859) (-1682.846) * (-1676.858) (-1685.147) [-1674.857] (-1678.969) -- 0:01:32
      548500 -- [-1677.104] (-1680.155) (-1672.984) (-1678.657) * [-1672.556] (-1680.010) (-1675.657) (-1672.452) -- 0:01:32
      549000 -- (-1681.498) (-1677.340) (-1676.149) [-1681.390] * (-1679.980) (-1677.370) [-1671.486] (-1676.936) -- 0:01:32
      549500 -- (-1685.958) (-1681.805) [-1672.518] (-1673.117) * (-1681.672) (-1686.529) [-1673.739] (-1673.076) -- 0:01:31
      550000 -- [-1676.592] (-1682.106) (-1678.225) (-1687.718) * (-1673.520) (-1680.386) (-1678.740) [-1674.416] -- 0:01:31

      Average standard deviation of split frequencies: 0.011557

      550500 -- (-1690.775) (-1678.130) [-1674.194] (-1682.308) * (-1674.855) (-1683.223) [-1675.242] (-1677.703) -- 0:01:31
      551000 -- (-1677.863) (-1680.433) [-1676.810] (-1677.313) * (-1683.638) (-1683.112) (-1677.909) [-1680.746] -- 0:01:31
      551500 -- (-1680.842) (-1686.334) [-1676.597] (-1672.855) * [-1683.167] (-1684.752) (-1681.100) (-1677.857) -- 0:01:31
      552000 -- (-1676.892) (-1682.963) (-1679.085) [-1676.065] * (-1677.301) [-1679.900] (-1675.965) (-1677.417) -- 0:01:31
      552500 -- (-1676.888) (-1688.912) [-1672.721] (-1676.795) * (-1676.644) (-1677.492) (-1673.816) [-1674.518] -- 0:01:31
      553000 -- (-1677.937) [-1678.533] (-1671.392) (-1676.490) * (-1674.186) [-1674.571] (-1673.361) (-1675.017) -- 0:01:31
      553500 -- [-1673.882] (-1677.736) (-1679.579) (-1688.501) * (-1676.423) [-1671.331] (-1673.058) (-1678.427) -- 0:01:31
      554000 -- (-1685.273) (-1679.229) (-1677.380) [-1674.590] * (-1680.711) [-1675.813] (-1671.796) (-1678.171) -- 0:01:30
      554500 -- (-1678.407) (-1681.451) [-1679.637] (-1680.054) * (-1684.462) [-1673.802] (-1680.089) (-1678.488) -- 0:01:30
      555000 -- (-1680.057) (-1680.236) [-1675.085] (-1674.684) * [-1679.341] (-1677.684) (-1679.761) (-1675.715) -- 0:01:30

      Average standard deviation of split frequencies: 0.012011

      555500 -- (-1680.111) (-1684.403) [-1670.959] (-1679.686) * (-1680.398) (-1676.643) (-1684.297) [-1680.964] -- 0:01:30
      556000 -- [-1674.952] (-1672.289) (-1673.914) (-1682.285) * [-1673.030] (-1677.491) (-1684.949) (-1685.216) -- 0:01:30
      556500 -- [-1673.251] (-1678.682) (-1682.435) (-1675.724) * [-1675.990] (-1676.289) (-1679.158) (-1680.662) -- 0:01:30
      557000 -- (-1677.000) [-1676.048] (-1680.139) (-1680.552) * (-1675.429) (-1678.778) (-1678.420) [-1682.076] -- 0:01:30
      557500 -- (-1679.388) (-1678.134) [-1681.424] (-1674.995) * (-1681.477) [-1675.363] (-1677.482) (-1678.856) -- 0:01:30
      558000 -- [-1677.659] (-1676.239) (-1684.781) (-1690.865) * (-1680.265) (-1681.192) [-1676.633] (-1681.804) -- 0:01:30
      558500 -- (-1678.764) [-1676.506] (-1680.282) (-1679.089) * (-1678.221) (-1679.336) [-1681.308] (-1674.161) -- 0:01:30
      559000 -- (-1676.617) (-1689.011) (-1677.073) [-1677.089] * (-1679.323) (-1674.535) [-1676.875] (-1675.860) -- 0:01:29
      559500 -- [-1672.954] (-1675.324) (-1675.493) (-1682.273) * (-1675.041) [-1676.724] (-1681.283) (-1680.124) -- 0:01:29
      560000 -- [-1690.249] (-1679.985) (-1676.361) (-1685.094) * (-1682.757) (-1679.247) (-1683.052) [-1678.424] -- 0:01:29

      Average standard deviation of split frequencies: 0.011911

      560500 -- (-1681.547) (-1683.176) [-1683.046] (-1676.542) * (-1674.849) [-1674.224] (-1674.365) (-1681.834) -- 0:01:29
      561000 -- (-1691.838) (-1685.367) (-1683.957) [-1684.781] * (-1677.980) (-1675.083) [-1680.095] (-1675.335) -- 0:01:29
      561500 -- (-1686.236) (-1674.693) [-1674.621] (-1686.558) * [-1674.769] (-1677.224) (-1675.433) (-1677.078) -- 0:01:29
      562000 -- (-1684.267) [-1675.502] (-1678.763) (-1683.427) * (-1681.529) (-1682.617) (-1685.041) [-1680.045] -- 0:01:29
      562500 -- (-1684.126) [-1673.688] (-1694.497) (-1680.571) * (-1685.446) (-1679.402) (-1680.559) [-1679.266] -- 0:01:29
      563000 -- [-1684.792] (-1681.545) (-1689.415) (-1680.300) * (-1675.960) [-1677.069] (-1678.604) (-1681.968) -- 0:01:29
      563500 -- [-1677.070] (-1681.957) (-1688.716) (-1677.232) * (-1685.955) (-1687.377) [-1678.372] (-1684.113) -- 0:01:29
      564000 -- (-1681.570) (-1685.446) (-1689.812) [-1674.382] * (-1681.715) (-1679.954) (-1684.164) [-1678.362] -- 0:01:28
      564500 -- (-1676.437) (-1678.756) (-1675.669) [-1685.653] * [-1675.067] (-1678.366) (-1680.313) (-1680.974) -- 0:01:28
      565000 -- (-1676.962) (-1687.725) (-1682.536) [-1678.809] * [-1672.076] (-1681.591) (-1677.303) (-1685.210) -- 0:01:28

      Average standard deviation of split frequencies: 0.011521

      565500 -- [-1672.432] (-1679.571) (-1689.633) (-1683.168) * [-1675.451] (-1676.573) (-1679.648) (-1680.810) -- 0:01:28
      566000 -- (-1681.157) (-1681.793) (-1676.674) [-1680.227] * (-1683.982) (-1689.123) [-1674.611] (-1675.787) -- 0:01:28
      566500 -- [-1677.173] (-1690.112) (-1684.956) (-1674.088) * [-1678.777] (-1680.500) (-1676.813) (-1676.180) -- 0:01:28
      567000 -- (-1690.629) (-1674.410) (-1683.526) [-1672.965] * (-1675.181) (-1686.610) (-1677.075) [-1671.585] -- 0:01:28
      567500 -- (-1679.569) (-1676.443) (-1683.687) [-1677.896] * (-1685.766) (-1674.861) (-1683.273) [-1678.393] -- 0:01:28
      568000 -- (-1688.043) (-1674.235) (-1683.001) [-1683.318] * (-1679.525) (-1685.844) (-1674.291) [-1677.665] -- 0:01:28
      568500 -- [-1682.107] (-1678.379) (-1680.537) (-1678.684) * (-1677.545) (-1685.942) [-1678.278] (-1678.008) -- 0:01:28
      569000 -- (-1675.138) (-1685.868) (-1675.924) [-1683.423] * (-1676.866) (-1687.594) [-1677.072] (-1686.005) -- 0:01:27
      569500 -- [-1675.996] (-1676.364) (-1675.120) (-1684.415) * (-1683.527) [-1682.262] (-1682.039) (-1672.427) -- 0:01:27
      570000 -- [-1675.337] (-1679.965) (-1682.581) (-1673.407) * (-1677.398) (-1676.006) (-1679.424) [-1677.342] -- 0:01:27

      Average standard deviation of split frequencies: 0.011703

      570500 -- (-1675.198) (-1673.948) [-1672.388] (-1676.779) * (-1677.627) [-1674.898] (-1680.020) (-1670.761) -- 0:01:27
      571000 -- [-1676.471] (-1677.194) (-1671.341) (-1678.642) * [-1676.110] (-1676.860) (-1679.902) (-1675.235) -- 0:01:27
      571500 -- (-1674.638) (-1682.608) (-1682.212) [-1678.781] * [-1672.070] (-1675.981) (-1681.197) (-1684.137) -- 0:01:27
      572000 -- (-1680.167) (-1681.691) (-1678.820) [-1671.766] * (-1678.095) (-1674.117) [-1678.876] (-1681.310) -- 0:01:27
      572500 -- (-1676.702) (-1675.384) [-1676.030] (-1675.801) * (-1678.507) (-1678.747) [-1681.507] (-1686.631) -- 0:01:27
      573000 -- (-1681.953) (-1676.063) (-1678.721) [-1678.836] * [-1677.396] (-1675.303) (-1679.613) (-1669.464) -- 0:01:27
      573500 -- (-1679.108) [-1672.290] (-1679.103) (-1681.259) * (-1680.487) (-1675.696) (-1674.987) [-1672.129] -- 0:01:27
      574000 -- (-1679.720) (-1676.113) (-1688.671) [-1677.024] * (-1679.643) (-1677.085) (-1681.742) [-1676.353] -- 0:01:26
      574500 -- (-1684.192) (-1682.446) [-1676.334] (-1677.763) * (-1685.430) [-1689.533] (-1674.510) (-1675.819) -- 0:01:26
      575000 -- (-1676.211) [-1680.651] (-1676.525) (-1676.803) * [-1681.213] (-1677.142) (-1682.281) (-1674.060) -- 0:01:26

      Average standard deviation of split frequencies: 0.012140

      575500 -- (-1686.263) [-1674.906] (-1678.528) (-1673.944) * (-1683.554) (-1677.017) [-1672.911] (-1672.578) -- 0:01:26
      576000 -- [-1678.932] (-1672.942) (-1676.823) (-1675.475) * (-1676.783) [-1679.832] (-1686.872) (-1679.334) -- 0:01:26
      576500 -- (-1685.641) (-1677.379) (-1674.921) [-1682.495] * (-1681.808) (-1674.894) [-1687.047] (-1685.708) -- 0:01:26
      577000 -- (-1677.042) (-1682.303) (-1687.322) [-1675.522] * (-1676.407) (-1686.501) (-1679.322) [-1673.427] -- 0:01:26
      577500 -- [-1675.671] (-1686.346) (-1680.430) (-1680.067) * (-1680.564) (-1685.837) (-1683.374) [-1682.198] -- 0:01:26
      578000 -- (-1679.654) (-1684.425) (-1688.640) [-1677.457] * (-1676.189) (-1680.107) [-1671.752] (-1677.456) -- 0:01:26
      578500 -- [-1673.563] (-1691.546) (-1691.425) (-1684.838) * (-1676.631) [-1677.266] (-1677.794) (-1683.540) -- 0:01:25
      579000 -- (-1676.624) (-1675.054) [-1685.601] (-1677.650) * (-1678.469) [-1682.130] (-1676.822) (-1677.660) -- 0:01:25
      579500 -- (-1675.196) [-1679.776] (-1693.797) (-1675.915) * [-1680.629] (-1692.672) (-1677.548) (-1677.878) -- 0:01:25
      580000 -- (-1676.153) [-1675.796] (-1685.274) (-1685.472) * (-1678.187) (-1677.975) [-1673.735] (-1680.413) -- 0:01:25

      Average standard deviation of split frequencies: 0.012583

      580500 -- (-1678.936) [-1673.039] (-1682.613) (-1679.918) * (-1679.861) (-1677.660) (-1683.595) [-1673.741] -- 0:01:25
      581000 -- [-1673.143] (-1674.792) (-1677.613) (-1679.035) * (-1679.900) [-1677.533] (-1683.102) (-1678.808) -- 0:01:25
      581500 -- (-1678.550) [-1676.538] (-1685.103) (-1678.041) * [-1676.439] (-1676.248) (-1692.820) (-1682.672) -- 0:01:25
      582000 -- [-1672.823] (-1682.997) (-1682.928) (-1685.294) * (-1683.357) (-1676.152) (-1683.112) [-1680.442] -- 0:01:25
      582500 -- (-1678.453) (-1680.444) (-1679.238) [-1687.427] * (-1679.825) (-1679.634) (-1684.315) [-1670.604] -- 0:01:25
      583000 -- (-1692.798) (-1684.662) [-1674.989] (-1685.061) * [-1673.604] (-1687.051) (-1683.428) (-1675.768) -- 0:01:25
      583500 -- [-1684.763] (-1682.510) (-1678.834) (-1685.037) * (-1675.721) (-1685.524) [-1674.088] (-1675.755) -- 0:01:24
      584000 -- (-1676.489) (-1691.939) (-1677.124) [-1684.970] * (-1679.671) (-1679.351) (-1678.682) [-1673.845] -- 0:01:24
      584500 -- (-1686.225) [-1686.786] (-1687.066) (-1682.889) * (-1679.178) (-1683.196) (-1680.481) [-1680.922] -- 0:01:24
      585000 -- (-1684.912) (-1688.331) (-1677.739) [-1680.290] * [-1677.566] (-1677.981) (-1682.735) (-1679.548) -- 0:01:24

      Average standard deviation of split frequencies: 0.012469

      585500 -- (-1684.136) (-1680.693) [-1678.993] (-1674.268) * (-1676.335) [-1676.227] (-1689.932) (-1680.674) -- 0:01:24
      586000 -- (-1681.509) (-1678.669) (-1678.502) [-1678.225] * [-1679.854] (-1680.355) (-1683.519) (-1674.452) -- 0:01:24
      586500 -- (-1677.233) (-1676.946) (-1682.302) [-1679.078] * [-1676.848] (-1676.313) (-1678.668) (-1676.022) -- 0:01:24
      587000 -- (-1686.651) (-1674.074) (-1679.465) [-1680.736] * [-1675.024] (-1678.921) (-1683.122) (-1682.504) -- 0:01:24
      587500 -- [-1673.543] (-1674.611) (-1684.569) (-1679.637) * (-1676.740) [-1678.409] (-1679.873) (-1676.448) -- 0:01:24
      588000 -- (-1695.798) [-1677.958] (-1680.952) (-1683.816) * (-1680.512) (-1683.921) (-1685.557) [-1679.095] -- 0:01:24
      588500 -- [-1676.251] (-1685.463) (-1678.607) (-1673.132) * (-1678.385) [-1675.354] (-1676.236) (-1676.450) -- 0:01:23
      589000 -- (-1681.921) (-1679.784) (-1679.314) [-1671.417] * (-1674.693) [-1678.255] (-1691.681) (-1676.224) -- 0:01:23
      589500 -- (-1676.005) [-1674.731] (-1675.985) (-1680.547) * (-1678.256) [-1674.396] (-1692.305) (-1676.342) -- 0:01:23
      590000 -- (-1687.581) (-1682.063) (-1680.170) [-1673.746] * (-1680.912) (-1680.701) (-1676.032) [-1681.664] -- 0:01:23

      Average standard deviation of split frequencies: 0.012636

      590500 -- [-1680.962] (-1682.298) (-1678.303) (-1678.476) * (-1676.156) [-1682.155] (-1685.968) (-1683.750) -- 0:01:23
      591000 -- [-1679.024] (-1681.647) (-1672.649) (-1678.452) * [-1682.565] (-1685.573) (-1685.160) (-1684.513) -- 0:01:23
      591500 -- (-1677.204) (-1686.512) (-1676.908) [-1675.823] * (-1677.847) (-1678.166) [-1676.299] (-1678.725) -- 0:01:23
      592000 -- (-1677.042) (-1683.708) [-1680.963] (-1679.748) * (-1682.456) [-1674.429] (-1678.495) (-1675.741) -- 0:01:23
      592500 -- (-1676.597) (-1677.728) [-1677.773] (-1681.640) * (-1684.476) (-1679.046) (-1680.613) [-1680.243] -- 0:01:23
      593000 -- (-1685.255) (-1676.960) [-1679.142] (-1674.353) * (-1684.301) (-1681.810) [-1672.538] (-1679.402) -- 0:01:23
      593500 -- (-1688.825) [-1677.911] (-1677.731) (-1678.149) * (-1685.252) (-1689.257) (-1678.228) [-1678.056] -- 0:01:22
      594000 -- (-1686.129) (-1672.469) [-1674.095] (-1671.074) * (-1693.289) (-1689.907) [-1675.024] (-1682.518) -- 0:01:22
      594500 -- [-1673.410] (-1683.469) (-1675.241) (-1678.336) * (-1693.940) (-1679.387) (-1678.575) [-1672.808] -- 0:01:22
      595000 -- (-1682.465) (-1685.389) [-1681.085] (-1683.212) * (-1690.311) (-1680.576) [-1680.299] (-1681.023) -- 0:01:22

      Average standard deviation of split frequencies: 0.013051

      595500 -- (-1684.857) (-1678.988) (-1674.958) [-1678.690] * (-1691.447) (-1680.402) (-1675.715) [-1677.849] -- 0:01:22
      596000 -- (-1684.184) (-1670.567) [-1682.053] (-1674.336) * (-1690.441) (-1683.961) (-1680.543) [-1674.561] -- 0:01:22
      596500 -- (-1676.572) [-1680.982] (-1681.800) (-1686.914) * [-1681.206] (-1681.705) (-1680.311) (-1672.753) -- 0:01:22
      597000 -- (-1674.717) (-1678.600) [-1675.364] (-1677.380) * (-1684.239) (-1680.549) [-1677.840] (-1681.989) -- 0:01:22
      597500 -- (-1678.011) [-1677.123] (-1673.835) (-1680.819) * [-1682.182] (-1675.328) (-1674.588) (-1681.437) -- 0:01:22
      598000 -- [-1676.828] (-1680.117) (-1676.750) (-1686.566) * (-1680.507) (-1678.786) (-1686.174) [-1687.116] -- 0:01:22
      598500 -- (-1680.841) (-1675.365) [-1679.790] (-1674.168) * (-1676.530) [-1677.549] (-1684.843) (-1677.956) -- 0:01:21
      599000 -- (-1678.632) (-1679.386) [-1681.092] (-1673.834) * (-1678.215) (-1681.411) [-1674.823] (-1685.374) -- 0:01:21
      599500 -- (-1681.434) [-1680.057] (-1677.835) (-1685.950) * (-1678.869) (-1678.756) [-1679.838] (-1681.937) -- 0:01:21
      600000 -- (-1687.507) (-1677.952) [-1675.399] (-1684.993) * [-1674.859] (-1679.794) (-1675.530) (-1679.184) -- 0:01:21

      Average standard deviation of split frequencies: 0.012688

      600500 -- [-1676.855] (-1677.435) (-1681.912) (-1675.599) * (-1676.554) [-1679.357] (-1678.130) (-1681.728) -- 0:01:21
      601000 -- (-1680.353) [-1676.688] (-1676.467) (-1679.401) * (-1680.933) (-1677.459) [-1676.530] (-1678.081) -- 0:01:21
      601500 -- [-1678.813] (-1676.575) (-1678.651) (-1676.279) * [-1680.439] (-1680.940) (-1676.339) (-1681.622) -- 0:01:21
      602000 -- (-1681.926) (-1678.461) [-1678.501] (-1682.852) * (-1678.154) (-1687.003) (-1680.330) [-1668.576] -- 0:01:21
      602500 -- (-1677.964) (-1676.314) [-1674.892] (-1682.317) * [-1676.768] (-1684.692) (-1681.393) (-1676.010) -- 0:01:21
      603000 -- (-1679.124) (-1681.569) [-1676.059] (-1678.720) * [-1675.227] (-1682.874) (-1681.750) (-1674.668) -- 0:01:20
      603500 -- (-1680.686) (-1682.598) (-1684.162) [-1679.908] * (-1687.204) [-1678.608] (-1678.560) (-1677.353) -- 0:01:20
      604000 -- [-1679.575] (-1681.222) (-1677.369) (-1679.855) * (-1688.185) [-1673.998] (-1686.390) (-1679.644) -- 0:01:20
      604500 -- (-1681.566) (-1676.562) (-1676.948) [-1681.004] * (-1682.236) (-1674.031) (-1681.706) [-1673.931] -- 0:01:20
      605000 -- (-1673.191) (-1676.236) [-1674.916] (-1679.185) * (-1690.028) (-1676.187) [-1675.649] (-1676.584) -- 0:01:20

      Average standard deviation of split frequencies: 0.013354

      605500 -- [-1681.653] (-1671.024) (-1676.410) (-1684.122) * (-1679.744) [-1672.550] (-1682.876) (-1684.126) -- 0:01:20
      606000 -- (-1674.317) (-1672.331) [-1670.577] (-1684.500) * (-1675.196) (-1675.986) (-1686.102) [-1680.421] -- 0:01:20
      606500 -- (-1672.566) (-1674.813) [-1678.571] (-1682.510) * (-1679.557) (-1679.505) [-1682.621] (-1686.224) -- 0:01:20
      607000 -- (-1677.836) (-1677.976) [-1678.408] (-1683.534) * [-1675.277] (-1676.736) (-1683.474) (-1683.494) -- 0:01:20
      607500 -- (-1674.296) (-1677.005) [-1676.363] (-1677.724) * (-1684.749) [-1676.500] (-1679.328) (-1682.045) -- 0:01:20
      608000 -- (-1680.562) (-1680.087) [-1680.686] (-1687.454) * (-1681.492) (-1681.772) [-1682.953] (-1688.111) -- 0:01:19
      608500 -- (-1675.117) (-1669.167) (-1686.085) [-1677.005] * [-1681.465] (-1675.529) (-1681.880) (-1673.980) -- 0:01:19
      609000 -- (-1680.804) (-1679.017) [-1682.744] (-1676.116) * (-1677.320) [-1671.845] (-1681.777) (-1676.035) -- 0:01:19
      609500 -- [-1676.980] (-1683.267) (-1681.957) (-1690.267) * (-1679.026) [-1671.180] (-1682.879) (-1675.479) -- 0:01:19
      610000 -- (-1677.439) (-1694.739) (-1674.060) [-1680.091] * (-1678.887) [-1677.477] (-1679.183) (-1673.021) -- 0:01:19

      Average standard deviation of split frequencies: 0.013252

      610500 -- [-1680.236] (-1691.418) (-1681.162) (-1677.717) * [-1680.484] (-1673.332) (-1674.805) (-1675.895) -- 0:01:19
      611000 -- [-1677.540] (-1690.348) (-1677.735) (-1681.035) * [-1676.481] (-1679.540) (-1679.381) (-1685.655) -- 0:01:19
      611500 -- (-1679.812) (-1681.963) [-1676.694] (-1682.822) * (-1684.844) (-1679.827) [-1674.456] (-1676.691) -- 0:01:19
      612000 -- (-1682.497) (-1683.204) [-1677.226] (-1674.429) * (-1686.777) (-1681.787) (-1689.348) [-1679.377] -- 0:01:19
      612500 -- (-1676.256) [-1683.826] (-1675.223) (-1679.625) * (-1681.499) (-1682.610) (-1678.779) [-1675.002] -- 0:01:19
      613000 -- (-1678.412) (-1673.319) [-1674.808] (-1677.621) * (-1683.600) [-1688.437] (-1678.839) (-1678.886) -- 0:01:18
      613500 -- (-1677.777) (-1682.211) [-1676.171] (-1676.550) * (-1683.156) [-1673.300] (-1679.480) (-1673.564) -- 0:01:18
      614000 -- (-1675.229) (-1688.570) [-1671.846] (-1679.849) * (-1686.262) [-1679.598] (-1683.245) (-1675.518) -- 0:01:18
      614500 -- [-1673.610] (-1675.334) (-1673.675) (-1679.008) * [-1679.551] (-1684.557) (-1676.146) (-1678.703) -- 0:01:19
      615000 -- (-1677.951) (-1680.766) [-1681.496] (-1675.327) * [-1679.692] (-1682.846) (-1680.994) (-1680.391) -- 0:01:18

      Average standard deviation of split frequencies: 0.012627

      615500 -- (-1680.621) (-1684.170) [-1680.058] (-1676.176) * (-1675.377) (-1679.750) [-1680.864] (-1681.040) -- 0:01:18
      616000 -- (-1680.362) (-1679.606) [-1669.927] (-1678.117) * [-1674.366] (-1677.308) (-1676.409) (-1670.958) -- 0:01:18
      616500 -- (-1681.298) (-1683.829) [-1675.101] (-1684.449) * (-1693.886) [-1680.149] (-1678.710) (-1677.620) -- 0:01:18
      617000 -- (-1683.300) (-1675.741) (-1686.999) [-1672.334] * [-1679.844] (-1674.798) (-1679.610) (-1678.139) -- 0:01:18
      617500 -- [-1678.050] (-1688.517) (-1681.382) (-1677.674) * [-1675.436] (-1675.478) (-1681.419) (-1675.543) -- 0:01:18
      618000 -- (-1681.211) [-1677.012] (-1678.512) (-1674.481) * (-1676.159) (-1681.015) (-1678.746) [-1674.814] -- 0:01:17
      618500 -- (-1686.956) (-1675.429) [-1680.208] (-1673.914) * (-1683.588) (-1677.991) (-1678.169) [-1676.040] -- 0:01:17
      619000 -- (-1677.147) [-1672.939] (-1680.029) (-1672.829) * [-1677.902] (-1678.761) (-1673.461) (-1674.713) -- 0:01:17
      619500 -- (-1679.858) [-1679.565] (-1675.092) (-1674.931) * (-1675.239) (-1680.335) (-1683.072) [-1677.985] -- 0:01:18
      620000 -- (-1677.180) (-1687.160) (-1685.030) [-1672.672] * [-1677.651] (-1679.326) (-1676.896) (-1678.167) -- 0:01:17

      Average standard deviation of split frequencies: 0.012026

      620500 -- (-1676.687) [-1682.424] (-1672.443) (-1677.056) * (-1677.158) (-1682.291) [-1670.246] (-1685.823) -- 0:01:17
      621000 -- [-1681.552] (-1678.809) (-1675.017) (-1681.102) * (-1681.962) (-1675.708) [-1683.800] (-1671.633) -- 0:01:17
      621500 -- (-1677.876) (-1675.846) (-1675.742) [-1681.983] * (-1674.265) (-1685.112) (-1671.884) [-1678.440] -- 0:01:17
      622000 -- (-1676.690) [-1681.360] (-1677.274) (-1679.176) * (-1676.334) (-1674.448) [-1679.977] (-1675.148) -- 0:01:17
      622500 -- (-1679.150) (-1682.627) (-1678.980) [-1678.887] * (-1681.292) (-1676.386) [-1675.650] (-1674.021) -- 0:01:17
      623000 -- [-1678.876] (-1682.305) (-1672.350) (-1679.060) * (-1673.890) (-1676.805) [-1685.741] (-1674.448) -- 0:01:16
      623500 -- (-1684.782) [-1671.605] (-1683.557) (-1684.660) * (-1679.946) (-1678.460) (-1671.557) [-1674.182] -- 0:01:16
      624000 -- [-1672.528] (-1680.056) (-1674.664) (-1688.831) * (-1675.232) (-1675.272) [-1676.544] (-1680.067) -- 0:01:16
      624500 -- (-1688.711) (-1681.266) [-1675.508] (-1690.484) * [-1671.699] (-1674.218) (-1677.134) (-1675.484) -- 0:01:16
      625000 -- (-1679.983) (-1672.821) [-1682.194] (-1684.980) * (-1674.410) (-1685.266) (-1677.378) [-1674.585] -- 0:01:16

      Average standard deviation of split frequencies: 0.012300

      625500 -- [-1674.216] (-1677.833) (-1678.714) (-1687.455) * [-1678.295] (-1677.993) (-1675.682) (-1675.407) -- 0:01:16
      626000 -- (-1677.913) [-1674.011] (-1672.190) (-1683.481) * (-1674.151) (-1671.720) (-1679.937) [-1677.516] -- 0:01:16
      626500 -- [-1677.227] (-1676.837) (-1676.670) (-1672.691) * (-1678.393) (-1677.770) (-1685.575) [-1680.669] -- 0:01:16
      627000 -- [-1680.676] (-1678.611) (-1676.814) (-1678.691) * (-1680.646) [-1677.320] (-1678.431) (-1681.021) -- 0:01:16
      627500 -- [-1677.396] (-1678.722) (-1678.572) (-1693.428) * (-1673.692) (-1671.217) (-1677.669) [-1674.419] -- 0:01:15
      628000 -- [-1677.596] (-1687.988) (-1671.105) (-1680.528) * (-1670.536) (-1674.622) (-1677.715) [-1673.608] -- 0:01:15
      628500 -- (-1686.228) (-1677.497) [-1676.684] (-1675.872) * [-1676.930] (-1675.270) (-1685.550) (-1678.959) -- 0:01:15
      629000 -- (-1693.240) (-1678.714) [-1674.389] (-1680.367) * (-1673.910) [-1677.596] (-1676.788) (-1681.832) -- 0:01:16
      629500 -- (-1687.932) [-1676.025] (-1681.618) (-1675.757) * (-1686.109) (-1687.062) (-1685.638) [-1677.424] -- 0:01:15
      630000 -- (-1679.041) (-1674.955) (-1674.762) [-1684.084] * (-1689.472) (-1682.783) [-1687.533] (-1674.834) -- 0:01:15

      Average standard deviation of split frequencies: 0.011337

      630500 -- (-1675.657) [-1678.104] (-1684.996) (-1679.313) * (-1686.056) (-1682.859) [-1676.965] (-1682.600) -- 0:01:15
      631000 -- (-1678.152) (-1680.973) (-1680.779) [-1682.292] * (-1683.474) (-1678.501) [-1680.847] (-1677.428) -- 0:01:15
      631500 -- [-1677.245] (-1678.695) (-1683.220) (-1683.503) * (-1681.503) (-1675.912) [-1678.206] (-1683.297) -- 0:01:15
      632000 -- (-1676.990) [-1676.358] (-1680.178) (-1680.116) * (-1689.530) (-1674.408) (-1682.549) [-1676.094] -- 0:01:15
      632500 -- (-1676.027) (-1678.008) [-1676.231] (-1677.025) * [-1679.176] (-1681.828) (-1671.119) (-1676.749) -- 0:01:14
      633000 -- [-1680.613] (-1679.444) (-1686.409) (-1685.816) * (-1674.840) (-1682.075) (-1675.636) [-1678.484] -- 0:01:14
      633500 -- (-1677.955) (-1684.939) [-1676.057] (-1684.191) * [-1676.099] (-1681.801) (-1683.571) (-1682.621) -- 0:01:14
      634000 -- [-1674.665] (-1679.656) (-1673.237) (-1693.939) * [-1671.930] (-1674.285) (-1678.654) (-1687.320) -- 0:01:15
      634500 -- (-1675.388) (-1681.319) [-1678.638] (-1684.558) * (-1697.757) (-1675.132) [-1672.685] (-1679.954) -- 0:01:14
      635000 -- (-1685.090) [-1672.262] (-1681.748) (-1679.671) * (-1681.668) (-1678.133) [-1676.049] (-1683.558) -- 0:01:14

      Average standard deviation of split frequencies: 0.011736

      635500 -- (-1680.211) [-1674.274] (-1677.483) (-1677.109) * (-1676.656) (-1677.955) (-1682.837) [-1676.984] -- 0:01:14
      636000 -- (-1689.566) [-1679.429] (-1675.524) (-1683.517) * (-1681.461) [-1684.678] (-1682.718) (-1674.264) -- 0:01:14
      636500 -- [-1680.550] (-1676.003) (-1682.382) (-1671.762) * [-1676.960] (-1676.344) (-1681.687) (-1677.456) -- 0:01:14
      637000 -- (-1678.743) [-1681.400] (-1680.999) (-1675.392) * (-1680.079) (-1680.387) [-1686.651] (-1683.489) -- 0:01:14
      637500 -- (-1682.560) (-1675.114) (-1682.988) [-1678.899] * (-1683.002) [-1678.207] (-1680.089) (-1678.391) -- 0:01:13
      638000 -- [-1678.207] (-1685.202) (-1677.479) (-1680.027) * (-1689.199) (-1676.021) [-1676.738] (-1681.335) -- 0:01:13
      638500 -- (-1685.966) [-1682.845] (-1679.082) (-1674.445) * (-1672.979) [-1672.135] (-1676.676) (-1687.630) -- 0:01:13
      639000 -- (-1682.910) [-1679.240] (-1678.013) (-1674.001) * (-1673.790) (-1677.141) (-1686.358) [-1677.699] -- 0:01:14
      639500 -- [-1683.311] (-1676.476) (-1678.783) (-1676.075) * (-1679.942) [-1676.463] (-1673.401) (-1680.445) -- 0:01:13
      640000 -- (-1680.610) [-1675.908] (-1677.537) (-1681.815) * [-1680.341] (-1685.878) (-1676.434) (-1678.741) -- 0:01:13

      Average standard deviation of split frequencies: 0.012018

      640500 -- (-1674.728) [-1678.432] (-1681.334) (-1675.408) * (-1682.031) [-1679.516] (-1679.805) (-1677.341) -- 0:01:13
      641000 -- (-1675.798) (-1680.720) (-1684.854) [-1677.100] * (-1688.981) (-1678.894) (-1676.346) [-1678.521] -- 0:01:13
      641500 -- (-1680.308) [-1686.200] (-1693.437) (-1678.248) * (-1679.930) [-1671.317] (-1688.658) (-1676.344) -- 0:01:13
      642000 -- [-1681.749] (-1678.812) (-1681.669) (-1687.254) * (-1680.796) (-1681.332) (-1683.612) [-1681.565] -- 0:01:13
      642500 -- (-1684.184) [-1678.858] (-1676.879) (-1698.125) * (-1683.028) [-1678.256] (-1680.271) (-1684.793) -- 0:01:12
      643000 -- (-1679.434) [-1678.697] (-1682.541) (-1687.055) * (-1682.253) [-1680.024] (-1681.350) (-1680.315) -- 0:01:12
      643500 -- [-1679.801] (-1675.582) (-1676.625) (-1676.932) * [-1677.242] (-1680.946) (-1676.904) (-1685.303) -- 0:01:13
      644000 -- (-1680.193) (-1681.790) [-1672.820] (-1679.823) * (-1678.880) (-1680.692) [-1680.129] (-1678.016) -- 0:01:12
      644500 -- [-1677.572] (-1684.115) (-1672.136) (-1682.438) * (-1676.387) (-1672.336) (-1682.376) [-1680.127] -- 0:01:12
      645000 -- (-1681.102) (-1675.114) [-1676.756] (-1679.985) * (-1677.335) (-1689.681) [-1676.282] (-1680.713) -- 0:01:12

      Average standard deviation of split frequencies: 0.010703

      645500 -- (-1682.063) [-1679.936] (-1676.911) (-1673.897) * (-1691.494) (-1675.199) (-1678.385) [-1673.093] -- 0:01:12
      646000 -- (-1676.843) (-1678.602) [-1677.319] (-1674.664) * (-1684.824) [-1674.730] (-1673.126) (-1686.458) -- 0:01:12
      646500 -- (-1682.886) [-1684.401] (-1677.854) (-1676.204) * [-1679.897] (-1688.104) (-1674.425) (-1682.585) -- 0:01:12
      647000 -- (-1679.214) (-1673.760) [-1677.223] (-1675.334) * (-1680.137) (-1677.802) [-1678.071] (-1688.647) -- 0:01:12
      647500 -- (-1680.374) [-1672.147] (-1677.707) (-1679.098) * (-1680.439) (-1679.201) [-1677.981] (-1671.897) -- 0:01:11
      648000 -- (-1686.904) [-1677.308] (-1678.504) (-1686.212) * (-1681.159) (-1686.753) [-1677.265] (-1682.165) -- 0:01:11
      648500 -- (-1681.387) [-1670.373] (-1677.826) (-1688.818) * (-1680.342) (-1671.895) [-1681.812] (-1678.294) -- 0:01:12
      649000 -- [-1674.556] (-1678.842) (-1669.708) (-1684.644) * (-1676.394) (-1677.658) [-1674.758] (-1683.545) -- 0:01:11
      649500 -- [-1674.007] (-1679.703) (-1678.482) (-1674.119) * (-1676.114) [-1678.523] (-1675.060) (-1673.223) -- 0:01:11
      650000 -- (-1676.415) (-1689.008) (-1675.600) [-1673.781] * (-1684.722) [-1684.630] (-1679.441) (-1676.909) -- 0:01:11

      Average standard deviation of split frequencies: 0.010867

      650500 -- [-1678.009] (-1680.146) (-1680.649) (-1674.392) * (-1676.571) [-1673.268] (-1680.281) (-1680.797) -- 0:01:11
      651000 -- [-1677.295] (-1680.129) (-1680.189) (-1677.725) * [-1676.062] (-1676.896) (-1676.517) (-1680.693) -- 0:01:11
      651500 -- (-1680.557) (-1676.342) (-1681.911) [-1674.320] * (-1680.128) (-1672.471) (-1691.563) [-1680.229] -- 0:01:11
      652000 -- (-1679.455) (-1678.461) (-1676.255) [-1679.960] * [-1676.656] (-1672.731) (-1675.492) (-1678.939) -- 0:01:10
      652500 -- (-1684.122) [-1674.257] (-1680.823) (-1681.810) * [-1674.104] (-1676.493) (-1676.154) (-1682.546) -- 0:01:10
      653000 -- (-1691.914) [-1673.193] (-1677.214) (-1683.501) * (-1670.514) [-1677.869] (-1678.208) (-1682.533) -- 0:01:11
      653500 -- (-1683.893) [-1677.549] (-1681.111) (-1682.889) * (-1678.054) (-1676.603) [-1678.894] (-1679.809) -- 0:01:11
      654000 -- (-1680.160) (-1676.087) (-1678.607) [-1680.371] * [-1675.125] (-1677.234) (-1679.467) (-1675.930) -- 0:01:10
      654500 -- (-1685.513) (-1687.630) [-1680.368] (-1679.760) * [-1674.705] (-1677.449) (-1680.204) (-1680.035) -- 0:01:10
      655000 -- (-1679.809) (-1684.252) [-1680.744] (-1682.385) * (-1682.565) [-1690.596] (-1674.605) (-1680.412) -- 0:01:10

      Average standard deviation of split frequencies: 0.010779

      655500 -- (-1687.412) (-1672.955) [-1682.463] (-1680.827) * [-1677.635] (-1679.616) (-1680.744) (-1688.962) -- 0:01:10
      656000 -- (-1688.493) (-1674.323) (-1680.170) [-1675.959] * (-1678.619) [-1679.643] (-1681.817) (-1678.213) -- 0:01:10
      656500 -- (-1694.225) [-1677.953] (-1678.235) (-1674.857) * (-1677.601) (-1677.776) [-1674.274] (-1679.069) -- 0:01:10
      657000 -- (-1683.394) (-1680.121) (-1683.294) [-1680.729] * (-1674.902) (-1676.037) (-1682.143) [-1680.013] -- 0:01:09
      657500 -- (-1687.910) (-1675.442) (-1689.750) [-1675.690] * (-1679.320) (-1680.090) [-1678.680] (-1683.853) -- 0:01:09
      658000 -- (-1681.908) (-1670.722) [-1676.291] (-1675.865) * (-1673.669) [-1680.583] (-1683.780) (-1688.327) -- 0:01:10
      658500 -- (-1681.489) (-1677.026) [-1679.104] (-1675.790) * (-1674.198) (-1679.923) [-1676.592] (-1680.164) -- 0:01:10
      659000 -- (-1677.910) (-1676.357) [-1683.811] (-1680.861) * (-1684.000) (-1676.602) [-1672.887] (-1673.236) -- 0:01:09
      659500 -- (-1680.473) [-1675.686] (-1683.054) (-1673.693) * (-1684.272) (-1676.023) [-1676.196] (-1675.111) -- 0:01:09
      660000 -- (-1681.717) [-1675.211] (-1674.500) (-1681.542) * (-1675.797) (-1677.657) (-1674.303) [-1674.590] -- 0:01:09

      Average standard deviation of split frequencies: 0.011535

      660500 -- (-1681.485) [-1682.497] (-1677.008) (-1679.227) * [-1671.915] (-1674.657) (-1674.866) (-1685.511) -- 0:01:09
      661000 -- (-1679.121) (-1689.132) (-1674.906) [-1681.681] * (-1684.798) [-1681.607] (-1681.539) (-1682.253) -- 0:01:09
      661500 -- (-1682.834) (-1686.013) (-1679.907) [-1679.248] * (-1683.027) (-1681.141) (-1677.463) [-1678.991] -- 0:01:09
      662000 -- [-1680.456] (-1687.763) (-1682.910) (-1673.988) * [-1676.964] (-1683.001) (-1678.379) (-1684.808) -- 0:01:08
      662500 -- (-1685.098) [-1674.029] (-1682.817) (-1674.895) * (-1683.793) [-1671.204] (-1670.346) (-1687.925) -- 0:01:08
      663000 -- (-1672.041) (-1685.158) (-1677.177) [-1675.224] * (-1686.042) (-1677.173) [-1674.969] (-1678.924) -- 0:01:09
      663500 -- (-1690.678) [-1676.589] (-1676.174) (-1678.004) * (-1678.346) (-1675.394) (-1683.421) [-1677.606] -- 0:01:08
      664000 -- (-1676.977) (-1675.416) (-1679.036) [-1675.839] * [-1676.065] (-1684.013) (-1682.225) (-1672.800) -- 0:01:08
      664500 -- (-1684.123) [-1677.827] (-1680.696) (-1678.488) * (-1675.176) [-1678.815] (-1679.227) (-1678.398) -- 0:01:08
      665000 -- [-1682.112] (-1678.542) (-1681.677) (-1684.011) * [-1673.945] (-1675.730) (-1686.278) (-1675.343) -- 0:01:08

      Average standard deviation of split frequencies: 0.010971

      665500 -- (-1676.642) (-1682.663) (-1680.534) [-1674.426] * (-1685.893) (-1677.159) (-1690.170) [-1673.687] -- 0:01:08
      666000 -- (-1673.812) (-1675.599) (-1683.822) [-1674.782] * (-1676.417) (-1678.835) [-1675.210] (-1676.072) -- 0:01:08
      666500 -- (-1683.255) (-1680.850) [-1677.688] (-1679.734) * (-1675.359) [-1676.300] (-1679.933) (-1679.091) -- 0:01:08
      667000 -- [-1677.941] (-1683.593) (-1677.149) (-1681.685) * (-1684.250) (-1681.342) (-1677.789) [-1681.095] -- 0:01:07
      667500 -- (-1678.302) (-1685.417) [-1675.480] (-1682.422) * (-1683.105) [-1674.145] (-1680.036) (-1675.543) -- 0:01:07
      668000 -- (-1682.906) (-1675.512) [-1672.348] (-1683.487) * (-1679.452) (-1678.258) [-1680.741] (-1679.873) -- 0:01:08
      668500 -- [-1676.993] (-1681.905) (-1681.817) (-1679.017) * [-1671.525] (-1679.862) (-1681.784) (-1679.195) -- 0:01:07
      669000 -- (-1682.820) (-1678.702) [-1674.967] (-1683.268) * (-1673.335) (-1676.532) (-1682.492) [-1670.187] -- 0:01:07
      669500 -- (-1676.167) (-1676.321) (-1681.101) [-1673.055] * (-1684.695) (-1677.166) (-1672.116) [-1677.108] -- 0:01:07
      670000 -- (-1678.167) (-1676.431) (-1684.705) [-1676.818] * (-1678.848) (-1684.715) (-1676.434) [-1677.663] -- 0:01:07

      Average standard deviation of split frequencies: 0.011363

      670500 -- (-1675.376) (-1681.829) (-1682.996) [-1682.346] * (-1679.043) [-1676.548] (-1683.280) (-1680.419) -- 0:01:07
      671000 -- (-1681.461) [-1677.051] (-1693.568) (-1682.474) * [-1676.906] (-1683.313) (-1679.638) (-1682.236) -- 0:01:07
      671500 -- (-1693.027) [-1687.728] (-1690.189) (-1678.126) * [-1675.473] (-1678.633) (-1674.418) (-1678.017) -- 0:01:07
      672000 -- [-1677.555] (-1680.676) (-1685.748) (-1681.963) * [-1671.985] (-1684.365) (-1673.243) (-1680.422) -- 0:01:06
      672500 -- (-1674.657) (-1676.021) [-1675.273] (-1675.143) * (-1681.593) [-1676.033] (-1681.690) (-1682.149) -- 0:01:07
      673000 -- [-1674.739] (-1686.795) (-1678.267) (-1679.381) * (-1685.287) [-1681.237] (-1678.825) (-1675.108) -- 0:01:07
      673500 -- [-1679.026] (-1678.437) (-1676.925) (-1676.676) * (-1677.758) [-1673.818] (-1686.063) (-1675.195) -- 0:01:06
      674000 -- (-1681.665) [-1676.173] (-1683.537) (-1676.374) * (-1684.941) [-1681.836] (-1679.992) (-1680.873) -- 0:01:06
      674500 -- (-1680.243) (-1679.604) (-1671.463) [-1681.665] * (-1687.019) (-1675.058) (-1684.077) [-1678.496] -- 0:01:06
      675000 -- (-1683.905) (-1676.718) (-1678.357) [-1671.462] * (-1690.907) (-1687.819) [-1674.826] (-1689.233) -- 0:01:06

      Average standard deviation of split frequencies: 0.011739

      675500 -- (-1686.081) (-1675.879) (-1670.019) [-1679.423] * (-1676.081) (-1675.641) [-1671.268] (-1679.868) -- 0:01:06
      676000 -- (-1677.250) [-1674.783] (-1678.945) (-1675.085) * (-1674.245) (-1683.246) (-1680.424) [-1676.797] -- 0:01:06
      676500 -- (-1672.197) (-1676.448) (-1678.329) [-1673.750] * [-1681.362] (-1674.865) (-1678.451) (-1680.009) -- 0:01:05
      677000 -- (-1677.485) (-1674.365) [-1676.014] (-1689.294) * (-1685.835) [-1687.700] (-1681.088) (-1677.850) -- 0:01:05
      677500 -- (-1680.492) [-1676.387] (-1678.327) (-1687.038) * [-1685.908] (-1675.507) (-1676.224) (-1675.527) -- 0:01:06
      678000 -- [-1680.728] (-1688.970) (-1685.734) (-1676.323) * [-1674.607] (-1678.860) (-1685.848) (-1681.161) -- 0:01:06
      678500 -- [-1679.341] (-1683.421) (-1683.656) (-1678.381) * [-1680.209] (-1690.214) (-1675.490) (-1676.429) -- 0:01:05
      679000 -- (-1684.752) [-1681.581] (-1675.641) (-1675.120) * (-1673.942) (-1677.228) (-1682.615) [-1678.125] -- 0:01:05
      679500 -- (-1686.461) (-1676.987) (-1683.618) [-1674.945] * [-1676.180] (-1675.188) (-1676.287) (-1671.433) -- 0:01:05
      680000 -- (-1676.811) (-1682.052) [-1678.994] (-1672.298) * [-1674.735] (-1671.001) (-1674.245) (-1674.172) -- 0:01:05

      Average standard deviation of split frequencies: 0.011889

      680500 -- (-1693.568) (-1682.126) (-1682.995) [-1672.351] * (-1678.932) (-1677.516) [-1676.345] (-1673.763) -- 0:01:05
      681000 -- (-1671.087) (-1680.025) [-1677.440] (-1675.544) * (-1677.451) (-1678.271) (-1676.582) [-1686.340] -- 0:01:05
      681500 -- (-1676.255) [-1676.435] (-1678.547) (-1679.530) * (-1684.434) [-1682.395] (-1686.562) (-1679.864) -- 0:01:04
      682000 -- (-1675.602) (-1683.209) (-1678.688) [-1676.747] * [-1675.595] (-1688.934) (-1678.253) (-1676.259) -- 0:01:04
      682500 -- [-1676.383] (-1678.940) (-1690.013) (-1678.764) * (-1674.147) (-1693.897) (-1680.180) [-1670.018] -- 0:01:05
      683000 -- (-1677.791) (-1687.784) (-1686.832) [-1677.718] * [-1673.465] (-1683.032) (-1687.492) (-1678.764) -- 0:01:04
      683500 -- (-1682.680) [-1675.162] (-1680.657) (-1678.799) * (-1674.715) (-1681.473) (-1688.667) [-1677.580] -- 0:01:04
      684000 -- (-1677.322) (-1684.789) (-1693.990) [-1690.464] * (-1680.338) (-1678.242) (-1689.862) [-1674.806] -- 0:01:04
      684500 -- (-1674.801) (-1675.201) [-1677.103] (-1681.268) * (-1677.154) (-1672.859) (-1676.278) [-1677.331] -- 0:01:04
      685000 -- [-1677.017] (-1675.596) (-1678.212) (-1680.225) * (-1679.798) (-1678.744) [-1676.236] (-1674.227) -- 0:01:04

      Average standard deviation of split frequencies: 0.012026

      685500 -- (-1678.366) (-1674.538) [-1674.095] (-1682.880) * (-1681.935) (-1683.771) (-1682.331) [-1678.273] -- 0:01:04
      686000 -- (-1685.413) (-1674.861) (-1685.373) [-1678.536] * (-1676.350) (-1680.448) (-1685.225) [-1674.446] -- 0:01:04
      686500 -- (-1683.442) (-1677.797) (-1686.522) [-1673.325] * (-1681.480) (-1685.139) (-1689.113) [-1679.493] -- 0:01:03
      687000 -- (-1678.546) [-1674.979] (-1680.566) (-1685.316) * (-1683.590) [-1669.345] (-1674.318) (-1684.484) -- 0:01:03
      687500 -- [-1681.046] (-1675.526) (-1681.267) (-1686.977) * [-1678.948] (-1681.308) (-1677.194) (-1680.099) -- 0:01:04
      688000 -- (-1683.480) (-1676.331) [-1679.635] (-1674.682) * (-1683.177) (-1683.004) (-1688.550) [-1679.597] -- 0:01:03
      688500 -- (-1680.840) (-1677.660) [-1674.198] (-1687.925) * (-1679.246) (-1675.986) [-1675.065] (-1675.103) -- 0:01:03
      689000 -- (-1686.071) [-1680.131] (-1678.185) (-1684.603) * (-1680.654) [-1675.202] (-1683.972) (-1681.931) -- 0:01:03
      689500 -- (-1681.682) (-1674.833) (-1678.572) [-1676.736] * (-1686.303) (-1681.317) [-1678.676] (-1676.704) -- 0:01:03
      690000 -- (-1676.915) [-1678.399] (-1673.283) (-1673.841) * (-1679.601) (-1679.246) (-1681.868) [-1672.929] -- 0:01:03

      Average standard deviation of split frequencies: 0.011489

      690500 -- (-1681.205) (-1676.434) [-1681.091] (-1679.722) * (-1682.739) (-1678.288) [-1679.914] (-1675.722) -- 0:01:03
      691000 -- (-1670.111) [-1678.899] (-1675.016) (-1674.836) * (-1682.313) (-1682.616) (-1681.858) [-1673.646] -- 0:01:03
      691500 -- (-1680.409) (-1675.267) (-1673.984) [-1683.137] * (-1678.368) (-1680.037) [-1673.589] (-1688.694) -- 0:01:02
      692000 -- (-1674.710) [-1676.687] (-1673.502) (-1683.616) * (-1680.818) (-1682.712) [-1675.927] (-1680.273) -- 0:01:03
      692500 -- (-1682.269) [-1675.209] (-1673.757) (-1682.238) * (-1676.901) (-1675.611) (-1679.939) [-1678.331] -- 0:01:03
      693000 -- (-1687.331) (-1678.895) [-1673.232] (-1675.485) * (-1689.532) (-1676.911) (-1673.224) [-1683.497] -- 0:01:02
      693500 -- (-1681.677) (-1687.301) (-1681.694) [-1672.306] * (-1681.593) (-1674.676) [-1671.056] (-1680.745) -- 0:01:02
      694000 -- [-1681.822] (-1673.814) (-1679.849) (-1678.625) * (-1679.849) (-1676.465) (-1673.563) [-1673.558] -- 0:01:02
      694500 -- [-1670.706] (-1676.852) (-1681.933) (-1676.621) * (-1682.688) (-1672.915) (-1674.943) [-1680.863] -- 0:01:02
      695000 -- (-1677.226) [-1674.263] (-1684.885) (-1677.210) * (-1680.856) (-1678.592) [-1677.071] (-1675.874) -- 0:01:02

      Average standard deviation of split frequencies: 0.011853

      695500 -- (-1680.608) (-1678.454) (-1680.554) [-1676.715] * [-1678.773] (-1671.148) (-1683.864) (-1678.072) -- 0:01:02
      696000 -- (-1678.018) [-1676.729] (-1675.468) (-1673.484) * (-1678.280) (-1674.287) (-1694.346) [-1679.074] -- 0:01:02
      696500 -- (-1676.109) [-1675.918] (-1678.401) (-1676.412) * (-1678.330) (-1693.106) (-1680.417) [-1679.998] -- 0:01:01
      697000 -- (-1688.174) (-1674.517) (-1681.552) [-1677.512] * [-1685.440] (-1685.731) (-1691.179) (-1679.796) -- 0:01:02
      697500 -- [-1677.051] (-1679.051) (-1675.524) (-1675.021) * (-1688.614) (-1679.188) [-1680.376] (-1678.104) -- 0:01:02
      698000 -- (-1675.978) (-1684.047) [-1679.561] (-1679.799) * (-1681.891) (-1673.387) [-1670.947] (-1677.335) -- 0:01:01
      698500 -- (-1677.326) (-1689.778) [-1677.195] (-1674.605) * (-1682.009) (-1675.770) [-1676.845] (-1686.498) -- 0:01:01
      699000 -- [-1680.339] (-1687.168) (-1677.339) (-1677.951) * (-1683.157) (-1672.558) [-1673.730] (-1678.787) -- 0:01:01
      699500 -- (-1676.884) [-1677.679] (-1676.692) (-1676.728) * (-1687.436) (-1672.976) (-1676.091) [-1676.307] -- 0:01:01
      700000 -- (-1677.176) (-1676.641) [-1676.559] (-1674.738) * (-1683.583) (-1678.346) [-1678.348] (-1684.454) -- 0:01:01

      Average standard deviation of split frequencies: 0.011550

      700500 -- (-1677.679) [-1674.005] (-1685.784) (-1679.520) * (-1675.425) (-1677.794) [-1675.645] (-1678.658) -- 0:01:01
      701000 -- [-1681.429] (-1682.996) (-1678.496) (-1676.213) * (-1679.457) (-1686.543) (-1677.091) [-1672.231] -- 0:01:00
      701500 -- (-1677.939) (-1682.510) [-1682.573] (-1674.303) * (-1693.475) [-1678.609] (-1673.108) (-1679.085) -- 0:01:00
      702000 -- (-1676.837) (-1682.211) (-1679.395) [-1677.320] * (-1680.905) (-1679.732) (-1678.605) [-1672.218] -- 0:01:01
      702500 -- (-1679.337) (-1683.827) [-1676.156] (-1674.596) * (-1679.048) (-1685.555) [-1676.369] (-1676.914) -- 0:01:00
      703000 -- (-1680.315) (-1683.875) [-1675.681] (-1688.862) * [-1676.858] (-1678.068) (-1681.572) (-1678.593) -- 0:01:00
      703500 -- (-1679.766) (-1674.662) [-1674.057] (-1679.256) * (-1680.833) [-1675.412] (-1681.107) (-1686.049) -- 0:01:00
      704000 -- (-1678.872) (-1693.344) [-1680.769] (-1680.736) * (-1676.618) (-1674.933) [-1683.685] (-1676.422) -- 0:01:00
      704500 -- (-1684.247) (-1673.291) (-1683.338) [-1687.309] * (-1676.622) [-1673.103] (-1673.258) (-1675.344) -- 0:01:00
      705000 -- (-1686.060) (-1689.676) (-1677.876) [-1678.816] * (-1673.585) (-1682.465) (-1687.260) [-1674.184] -- 0:01:00

      Average standard deviation of split frequencies: 0.011685

      705500 -- (-1682.445) (-1679.772) (-1674.146) [-1678.607] * (-1676.607) (-1680.476) [-1675.160] (-1673.528) -- 0:01:00
      706000 -- (-1675.072) (-1682.547) [-1680.229] (-1688.288) * (-1679.433) [-1676.240] (-1683.227) (-1686.005) -- 0:00:59
      706500 -- [-1674.177] (-1677.434) (-1679.524) (-1680.035) * (-1674.410) (-1687.598) (-1677.802) [-1678.608] -- 0:01:00
      707000 -- [-1682.232] (-1682.043) (-1679.081) (-1684.575) * (-1678.490) (-1680.946) [-1676.800] (-1679.960) -- 0:01:00
      707500 -- (-1676.599) [-1679.461] (-1682.634) (-1676.417) * [-1673.993] (-1678.873) (-1682.833) (-1690.510) -- 0:00:59
      708000 -- (-1684.497) (-1683.715) [-1678.890] (-1683.747) * [-1681.293] (-1677.355) (-1679.121) (-1681.644) -- 0:00:59
      708500 -- (-1690.114) (-1682.107) (-1683.609) [-1681.762] * (-1681.602) [-1678.498] (-1677.709) (-1674.159) -- 0:00:59
      709000 -- (-1682.686) (-1680.309) [-1674.156] (-1671.815) * (-1679.099) [-1676.488] (-1678.031) (-1675.746) -- 0:00:59
      709500 -- (-1678.089) (-1676.191) (-1672.453) [-1671.442] * (-1672.507) (-1675.630) [-1673.594] (-1674.273) -- 0:00:59
      710000 -- (-1675.743) [-1675.415] (-1674.465) (-1681.564) * (-1677.329) [-1675.149] (-1673.640) (-1679.795) -- 0:00:59

      Average standard deviation of split frequencies: 0.011387

      710500 -- (-1677.931) (-1680.598) (-1671.820) [-1673.314] * (-1670.621) [-1682.110] (-1678.659) (-1680.191) -- 0:00:59
      711000 -- [-1680.897] (-1683.367) (-1679.539) (-1674.557) * [-1670.034] (-1678.759) (-1672.923) (-1680.529) -- 0:00:58
      711500 -- (-1680.970) (-1676.779) (-1678.555) [-1673.584] * [-1677.741] (-1683.525) (-1675.670) (-1680.733) -- 0:00:59
      712000 -- (-1685.476) (-1678.820) (-1690.108) [-1676.652] * [-1677.809] (-1678.033) (-1675.428) (-1677.842) -- 0:00:59
      712500 -- (-1677.725) (-1678.435) (-1681.269) [-1679.324] * [-1680.231] (-1681.447) (-1676.194) (-1678.689) -- 0:00:58
      713000 -- [-1676.516] (-1689.600) (-1672.754) (-1678.313) * (-1679.502) (-1672.462) [-1676.442] (-1681.601) -- 0:00:58
      713500 -- (-1674.720) (-1686.895) [-1674.935] (-1679.119) * (-1682.519) [-1674.499] (-1678.279) (-1683.591) -- 0:00:58
      714000 -- (-1680.425) [-1674.345] (-1685.663) (-1679.408) * [-1678.004] (-1676.796) (-1681.530) (-1679.698) -- 0:00:58
      714500 -- (-1684.697) [-1675.135] (-1681.045) (-1677.752) * (-1679.416) [-1678.635] (-1680.453) (-1679.557) -- 0:00:58
      715000 -- (-1674.441) (-1680.997) (-1676.459) [-1681.317] * [-1676.556] (-1684.610) (-1675.294) (-1688.592) -- 0:00:58

      Average standard deviation of split frequencies: 0.010863

      715500 -- (-1680.852) [-1681.927] (-1676.234) (-1679.591) * (-1673.926) (-1682.245) [-1678.658] (-1683.497) -- 0:00:58
      716000 -- (-1670.255) [-1674.482] (-1678.493) (-1673.717) * [-1673.079] (-1679.056) (-1680.656) (-1679.983) -- 0:00:57
      716500 -- [-1678.512] (-1683.009) (-1678.292) (-1683.082) * (-1674.633) [-1682.920] (-1682.286) (-1681.505) -- 0:00:58
      717000 -- (-1679.133) [-1681.780] (-1681.844) (-1680.919) * (-1681.388) [-1685.280] (-1678.665) (-1678.448) -- 0:00:58
      717500 -- (-1679.757) (-1674.523) [-1671.690] (-1687.449) * (-1676.266) (-1672.758) [-1675.375] (-1679.259) -- 0:00:57
      718000 -- (-1677.527) (-1677.979) [-1678.315] (-1674.657) * (-1683.929) (-1677.164) (-1685.471) [-1678.171] -- 0:00:57
      718500 -- [-1680.271] (-1674.690) (-1687.210) (-1676.635) * (-1681.800) [-1674.068] (-1681.685) (-1670.804) -- 0:00:57
      719000 -- (-1679.995) (-1678.148) (-1673.860) [-1680.683] * [-1677.768] (-1681.615) (-1678.123) (-1674.928) -- 0:00:57
      719500 -- (-1674.220) (-1679.056) [-1671.794] (-1679.495) * (-1681.357) [-1676.551] (-1673.451) (-1676.695) -- 0:00:57
      720000 -- [-1674.971] (-1671.230) (-1676.966) (-1679.740) * (-1681.020) (-1677.528) [-1683.436] (-1678.710) -- 0:00:57

      Average standard deviation of split frequencies: 0.011011

      720500 -- (-1674.136) [-1682.668] (-1678.978) (-1684.733) * [-1679.896] (-1678.509) (-1687.587) (-1687.345) -- 0:00:57
      721000 -- (-1681.038) (-1675.345) [-1676.003] (-1684.311) * (-1675.200) (-1674.651) (-1686.418) [-1680.841] -- 0:00:56
      721500 -- [-1672.542] (-1676.819) (-1681.128) (-1683.045) * (-1674.233) (-1674.506) (-1682.358) [-1671.462] -- 0:00:57
      722000 -- (-1678.075) (-1671.566) [-1675.327] (-1682.050) * [-1671.463] (-1691.044) (-1678.861) (-1685.101) -- 0:00:56
      722500 -- (-1683.050) [-1679.730] (-1679.487) (-1689.320) * (-1677.418) (-1678.955) (-1674.675) [-1673.387] -- 0:00:56
      723000 -- [-1677.454] (-1674.813) (-1679.419) (-1690.746) * [-1678.132] (-1677.388) (-1678.465) (-1675.619) -- 0:00:56
      723500 -- (-1677.858) [-1676.535] (-1671.600) (-1686.392) * [-1676.746] (-1681.709) (-1677.427) (-1676.399) -- 0:00:56
      724000 -- (-1684.618) [-1670.330] (-1673.233) (-1693.875) * (-1678.238) (-1672.286) [-1678.712] (-1682.041) -- 0:00:56
      724500 -- (-1687.905) [-1670.791] (-1679.037) (-1690.530) * [-1673.231] (-1680.990) (-1686.619) (-1678.356) -- 0:00:56
      725000 -- (-1681.928) [-1672.784] (-1693.552) (-1691.780) * [-1673.053] (-1683.723) (-1676.727) (-1677.482) -- 0:00:56

      Average standard deviation of split frequencies: 0.010930

      725500 -- (-1683.009) (-1675.065) [-1677.761] (-1698.957) * (-1678.519) (-1674.943) (-1683.405) [-1673.403] -- 0:00:55
      726000 -- (-1680.678) (-1676.551) [-1682.792] (-1695.293) * (-1674.014) (-1676.297) (-1681.226) [-1686.374] -- 0:00:55
      726500 -- (-1674.628) [-1679.500] (-1679.091) (-1682.937) * [-1680.378] (-1674.219) (-1688.794) (-1674.207) -- 0:00:56
      727000 -- (-1679.183) (-1674.376) [-1674.277] (-1683.782) * (-1683.526) (-1685.937) [-1680.941] (-1674.791) -- 0:00:55
      727500 -- (-1675.768) (-1680.193) [-1678.981] (-1684.247) * (-1676.472) (-1681.933) (-1686.604) [-1673.084] -- 0:00:55
      728000 -- [-1675.869] (-1683.324) (-1674.619) (-1680.462) * (-1671.468) [-1681.284] (-1681.266) (-1676.516) -- 0:00:55
      728500 -- (-1675.630) [-1681.994] (-1678.438) (-1683.151) * (-1677.070) (-1682.027) (-1678.795) [-1676.400] -- 0:00:55
      729000 -- (-1676.648) [-1677.671] (-1680.511) (-1680.949) * (-1676.390) (-1676.660) (-1675.658) [-1677.866] -- 0:00:55
      729500 -- (-1680.405) (-1674.252) (-1680.323) [-1672.970] * (-1680.598) (-1671.069) (-1675.642) [-1675.229] -- 0:00:55
      730000 -- (-1674.597) [-1681.942] (-1678.817) (-1675.482) * (-1675.588) (-1680.257) (-1684.033) [-1674.229] -- 0:00:55

      Average standard deviation of split frequencies: 0.011290

      730500 -- (-1675.038) (-1681.210) (-1682.875) [-1675.062] * (-1683.444) (-1676.236) (-1686.803) [-1672.680] -- 0:00:54
      731000 -- (-1686.261) (-1679.753) [-1683.354] (-1689.843) * (-1679.874) (-1683.165) (-1688.183) [-1675.865] -- 0:00:54
      731500 -- (-1679.164) [-1674.586] (-1687.020) (-1686.794) * [-1674.434] (-1675.377) (-1687.812) (-1680.030) -- 0:00:55
      732000 -- (-1680.417) (-1681.469) [-1673.281] (-1684.177) * (-1674.618) (-1675.636) [-1676.901] (-1681.452) -- 0:00:54
      732500 -- (-1681.127) (-1681.091) (-1687.335) [-1676.093] * (-1677.014) (-1674.184) (-1678.911) [-1676.299] -- 0:00:54
      733000 -- (-1679.774) (-1679.205) (-1683.752) [-1679.751] * [-1674.022] (-1680.721) (-1683.987) (-1681.977) -- 0:00:54
      733500 -- [-1674.973] (-1682.052) (-1683.112) (-1673.994) * (-1677.380) (-1676.816) [-1679.039] (-1685.588) -- 0:00:54
      734000 -- [-1676.663] (-1684.413) (-1685.526) (-1678.271) * (-1685.410) (-1690.074) (-1677.800) [-1674.852] -- 0:00:54
      734500 -- (-1673.374) (-1682.059) (-1680.678) [-1680.055] * (-1679.383) [-1681.227] (-1681.975) (-1686.492) -- 0:00:54
      735000 -- (-1687.785) (-1682.042) [-1671.344] (-1681.983) * [-1683.831] (-1678.051) (-1682.493) (-1676.177) -- 0:00:54

      Average standard deviation of split frequencies: 0.011209

      735500 -- [-1674.027] (-1675.577) (-1685.783) (-1676.379) * (-1682.671) [-1677.667] (-1677.351) (-1681.208) -- 0:00:53
      736000 -- [-1677.851] (-1673.234) (-1675.940) (-1671.796) * (-1688.601) (-1685.067) [-1680.576] (-1676.192) -- 0:00:53
      736500 -- (-1677.935) (-1679.407) [-1674.913] (-1680.490) * (-1688.128) [-1675.291] (-1686.303) (-1683.172) -- 0:00:54
      737000 -- [-1679.648] (-1680.821) (-1685.629) (-1678.067) * (-1683.996) (-1670.073) [-1683.164] (-1683.965) -- 0:00:53
      737500 -- [-1687.545] (-1684.476) (-1684.726) (-1677.891) * (-1686.329) (-1676.662) (-1680.401) [-1672.453] -- 0:00:53
      738000 -- (-1682.639) (-1682.575) (-1678.309) [-1678.831] * [-1677.672] (-1676.648) (-1680.058) (-1673.782) -- 0:00:53
      738500 -- (-1677.638) (-1682.138) [-1677.291] (-1680.273) * (-1676.999) (-1680.233) (-1679.212) [-1676.243] -- 0:00:53
      739000 -- (-1679.467) [-1675.392] (-1676.782) (-1679.449) * (-1687.919) (-1673.622) [-1670.247] (-1687.502) -- 0:00:53
      739500 -- (-1674.620) (-1679.421) (-1684.736) [-1671.264] * (-1686.376) (-1671.760) (-1675.192) [-1681.766] -- 0:00:53
      740000 -- (-1682.230) [-1684.690] (-1675.485) (-1678.620) * (-1684.326) [-1677.962] (-1679.931) (-1677.222) -- 0:00:53

      Average standard deviation of split frequencies: 0.011562

      740500 -- [-1682.678] (-1691.600) (-1677.894) (-1681.375) * (-1676.040) (-1687.121) (-1673.818) [-1673.840] -- 0:00:52
      741000 -- (-1675.975) (-1679.900) (-1674.030) [-1677.411] * (-1675.986) (-1688.822) [-1676.032] (-1683.059) -- 0:00:53
      741500 -- [-1674.923] (-1680.163) (-1675.673) (-1683.759) * [-1675.467] (-1679.737) (-1675.587) (-1680.623) -- 0:00:52
      742000 -- [-1680.563] (-1679.016) (-1672.939) (-1687.538) * (-1682.031) (-1687.574) [-1675.822] (-1681.419) -- 0:00:52
      742500 -- (-1680.435) [-1679.561] (-1676.392) (-1677.548) * (-1682.566) [-1679.488] (-1685.299) (-1674.468) -- 0:00:52
      743000 -- (-1671.850) (-1684.191) (-1683.896) [-1682.108] * (-1684.757) [-1679.716] (-1686.916) (-1672.527) -- 0:00:52
      743500 -- (-1677.061) [-1674.765] (-1697.216) (-1674.567) * [-1676.589] (-1686.861) (-1678.498) (-1683.550) -- 0:00:52
      744000 -- (-1680.759) (-1686.760) [-1681.579] (-1673.308) * [-1674.751] (-1675.301) (-1675.533) (-1678.692) -- 0:00:52
      744500 -- (-1684.771) (-1685.322) [-1675.098] (-1673.613) * (-1674.582) [-1678.408] (-1674.702) (-1678.066) -- 0:00:52
      745000 -- (-1682.539) (-1675.809) [-1674.135] (-1678.187) * (-1680.561) (-1674.919) [-1672.709] (-1680.075) -- 0:00:52

      Average standard deviation of split frequencies: 0.011480

      745500 -- (-1680.645) (-1679.181) (-1674.978) [-1678.712] * (-1683.008) (-1679.963) [-1681.778] (-1673.281) -- 0:00:51
      746000 -- [-1674.739] (-1682.015) (-1672.726) (-1673.523) * [-1678.276] (-1680.903) (-1682.660) (-1677.465) -- 0:00:52
      746500 -- (-1678.213) (-1674.718) (-1676.654) [-1676.719] * (-1676.355) [-1677.324] (-1685.950) (-1682.420) -- 0:00:51
      747000 -- (-1675.304) [-1680.131] (-1673.349) (-1689.929) * [-1678.020] (-1680.754) (-1675.098) (-1673.733) -- 0:00:51
      747500 -- (-1680.287) (-1678.515) [-1675.986] (-1681.052) * (-1692.569) (-1679.866) (-1674.225) [-1679.334] -- 0:00:51
      748000 -- (-1680.899) (-1682.119) [-1670.991] (-1681.442) * (-1677.659) [-1672.825] (-1682.720) (-1680.207) -- 0:00:51
      748500 -- (-1672.803) (-1689.073) [-1678.446] (-1678.970) * (-1682.427) [-1677.661] (-1685.145) (-1671.119) -- 0:00:51
      749000 -- (-1675.637) (-1688.587) (-1678.091) [-1674.066] * (-1673.336) (-1679.445) (-1688.238) [-1674.969] -- 0:00:51
      749500 -- (-1674.379) [-1681.192] (-1678.332) (-1677.646) * (-1681.907) (-1680.725) (-1682.302) [-1677.847] -- 0:00:51
      750000 -- (-1674.783) (-1679.215) [-1675.527] (-1674.183) * (-1675.443) (-1682.676) (-1692.467) [-1669.451] -- 0:00:51

      Average standard deviation of split frequencies: 0.012246

      750500 -- [-1679.183] (-1677.183) (-1677.860) (-1676.114) * [-1685.090] (-1673.756) (-1679.839) (-1683.766) -- 0:00:50
      751000 -- [-1678.088] (-1674.834) (-1679.756) (-1673.785) * (-1682.248) (-1682.292) [-1676.105] (-1683.081) -- 0:00:51
      751500 -- (-1683.143) [-1677.553] (-1689.526) (-1675.713) * (-1676.041) (-1683.769) [-1679.214] (-1686.646) -- 0:00:50
      752000 -- [-1679.932] (-1689.514) (-1685.871) (-1683.936) * [-1680.920] (-1671.642) (-1679.315) (-1687.282) -- 0:00:50
      752500 -- (-1678.620) (-1682.454) (-1688.216) [-1676.844] * (-1671.769) (-1675.221) (-1678.595) [-1675.434] -- 0:00:50
      753000 -- (-1682.983) [-1683.822] (-1674.395) (-1678.236) * [-1673.314] (-1682.859) (-1674.954) (-1685.856) -- 0:00:50
      753500 -- (-1677.175) (-1684.055) (-1678.163) [-1678.461] * (-1683.685) [-1680.692] (-1676.034) (-1682.349) -- 0:00:50
      754000 -- (-1676.498) [-1679.800] (-1684.292) (-1676.157) * (-1680.450) [-1677.934] (-1685.505) (-1681.191) -- 0:00:50
      754500 -- (-1676.438) (-1676.169) [-1676.136] (-1679.459) * (-1672.583) (-1677.024) (-1680.812) [-1679.243] -- 0:00:50
      755000 -- (-1677.998) (-1682.470) [-1679.066] (-1685.470) * (-1675.938) [-1678.849] (-1678.353) (-1675.757) -- 0:00:49

      Average standard deviation of split frequencies: 0.012783

      755500 -- (-1672.411) (-1679.265) (-1682.075) [-1678.656] * (-1685.565) [-1673.838] (-1675.370) (-1671.412) -- 0:00:50
      756000 -- (-1675.248) (-1684.754) [-1672.147] (-1673.197) * (-1677.165) [-1678.459] (-1683.554) (-1677.914) -- 0:00:50
      756500 -- (-1681.741) (-1680.133) [-1677.205] (-1688.552) * (-1685.000) (-1681.896) (-1676.822) [-1678.392] -- 0:00:49
      757000 -- (-1687.926) (-1687.994) [-1676.092] (-1677.839) * (-1680.328) [-1675.142] (-1680.371) (-1682.626) -- 0:00:49
      757500 -- (-1690.058) (-1679.765) [-1673.432] (-1676.103) * (-1693.963) [-1679.897] (-1683.589) (-1679.821) -- 0:00:49
      758000 -- (-1684.552) (-1692.265) (-1680.284) [-1681.316] * (-1678.325) [-1675.494] (-1686.068) (-1685.127) -- 0:00:49
      758500 -- (-1680.695) (-1677.701) [-1682.524] (-1678.403) * (-1680.402) [-1678.409] (-1679.580) (-1684.641) -- 0:00:49
      759000 -- [-1677.048] (-1680.825) (-1685.564) (-1673.636) * [-1681.484] (-1678.059) (-1678.910) (-1675.270) -- 0:00:49
      759500 -- (-1681.739) [-1668.749] (-1681.798) (-1677.866) * (-1676.515) (-1676.448) (-1676.838) [-1677.687] -- 0:00:49
      760000 -- (-1680.322) (-1677.699) [-1678.413] (-1675.889) * (-1676.060) (-1692.916) [-1687.822] (-1680.335) -- 0:00:48

      Average standard deviation of split frequencies: 0.012704

      760500 -- (-1676.465) [-1676.203] (-1683.248) (-1676.732) * (-1684.102) (-1683.752) (-1688.430) [-1680.423] -- 0:00:49
      761000 -- [-1682.795] (-1678.074) (-1683.106) (-1676.975) * (-1688.245) (-1680.436) (-1684.007) [-1680.396] -- 0:00:48
      761500 -- (-1682.290) [-1673.259] (-1681.183) (-1681.401) * (-1682.737) (-1681.679) (-1679.813) [-1681.621] -- 0:00:48
      762000 -- (-1684.295) [-1676.990] (-1679.381) (-1678.280) * [-1689.229] (-1678.070) (-1688.111) (-1684.957) -- 0:00:48
      762500 -- (-1688.649) (-1673.121) (-1674.410) [-1679.628] * (-1683.295) (-1672.575) (-1689.499) [-1671.028] -- 0:00:48
      763000 -- (-1677.034) (-1680.179) (-1678.570) [-1679.392] * (-1679.748) [-1677.240] (-1684.643) (-1671.675) -- 0:00:48
      763500 -- (-1681.014) [-1677.157] (-1673.279) (-1681.443) * (-1686.312) (-1677.727) [-1682.376] (-1679.683) -- 0:00:48
      764000 -- (-1677.054) (-1684.294) [-1674.672] (-1679.416) * (-1675.758) (-1680.659) (-1677.013) [-1670.792] -- 0:00:48
      764500 -- (-1683.023) [-1678.789] (-1683.033) (-1681.105) * [-1680.302] (-1679.054) (-1672.827) (-1678.377) -- 0:00:48
      765000 -- [-1678.668] (-1680.963) (-1676.993) (-1682.614) * (-1682.338) [-1678.934] (-1687.677) (-1676.214) -- 0:00:47

      Average standard deviation of split frequencies: 0.012821

      765500 -- [-1686.215] (-1679.512) (-1678.926) (-1681.484) * (-1676.500) (-1678.985) [-1674.898] (-1677.894) -- 0:00:48
      766000 -- (-1680.193) (-1678.009) [-1676.086] (-1674.887) * (-1689.792) [-1671.311] (-1674.664) (-1677.052) -- 0:00:47
      766500 -- (-1679.759) [-1679.786] (-1684.752) (-1676.787) * (-1688.364) (-1678.899) (-1682.391) [-1682.884] -- 0:00:47
      767000 -- [-1677.910] (-1683.148) (-1681.664) (-1679.957) * (-1689.831) [-1678.433] (-1673.781) (-1687.873) -- 0:00:47
      767500 -- [-1679.468] (-1685.166) (-1683.024) (-1686.325) * (-1680.628) (-1677.424) [-1671.603] (-1678.265) -- 0:00:47
      768000 -- (-1687.385) (-1677.474) [-1672.890] (-1679.669) * (-1680.695) (-1678.419) (-1679.143) [-1675.859] -- 0:00:47
      768500 -- (-1683.375) (-1679.013) (-1676.723) [-1679.869] * (-1685.654) [-1681.080] (-1674.944) (-1683.536) -- 0:00:47
      769000 -- (-1678.000) (-1684.519) [-1674.153] (-1678.088) * (-1673.883) [-1675.809] (-1671.835) (-1675.565) -- 0:00:47
      769500 -- (-1683.205) (-1685.000) (-1672.418) [-1672.913] * (-1680.082) (-1676.466) (-1675.535) [-1679.898] -- 0:00:47
      770000 -- [-1676.803] (-1680.929) (-1688.467) (-1674.649) * (-1683.397) (-1678.635) (-1687.472) [-1674.878] -- 0:00:47

      Average standard deviation of split frequencies: 0.012743

      770500 -- (-1672.601) [-1680.940] (-1682.043) (-1678.189) * [-1674.162] (-1680.485) (-1684.294) (-1674.700) -- 0:00:47
      771000 -- (-1678.103) [-1678.997] (-1677.669) (-1685.183) * (-1675.101) [-1674.823] (-1686.691) (-1677.596) -- 0:00:46
      771500 -- (-1679.242) (-1679.824) [-1672.703] (-1681.894) * [-1673.513] (-1684.646) (-1685.589) (-1682.209) -- 0:00:46
      772000 -- (-1676.564) (-1685.185) (-1677.289) [-1669.537] * (-1681.193) (-1678.452) (-1680.838) [-1675.725] -- 0:00:46
      772500 -- (-1681.045) (-1686.947) (-1675.607) [-1676.402] * (-1680.655) (-1685.786) (-1680.762) [-1672.662] -- 0:00:46
      773000 -- [-1675.039] (-1675.000) (-1677.849) (-1683.598) * (-1681.575) [-1675.088] (-1680.774) (-1674.009) -- 0:00:46
      773500 -- (-1674.710) [-1671.321] (-1680.383) (-1679.740) * (-1677.838) (-1677.271) [-1678.741] (-1676.304) -- 0:00:46
      774000 -- (-1680.646) (-1680.347) (-1679.019) [-1673.863] * (-1681.919) (-1676.558) (-1686.716) [-1677.702] -- 0:00:46
      774500 -- (-1670.705) (-1683.417) (-1674.090) [-1677.961] * (-1688.233) [-1672.863] (-1689.702) (-1678.624) -- 0:00:46
      775000 -- [-1675.735] (-1675.685) (-1680.086) (-1687.345) * (-1684.683) (-1673.588) (-1681.552) [-1674.908] -- 0:00:46

      Average standard deviation of split frequencies: 0.011846

      775500 -- [-1681.706] (-1676.390) (-1688.641) (-1677.426) * (-1695.044) (-1671.971) [-1677.089] (-1676.944) -- 0:00:46
      776000 -- (-1683.863) (-1680.152) (-1676.240) [-1676.090] * (-1680.577) (-1679.937) (-1678.913) [-1678.725] -- 0:00:45
      776500 -- [-1680.545] (-1682.541) (-1687.689) (-1682.975) * (-1673.021) (-1681.210) [-1676.347] (-1675.024) -- 0:00:45
      777000 -- (-1678.793) (-1685.141) [-1673.378] (-1679.800) * [-1672.714] (-1675.573) (-1677.977) (-1679.316) -- 0:00:45
      777500 -- (-1674.326) (-1675.020) (-1679.506) [-1678.471] * (-1676.403) [-1679.727] (-1680.762) (-1680.823) -- 0:00:45
      778000 -- (-1687.984) [-1673.363] (-1687.604) (-1674.133) * [-1680.899] (-1676.057) (-1684.135) (-1677.984) -- 0:00:45
      778500 -- [-1673.235] (-1675.474) (-1676.045) (-1676.088) * (-1672.861) [-1675.101] (-1684.534) (-1682.687) -- 0:00:45
      779000 -- (-1680.348) [-1680.245] (-1677.165) (-1681.552) * (-1675.961) (-1678.555) (-1680.300) [-1682.644] -- 0:00:45
      779500 -- (-1687.973) [-1689.551] (-1676.032) (-1679.189) * (-1682.271) (-1676.828) [-1676.584] (-1680.338) -- 0:00:44
      780000 -- (-1677.364) (-1678.828) (-1685.818) [-1679.278] * (-1672.962) (-1682.654) [-1675.169] (-1684.136) -- 0:00:45

      Average standard deviation of split frequencies: 0.011976

      780500 -- [-1682.437] (-1674.897) (-1681.326) (-1685.695) * (-1679.836) [-1676.129] (-1678.337) (-1679.762) -- 0:00:44
      781000 -- (-1672.540) [-1678.747] (-1682.943) (-1672.325) * (-1675.111) (-1677.798) [-1678.524] (-1686.928) -- 0:00:44
      781500 -- (-1679.641) [-1683.001] (-1682.892) (-1686.069) * [-1676.123] (-1674.382) (-1677.841) (-1684.739) -- 0:00:44
      782000 -- (-1674.453) (-1679.512) (-1683.405) [-1678.989] * (-1679.085) [-1679.509] (-1676.211) (-1695.685) -- 0:00:44
      782500 -- (-1689.818) [-1678.648] (-1680.899) (-1674.204) * (-1675.992) (-1687.483) [-1681.843] (-1677.339) -- 0:00:44
      783000 -- (-1676.866) (-1677.680) (-1687.055) [-1675.778] * [-1673.603] (-1679.832) (-1676.620) (-1672.814) -- 0:00:44
      783500 -- (-1680.082) [-1680.710] (-1685.324) (-1674.450) * (-1679.001) (-1675.213) (-1687.262) [-1671.988] -- 0:00:44
      784000 -- [-1682.922] (-1678.711) (-1690.097) (-1676.867) * (-1675.046) (-1683.798) (-1682.080) [-1680.160] -- 0:00:44
      784500 -- [-1679.416] (-1674.315) (-1680.117) (-1684.062) * (-1678.586) (-1682.196) [-1678.982] (-1681.148) -- 0:00:44
      785000 -- (-1677.755) (-1672.677) [-1671.062] (-1679.017) * (-1677.716) (-1682.399) [-1674.221] (-1683.793) -- 0:00:44

      Average standard deviation of split frequencies: 0.012295

      785500 -- [-1674.464] (-1674.848) (-1675.729) (-1682.259) * [-1675.705] (-1682.605) (-1678.444) (-1676.375) -- 0:00:43
      786000 -- (-1692.632) [-1679.479] (-1675.186) (-1680.890) * (-1676.244) (-1688.171) (-1676.083) [-1673.957] -- 0:00:43
      786500 -- (-1689.915) (-1675.696) (-1674.192) [-1680.536] * (-1671.278) (-1676.379) [-1678.755] (-1674.800) -- 0:00:43
      787000 -- (-1681.103) (-1678.062) [-1671.668] (-1689.553) * (-1676.436) [-1671.405] (-1681.094) (-1675.634) -- 0:00:43
      787500 -- [-1689.764] (-1679.717) (-1678.502) (-1680.565) * (-1683.663) (-1688.781) (-1686.134) [-1673.941] -- 0:00:43
      788000 -- (-1683.982) [-1674.072] (-1676.948) (-1685.557) * (-1681.817) [-1681.295] (-1678.062) (-1678.470) -- 0:00:43
      788500 -- [-1680.509] (-1673.973) (-1682.799) (-1680.844) * (-1680.132) (-1675.807) [-1676.259] (-1676.054) -- 0:00:43
      789000 -- [-1683.731] (-1681.951) (-1670.725) (-1675.372) * (-1681.858) (-1683.142) [-1674.149] (-1683.052) -- 0:00:43
      789500 -- [-1674.009] (-1683.983) (-1681.633) (-1678.947) * (-1683.192) (-1677.850) [-1674.091] (-1684.879) -- 0:00:43
      790000 -- (-1676.504) [-1675.856] (-1681.577) (-1676.186) * (-1677.791) (-1685.358) [-1678.728] (-1681.841) -- 0:00:43

      Average standard deviation of split frequencies: 0.011626

      790500 -- [-1676.554] (-1687.223) (-1686.354) (-1677.550) * (-1680.574) [-1676.241] (-1677.673) (-1675.676) -- 0:00:42
      791000 -- (-1676.812) (-1683.750) (-1688.639) [-1677.176] * (-1683.686) [-1678.673] (-1674.386) (-1673.428) -- 0:00:42
      791500 -- (-1684.189) (-1680.312) (-1680.519) [-1675.315] * (-1677.651) [-1679.666] (-1674.911) (-1674.624) -- 0:00:42
      792000 -- (-1688.565) (-1686.654) (-1678.424) [-1674.759] * [-1676.699] (-1672.038) (-1681.502) (-1684.286) -- 0:00:42
      792500 -- (-1683.537) [-1680.104] (-1690.683) (-1678.383) * (-1681.564) [-1679.142] (-1679.819) (-1679.785) -- 0:00:42
      793000 -- (-1686.210) (-1678.193) (-1697.261) [-1673.501] * (-1676.823) [-1681.246] (-1681.979) (-1682.108) -- 0:00:42
      793500 -- (-1677.501) [-1684.918] (-1691.402) (-1676.531) * [-1676.016] (-1672.805) (-1678.131) (-1678.642) -- 0:00:42
      794000 -- [-1680.527] (-1680.901) (-1678.687) (-1677.340) * [-1686.559] (-1677.427) (-1677.819) (-1676.192) -- 0:00:42
      794500 -- (-1673.237) (-1684.117) [-1677.100] (-1678.663) * (-1685.692) (-1679.752) (-1681.763) [-1675.556] -- 0:00:42
      795000 -- (-1684.355) (-1684.418) (-1680.572) [-1675.411] * (-1688.554) (-1676.456) (-1676.040) [-1677.334] -- 0:00:42

      Average standard deviation of split frequencies: 0.011351

      795500 -- (-1675.849) [-1677.096] (-1676.846) (-1679.677) * [-1673.301] (-1680.408) (-1682.125) (-1683.047) -- 0:00:41
      796000 -- (-1676.244) (-1684.582) [-1680.301] (-1673.650) * (-1675.293) (-1683.405) [-1681.133] (-1675.962) -- 0:00:41
      796500 -- (-1677.931) [-1675.584] (-1680.290) (-1679.116) * (-1677.291) (-1676.499) [-1678.194] (-1680.929) -- 0:00:41
      797000 -- [-1681.384] (-1679.990) (-1680.658) (-1679.264) * [-1676.153] (-1685.006) (-1682.101) (-1678.495) -- 0:00:41
      797500 -- (-1674.888) (-1681.321) [-1677.331] (-1688.383) * (-1673.816) (-1683.770) [-1670.793] (-1683.380) -- 0:00:41
      798000 -- (-1674.876) [-1676.553] (-1679.459) (-1680.605) * [-1684.292] (-1676.010) (-1678.123) (-1677.954) -- 0:00:41
      798500 -- (-1680.067) (-1683.344) (-1679.245) [-1678.000] * (-1685.817) (-1672.964) (-1677.925) [-1673.775] -- 0:00:41
      799000 -- (-1679.754) (-1677.124) [-1676.131] (-1679.547) * (-1676.579) (-1678.690) (-1682.911) [-1676.365] -- 0:00:41
      799500 -- [-1678.039] (-1679.202) (-1681.195) (-1675.769) * [-1676.302] (-1679.313) (-1680.790) (-1676.513) -- 0:00:41
      800000 -- (-1680.050) (-1677.992) [-1677.472] (-1682.495) * (-1681.047) [-1673.101] (-1688.684) (-1677.037) -- 0:00:41

      Average standard deviation of split frequencies: 0.011285

      800500 -- [-1678.732] (-1675.857) (-1675.643) (-1683.342) * (-1679.098) [-1672.971] (-1681.108) (-1688.446) -- 0:00:40
      801000 -- (-1677.601) (-1671.617) (-1679.253) [-1672.810] * (-1677.182) [-1674.658] (-1679.735) (-1676.736) -- 0:00:40
      801500 -- (-1674.598) [-1671.678] (-1675.942) (-1687.289) * (-1679.916) [-1676.297] (-1677.313) (-1682.829) -- 0:00:40
      802000 -- (-1680.844) (-1680.305) (-1680.940) [-1676.146] * [-1678.515] (-1678.222) (-1693.063) (-1679.912) -- 0:00:40
      802500 -- (-1675.502) [-1677.458] (-1673.487) (-1674.289) * (-1678.112) [-1678.240] (-1682.382) (-1680.494) -- 0:00:40
      803000 -- (-1675.533) (-1684.499) [-1680.926] (-1682.036) * [-1678.868] (-1670.755) (-1673.191) (-1676.286) -- 0:00:40
      803500 -- (-1679.158) (-1670.048) [-1671.663] (-1681.918) * (-1680.417) [-1677.136] (-1687.387) (-1674.454) -- 0:00:40
      804000 -- (-1674.772) [-1672.162] (-1675.580) (-1688.331) * (-1678.568) (-1675.013) (-1685.547) [-1677.761] -- 0:00:40
      804500 -- (-1680.256) [-1674.747] (-1674.760) (-1683.596) * (-1685.333) (-1684.856) [-1676.405] (-1683.739) -- 0:00:40
      805000 -- (-1677.022) [-1676.701] (-1671.751) (-1679.959) * (-1677.873) (-1687.845) (-1678.116) [-1675.917] -- 0:00:39

      Average standard deviation of split frequencies: 0.010430

      805500 -- [-1674.423] (-1673.971) (-1689.296) (-1684.943) * (-1677.222) [-1678.569] (-1681.690) (-1681.658) -- 0:00:39
      806000 -- (-1673.291) (-1683.074) (-1692.008) [-1681.078] * (-1685.953) [-1678.305] (-1682.074) (-1679.537) -- 0:00:39
      806500 -- [-1671.303] (-1680.335) (-1684.434) (-1676.956) * (-1674.393) [-1682.021] (-1678.526) (-1680.287) -- 0:00:39
      807000 -- (-1686.256) (-1676.901) [-1675.378] (-1676.451) * (-1687.410) [-1675.576] (-1677.963) (-1680.838) -- 0:00:39
      807500 -- (-1674.614) (-1675.777) [-1674.071] (-1680.064) * (-1676.855) (-1675.768) (-1676.999) [-1676.500] -- 0:00:39
      808000 -- (-1682.969) (-1678.224) [-1675.456] (-1676.498) * (-1671.082) [-1668.844] (-1686.591) (-1680.446) -- 0:00:39
      808500 -- (-1681.724) [-1682.961] (-1672.514) (-1678.882) * (-1680.020) (-1682.950) (-1685.425) [-1672.606] -- 0:00:39
      809000 -- (-1679.663) [-1674.990] (-1681.030) (-1676.104) * (-1681.261) (-1677.235) [-1682.150] (-1680.000) -- 0:00:39
      809500 -- (-1680.126) [-1671.237] (-1676.930) (-1685.944) * (-1678.296) (-1676.425) (-1673.809) [-1678.646] -- 0:00:39
      810000 -- (-1674.760) (-1676.395) (-1690.213) [-1674.192] * (-1681.810) [-1680.819] (-1683.081) (-1678.252) -- 0:00:38

      Average standard deviation of split frequencies: 0.010661

      810500 -- (-1678.376) [-1672.691] (-1678.588) (-1673.952) * (-1681.091) [-1676.720] (-1676.106) (-1672.909) -- 0:00:38
      811000 -- (-1676.559) (-1678.065) (-1683.953) [-1677.205] * [-1675.450] (-1684.065) (-1678.825) (-1675.290) -- 0:00:38
      811500 -- (-1675.497) [-1675.169] (-1670.964) (-1681.807) * (-1673.662) (-1676.175) [-1677.000] (-1678.049) -- 0:00:38
      812000 -- (-1677.333) (-1693.460) [-1677.505] (-1683.864) * (-1676.818) (-1679.207) [-1676.614] (-1673.526) -- 0:00:38
      812500 -- (-1681.143) (-1681.076) [-1670.294] (-1680.257) * (-1693.799) (-1683.217) (-1675.263) [-1676.251] -- 0:00:38
      813000 -- (-1682.849) (-1686.762) [-1673.797] (-1682.095) * (-1684.121) [-1674.962] (-1677.965) (-1677.871) -- 0:00:38
      813500 -- [-1681.637] (-1679.871) (-1683.140) (-1672.126) * (-1673.778) (-1682.541) [-1677.724] (-1676.540) -- 0:00:38
      814000 -- [-1670.733] (-1688.424) (-1679.434) (-1675.560) * [-1678.041] (-1677.726) (-1673.906) (-1679.337) -- 0:00:38
      814500 -- (-1677.824) (-1679.686) [-1675.170] (-1675.461) * (-1683.058) [-1681.885] (-1685.944) (-1674.423) -- 0:00:38
      815000 -- (-1673.574) (-1681.141) (-1679.883) [-1671.031] * (-1677.154) (-1686.073) [-1674.033] (-1674.976) -- 0:00:37

      Average standard deviation of split frequencies: 0.011361

      815500 -- (-1680.147) [-1672.524] (-1691.023) (-1680.543) * [-1673.666] (-1678.030) (-1674.178) (-1682.213) -- 0:00:37
      816000 -- (-1674.414) (-1688.315) [-1671.603] (-1680.985) * (-1687.717) (-1687.420) [-1677.325] (-1682.410) -- 0:00:37
      816500 -- (-1674.581) [-1678.648] (-1676.596) (-1675.952) * (-1672.690) (-1681.165) [-1674.279] (-1683.677) -- 0:00:37
      817000 -- (-1680.221) (-1680.147) [-1675.251] (-1682.099) * (-1673.504) (-1676.541) [-1677.116] (-1675.299) -- 0:00:37
      817500 -- (-1682.548) (-1675.101) (-1677.454) [-1677.689] * (-1678.105) (-1677.126) [-1673.418] (-1670.397) -- 0:00:37
      818000 -- (-1674.697) [-1680.735] (-1676.433) (-1678.103) * (-1687.225) (-1678.543) [-1677.485] (-1675.582) -- 0:00:37
      818500 -- [-1670.422] (-1688.223) (-1675.538) (-1676.888) * (-1681.512) (-1680.120) [-1677.776] (-1678.515) -- 0:00:37
      819000 -- (-1674.988) [-1679.529] (-1680.745) (-1672.262) * (-1680.313) [-1672.119] (-1683.991) (-1674.655) -- 0:00:37
      819500 -- (-1674.816) (-1678.789) [-1681.151] (-1685.220) * (-1686.423) (-1678.204) (-1679.781) [-1684.898] -- 0:00:37
      820000 -- (-1680.752) [-1677.360] (-1675.660) (-1681.403) * (-1677.735) (-1677.767) (-1682.516) [-1676.118] -- 0:00:36

      Average standard deviation of split frequencies: 0.011488

      820500 -- (-1680.142) (-1678.037) [-1677.396] (-1690.862) * (-1680.148) [-1671.811] (-1685.657) (-1676.031) -- 0:00:36
      821000 -- (-1684.942) (-1689.188) (-1678.567) [-1686.450] * (-1673.268) (-1683.970) [-1684.120] (-1680.276) -- 0:00:36
      821500 -- (-1675.586) [-1687.535] (-1679.212) (-1683.409) * (-1682.556) (-1676.847) [-1679.815] (-1684.424) -- 0:00:36
      822000 -- [-1680.734] (-1681.023) (-1687.276) (-1684.064) * (-1679.295) (-1680.189) [-1681.837] (-1690.620) -- 0:00:36
      822500 -- (-1678.219) (-1674.209) (-1678.189) [-1678.847] * [-1675.428] (-1680.915) (-1684.742) (-1679.500) -- 0:00:36
      823000 -- (-1680.383) (-1682.306) (-1677.064) [-1673.134] * [-1675.710] (-1682.656) (-1673.137) (-1689.278) -- 0:00:36
      823500 -- (-1690.389) (-1690.542) (-1680.703) [-1675.514] * (-1675.623) (-1677.435) [-1670.523] (-1679.658) -- 0:00:36
      824000 -- (-1688.352) (-1681.477) (-1675.691) [-1678.094] * [-1680.181] (-1682.972) (-1676.692) (-1690.691) -- 0:00:36
      824500 -- (-1679.638) (-1681.279) [-1679.637] (-1685.121) * [-1685.144] (-1683.483) (-1676.322) (-1678.071) -- 0:00:35
      825000 -- (-1684.039) (-1673.967) [-1678.779] (-1680.594) * (-1684.925) (-1682.473) (-1682.584) [-1676.632] -- 0:00:35

      Average standard deviation of split frequencies: 0.011795

      825500 -- (-1678.629) (-1685.181) [-1672.791] (-1681.293) * (-1677.455) [-1674.078] (-1684.649) (-1674.128) -- 0:00:35
      826000 -- (-1682.261) [-1674.764] (-1679.344) (-1679.793) * (-1680.227) [-1677.944] (-1678.522) (-1675.391) -- 0:00:35
      826500 -- (-1681.928) (-1682.774) [-1673.463] (-1678.391) * (-1676.792) (-1681.232) (-1679.656) [-1673.727] -- 0:00:35
      827000 -- (-1684.832) [-1679.759] (-1676.017) (-1675.558) * (-1683.904) (-1682.607) [-1679.368] (-1690.476) -- 0:00:35
      827500 -- (-1685.321) [-1682.848] (-1676.349) (-1675.513) * [-1677.416] (-1679.779) (-1690.311) (-1682.414) -- 0:00:35
      828000 -- (-1678.538) [-1679.456] (-1672.565) (-1679.179) * (-1674.611) [-1681.437] (-1679.078) (-1676.783) -- 0:00:35
      828500 -- (-1676.744) (-1677.639) (-1673.254) [-1680.346] * (-1683.156) (-1683.955) [-1683.060] (-1676.493) -- 0:00:35
      829000 -- (-1675.716) [-1678.809] (-1676.841) (-1678.945) * (-1677.851) [-1681.107] (-1681.982) (-1672.367) -- 0:00:35
      829500 -- [-1672.687] (-1689.065) (-1685.634) (-1684.193) * [-1676.596] (-1676.110) (-1677.204) (-1677.788) -- 0:00:34
      830000 -- (-1680.242) [-1674.728] (-1682.698) (-1676.385) * [-1680.204] (-1687.111) (-1676.525) (-1681.799) -- 0:00:34

      Average standard deviation of split frequencies: 0.011539

      830500 -- [-1678.211] (-1679.086) (-1679.301) (-1675.678) * [-1681.800] (-1674.226) (-1678.133) (-1674.974) -- 0:00:34
      831000 -- (-1682.179) (-1678.294) (-1672.707) [-1679.794] * [-1675.399] (-1677.174) (-1685.287) (-1675.119) -- 0:00:34
      831500 -- (-1674.402) (-1680.078) [-1684.315] (-1680.102) * (-1676.009) (-1674.966) [-1678.141] (-1676.701) -- 0:00:34
      832000 -- (-1679.675) (-1689.391) (-1682.625) [-1672.756] * (-1674.362) [-1676.143] (-1681.329) (-1678.755) -- 0:00:34
      832500 -- [-1671.254] (-1684.116) (-1683.916) (-1670.340) * (-1681.645) (-1677.446) [-1673.352] (-1683.170) -- 0:00:34
      833000 -- [-1676.989] (-1677.095) (-1674.939) (-1683.291) * [-1681.113] (-1675.951) (-1673.838) (-1678.026) -- 0:00:34
      833500 -- (-1674.785) (-1679.808) (-1677.288) [-1676.438] * (-1676.622) (-1677.086) (-1681.998) [-1672.485] -- 0:00:34
      834000 -- (-1674.581) [-1675.753] (-1683.042) (-1675.033) * (-1683.559) (-1673.125) [-1673.328] (-1679.246) -- 0:00:34
      834500 -- (-1676.732) (-1679.311) [-1678.301] (-1674.971) * (-1687.943) (-1680.931) [-1680.188] (-1677.465) -- 0:00:33
      835000 -- (-1679.719) (-1684.825) [-1671.664] (-1676.537) * (-1681.214) [-1679.957] (-1676.967) (-1687.917) -- 0:00:33

      Average standard deviation of split frequencies: 0.010902

      835500 -- [-1674.745] (-1678.091) (-1685.754) (-1685.228) * (-1678.793) (-1677.239) (-1681.004) [-1676.050] -- 0:00:33
      836000 -- (-1675.486) [-1676.498] (-1680.111) (-1679.565) * (-1678.662) (-1680.868) (-1676.774) [-1676.743] -- 0:00:33
      836500 -- [-1675.442] (-1677.712) (-1682.696) (-1682.830) * (-1678.790) [-1680.736] (-1673.154) (-1677.282) -- 0:00:33
      837000 -- (-1676.237) (-1678.584) (-1675.898) [-1674.510] * (-1675.571) (-1674.432) [-1670.974] (-1680.154) -- 0:00:33
      837500 -- (-1671.327) [-1678.954] (-1676.335) (-1673.450) * (-1682.034) [-1675.673] (-1690.228) (-1673.082) -- 0:00:33
      838000 -- (-1677.747) (-1677.331) (-1693.337) [-1676.647] * (-1683.540) (-1672.508) [-1675.365] (-1680.091) -- 0:00:33
      838500 -- [-1674.260] (-1677.935) (-1676.858) (-1684.125) * (-1678.588) [-1675.003] (-1679.363) (-1686.017) -- 0:00:33
      839000 -- (-1677.115) [-1674.702] (-1680.221) (-1680.485) * (-1675.974) (-1680.322) [-1675.132] (-1681.607) -- 0:00:33
      839500 -- (-1682.822) (-1680.118) [-1681.192] (-1680.419) * (-1684.472) [-1674.969] (-1678.096) (-1679.302) -- 0:00:32
      840000 -- (-1684.949) [-1677.515] (-1678.515) (-1685.841) * (-1674.401) (-1669.731) (-1679.470) [-1678.639] -- 0:00:32

      Average standard deviation of split frequencies: 0.010841

      840500 -- (-1677.208) (-1677.817) [-1678.619] (-1677.392) * (-1688.203) (-1675.398) (-1681.449) [-1676.756] -- 0:00:32
      841000 -- [-1676.549] (-1683.734) (-1687.151) (-1677.629) * (-1683.951) (-1678.449) (-1677.144) [-1677.873] -- 0:00:32
      841500 -- (-1676.978) (-1679.813) [-1683.445] (-1678.756) * (-1680.234) (-1681.378) [-1677.804] (-1675.024) -- 0:00:32
      842000 -- [-1679.826] (-1682.170) (-1680.112) (-1677.104) * (-1678.725) (-1675.136) [-1682.014] (-1674.762) -- 0:00:32
      842500 -- [-1679.713] (-1683.733) (-1684.098) (-1676.766) * (-1686.323) [-1673.573] (-1684.168) (-1679.268) -- 0:00:32
      843000 -- (-1677.479) [-1676.282] (-1673.876) (-1679.622) * (-1679.536) (-1678.179) (-1678.992) [-1675.368] -- 0:00:32
      843500 -- (-1686.382) (-1684.497) [-1682.820] (-1673.759) * (-1677.634) [-1680.668] (-1678.677) (-1676.802) -- 0:00:32
      844000 -- (-1674.728) [-1676.222] (-1678.751) (-1678.715) * [-1682.254] (-1671.678) (-1678.507) (-1679.800) -- 0:00:31
      844500 -- (-1687.957) [-1685.992] (-1682.073) (-1677.794) * (-1684.867) (-1676.607) (-1679.630) [-1678.922] -- 0:00:31
      845000 -- (-1675.041) (-1672.407) (-1674.750) [-1676.843] * (-1679.396) (-1683.884) [-1683.923] (-1679.183) -- 0:00:31

      Average standard deviation of split frequencies: 0.010587

      845500 -- (-1675.794) [-1676.169] (-1675.885) (-1680.571) * (-1684.634) (-1678.973) [-1670.775] (-1685.989) -- 0:00:31
      846000 -- [-1676.794] (-1670.813) (-1680.052) (-1684.899) * (-1677.163) (-1677.363) [-1678.900] (-1671.895) -- 0:00:31
      846500 -- (-1682.186) [-1673.066] (-1679.822) (-1680.913) * (-1676.627) [-1673.736] (-1673.665) (-1673.750) -- 0:00:31
      847000 -- (-1680.263) (-1677.354) [-1676.009] (-1680.927) * (-1672.649) (-1680.400) [-1675.055] (-1675.820) -- 0:00:31
      847500 -- [-1679.602] (-1677.653) (-1677.640) (-1673.860) * (-1679.490) (-1678.284) (-1675.120) [-1673.546] -- 0:00:31
      848000 -- (-1673.451) [-1673.017] (-1680.515) (-1676.272) * [-1680.067] (-1673.912) (-1676.918) (-1676.089) -- 0:00:31
      848500 -- (-1679.229) [-1676.961] (-1673.555) (-1683.281) * (-1689.560) (-1674.942) [-1673.829] (-1678.770) -- 0:00:31
      849000 -- (-1684.053) [-1677.678] (-1682.028) (-1682.295) * (-1680.487) (-1680.280) [-1675.241] (-1680.854) -- 0:00:30
      849500 -- (-1679.108) [-1674.661] (-1672.378) (-1679.365) * (-1675.377) (-1682.545) (-1677.981) [-1683.695] -- 0:00:30
      850000 -- [-1676.249] (-1672.023) (-1678.098) (-1678.121) * (-1682.633) [-1677.844] (-1678.853) (-1679.656) -- 0:00:30

      Average standard deviation of split frequencies: 0.010529

      850500 -- (-1680.883) [-1677.381] (-1687.287) (-1681.163) * (-1687.785) [-1675.383] (-1674.793) (-1681.364) -- 0:00:30
      851000 -- (-1686.701) [-1679.592] (-1681.763) (-1676.114) * (-1688.267) [-1678.834] (-1677.709) (-1682.811) -- 0:00:30
      851500 -- (-1671.861) (-1679.895) [-1678.474] (-1672.011) * (-1676.362) (-1685.872) (-1676.326) [-1679.850] -- 0:00:30
      852000 -- (-1676.761) [-1676.919] (-1682.196) (-1672.882) * (-1677.886) (-1681.401) (-1675.958) [-1675.074] -- 0:00:30
      852500 -- (-1678.129) (-1687.123) [-1674.512] (-1678.604) * (-1679.227) (-1673.308) [-1670.819] (-1677.981) -- 0:00:30
      853000 -- (-1677.599) (-1679.896) [-1682.762] (-1680.869) * (-1685.765) [-1679.865] (-1675.971) (-1695.497) -- 0:00:30
      853500 -- (-1682.202) [-1675.599] (-1684.668) (-1680.788) * (-1679.068) (-1682.978) (-1674.979) [-1676.707] -- 0:00:30
      854000 -- (-1688.707) (-1680.002) (-1678.934) [-1676.920] * (-1683.890) (-1671.488) [-1674.924] (-1684.296) -- 0:00:29
      854500 -- (-1686.595) (-1683.324) (-1672.538) [-1674.352] * (-1676.873) [-1673.059] (-1678.562) (-1679.207) -- 0:00:29
      855000 -- (-1679.667) (-1673.977) (-1674.036) [-1670.409] * (-1690.537) [-1680.252] (-1678.787) (-1676.150) -- 0:00:29

      Average standard deviation of split frequencies: 0.010463

      855500 -- (-1674.733) (-1690.429) [-1677.047] (-1673.870) * (-1677.040) [-1675.141] (-1688.392) (-1681.575) -- 0:00:29
      856000 -- (-1671.619) (-1683.057) (-1676.755) [-1671.260] * (-1675.799) (-1677.575) [-1684.010] (-1676.758) -- 0:00:29
      856500 -- [-1672.748] (-1684.458) (-1674.111) (-1675.712) * (-1673.184) [-1671.970] (-1674.577) (-1679.910) -- 0:00:29
      857000 -- (-1674.455) (-1684.554) [-1673.592] (-1679.515) * (-1678.623) (-1677.037) (-1681.313) [-1680.446] -- 0:00:29
      857500 -- [-1677.892] (-1672.394) (-1681.276) (-1686.736) * (-1684.734) (-1676.832) (-1680.265) [-1673.185] -- 0:00:29
      858000 -- (-1679.682) (-1676.529) [-1674.647] (-1682.492) * (-1677.464) (-1681.784) [-1682.811] (-1678.110) -- 0:00:29
      858500 -- (-1684.675) (-1681.795) (-1673.967) [-1676.549] * (-1687.661) (-1681.131) (-1672.881) [-1677.441] -- 0:00:29
      859000 -- (-1679.992) (-1682.890) (-1679.226) [-1676.345] * (-1683.472) (-1678.353) (-1682.733) [-1678.132] -- 0:00:28
      859500 -- (-1682.530) (-1677.594) (-1675.085) [-1676.223] * [-1677.261] (-1687.251) (-1681.169) (-1679.093) -- 0:00:28
      860000 -- (-1688.698) [-1677.767] (-1685.669) (-1674.469) * [-1683.322] (-1679.637) (-1680.395) (-1676.457) -- 0:00:28

      Average standard deviation of split frequencies: 0.010407

      860500 -- (-1681.689) (-1679.521) (-1674.419) [-1679.230] * (-1692.584) (-1674.648) (-1680.538) [-1677.400] -- 0:00:28
      861000 -- [-1679.445] (-1688.015) (-1684.305) (-1674.380) * (-1677.180) (-1677.380) (-1676.305) [-1682.592] -- 0:00:28
      861500 -- (-1676.045) (-1675.515) (-1677.001) [-1676.841] * (-1680.240) (-1684.149) [-1679.820] (-1689.362) -- 0:00:28
      862000 -- (-1685.169) (-1684.108) [-1677.164] (-1685.634) * (-1693.224) (-1676.171) [-1683.459] (-1679.863) -- 0:00:28
      862500 -- (-1679.151) (-1673.906) [-1671.362] (-1677.166) * (-1688.478) (-1680.695) (-1679.394) [-1683.236] -- 0:00:28
      863000 -- [-1676.306] (-1680.424) (-1672.241) (-1674.991) * (-1684.375) (-1682.794) (-1676.326) [-1676.496] -- 0:00:28
      863500 -- (-1673.908) [-1685.578] (-1670.032) (-1679.450) * (-1685.939) (-1679.087) [-1673.527] (-1674.038) -- 0:00:27
      864000 -- (-1688.543) (-1683.957) (-1675.567) [-1676.649] * (-1680.598) (-1678.719) (-1682.668) [-1685.757] -- 0:00:27
      864500 -- (-1677.589) (-1688.073) (-1679.811) [-1682.081] * (-1677.021) (-1673.541) (-1675.431) [-1679.120] -- 0:00:27
      865000 -- [-1679.473] (-1672.756) (-1681.052) (-1682.454) * (-1678.215) [-1677.114] (-1680.851) (-1681.511) -- 0:00:27

      Average standard deviation of split frequencies: 0.010705

      865500 -- (-1682.308) [-1679.328] (-1678.483) (-1679.393) * (-1684.839) (-1677.540) [-1676.442] (-1683.167) -- 0:00:27
      866000 -- (-1680.228) (-1675.627) [-1679.987] (-1681.722) * [-1677.389] (-1677.304) (-1678.159) (-1683.575) -- 0:00:27
      866500 -- (-1679.395) [-1679.239] (-1680.658) (-1675.561) * [-1679.061] (-1686.862) (-1675.093) (-1673.614) -- 0:00:27
      867000 -- (-1674.219) (-1684.961) (-1681.135) [-1677.285] * (-1678.973) [-1674.550] (-1673.993) (-1675.514) -- 0:00:27
      867500 -- (-1684.926) [-1676.374] (-1677.867) (-1672.105) * (-1678.620) [-1672.802] (-1680.488) (-1672.659) -- 0:00:27
      868000 -- (-1677.585) (-1679.242) [-1674.571] (-1678.965) * (-1677.289) [-1681.155] (-1680.283) (-1682.629) -- 0:00:27
      868500 -- (-1674.101) (-1681.495) [-1674.801] (-1676.857) * (-1675.201) (-1682.088) (-1676.733) [-1674.746] -- 0:00:26
      869000 -- (-1682.360) (-1679.609) [-1673.940] (-1679.384) * (-1682.545) (-1677.839) (-1675.505) [-1677.718] -- 0:00:26
      869500 -- (-1676.259) (-1680.451) (-1690.345) [-1679.706] * [-1672.706] (-1684.946) (-1677.411) (-1680.385) -- 0:00:26
      870000 -- (-1680.609) (-1676.820) (-1688.625) [-1674.385] * (-1685.448) [-1678.438] (-1682.221) (-1684.056) -- 0:00:26

      Average standard deviation of split frequencies: 0.010468

      870500 -- [-1686.363] (-1688.274) (-1683.381) (-1678.419) * [-1676.175] (-1677.063) (-1678.274) (-1684.827) -- 0:00:26
      871000 -- (-1686.198) (-1678.292) (-1674.799) [-1676.789] * [-1679.903] (-1673.097) (-1678.751) (-1682.321) -- 0:00:26
      871500 -- (-1676.591) [-1679.514] (-1687.309) (-1672.276) * (-1672.496) (-1676.728) (-1681.521) [-1685.160] -- 0:00:26
      872000 -- (-1672.565) [-1682.880] (-1679.780) (-1676.512) * (-1670.556) [-1678.498] (-1685.714) (-1676.403) -- 0:00:26
      872500 -- (-1671.217) (-1685.146) (-1678.946) [-1673.994] * [-1674.672] (-1679.974) (-1681.143) (-1680.728) -- 0:00:26
      873000 -- [-1674.123] (-1685.252) (-1672.129) (-1679.299) * (-1670.177) (-1686.471) [-1675.612] (-1679.261) -- 0:00:26
      873500 -- [-1678.709] (-1694.514) (-1673.258) (-1679.981) * (-1682.524) [-1685.220] (-1678.182) (-1687.221) -- 0:00:25
      874000 -- [-1681.701] (-1684.781) (-1675.621) (-1678.611) * (-1681.695) (-1683.465) (-1681.804) [-1681.601] -- 0:00:25
      874500 -- (-1690.299) (-1686.031) (-1693.790) [-1674.811] * (-1676.037) (-1671.159) [-1671.940] (-1679.134) -- 0:00:25
      875000 -- (-1677.627) [-1677.773] (-1686.188) (-1688.622) * (-1676.374) [-1670.380] (-1680.548) (-1681.685) -- 0:00:25

      Average standard deviation of split frequencies: 0.009866

      875500 -- (-1677.960) (-1683.078) [-1695.433] (-1682.322) * [-1678.295] (-1677.543) (-1677.589) (-1684.820) -- 0:00:25
      876000 -- (-1680.232) (-1681.176) (-1687.247) [-1681.094] * [-1680.735] (-1679.772) (-1673.191) (-1675.098) -- 0:00:25
      876500 -- (-1680.784) (-1683.320) (-1682.890) [-1672.544] * [-1686.767] (-1678.338) (-1673.777) (-1678.817) -- 0:00:25
      877000 -- (-1685.427) (-1673.924) (-1681.758) [-1681.712] * [-1672.993] (-1675.218) (-1684.489) (-1688.294) -- 0:00:25
      877500 -- [-1674.087] (-1678.713) (-1681.819) (-1676.553) * [-1675.355] (-1678.127) (-1676.846) (-1684.011) -- 0:00:25
      878000 -- (-1679.143) (-1677.047) [-1675.100] (-1681.835) * (-1678.410) (-1671.078) (-1675.480) [-1675.338] -- 0:00:25
      878500 -- (-1680.051) (-1677.857) (-1675.361) [-1673.079] * [-1676.216] (-1675.356) (-1688.641) (-1679.370) -- 0:00:24
      879000 -- (-1689.993) (-1675.996) [-1670.203] (-1673.395) * [-1674.302] (-1679.353) (-1685.035) (-1674.629) -- 0:00:24
      879500 -- (-1682.041) (-1678.559) [-1678.027] (-1678.260) * (-1681.476) (-1681.778) (-1680.643) [-1680.972] -- 0:00:24
      880000 -- (-1678.061) (-1683.996) [-1671.497] (-1676.261) * [-1677.553] (-1686.923) (-1688.153) (-1680.839) -- 0:00:24

      Average standard deviation of split frequencies: 0.009457

      880500 -- [-1682.213] (-1679.646) (-1681.893) (-1684.365) * [-1673.515] (-1679.630) (-1678.504) (-1675.830) -- 0:00:24
      881000 -- (-1678.570) (-1678.759) (-1694.293) [-1680.976] * (-1681.915) [-1679.089] (-1671.986) (-1681.066) -- 0:00:24
      881500 -- (-1676.929) [-1675.919] (-1685.288) (-1690.347) * [-1673.191] (-1680.887) (-1681.119) (-1675.936) -- 0:00:24
      882000 -- [-1677.668] (-1681.876) (-1676.429) (-1676.623) * (-1688.597) (-1676.521) [-1675.916] (-1684.273) -- 0:00:24
      882500 -- (-1683.919) [-1690.100] (-1676.713) (-1679.215) * (-1677.190) (-1688.124) (-1678.592) [-1672.260] -- 0:00:24
      883000 -- (-1684.571) (-1682.468) [-1675.830] (-1679.779) * [-1679.807] (-1681.947) (-1686.243) (-1678.522) -- 0:00:23
      883500 -- (-1685.963) (-1675.267) (-1677.887) [-1677.520] * (-1676.494) (-1683.609) [-1674.808] (-1676.487) -- 0:00:23
      884000 -- [-1676.822] (-1680.131) (-1684.849) (-1679.117) * (-1676.528) (-1682.427) (-1678.725) [-1676.545] -- 0:00:23
      884500 -- (-1674.811) [-1676.527] (-1680.046) (-1687.310) * [-1678.900] (-1676.263) (-1679.249) (-1679.891) -- 0:00:23
      885000 -- [-1678.123] (-1682.202) (-1678.570) (-1686.591) * (-1679.562) (-1681.887) [-1672.499] (-1674.226) -- 0:00:23

      Average standard deviation of split frequencies: 0.009754

      885500 -- (-1670.806) (-1677.790) (-1679.304) [-1677.056] * (-1684.250) (-1686.794) [-1676.880] (-1682.458) -- 0:00:23
      886000 -- (-1677.999) (-1686.242) (-1678.563) [-1675.658] * (-1686.608) (-1681.564) [-1674.280] (-1690.507) -- 0:00:23
      886500 -- (-1675.879) [-1679.669] (-1683.546) (-1678.590) * (-1675.625) (-1675.255) [-1678.433] (-1686.488) -- 0:00:23
      887000 -- [-1678.572] (-1669.183) (-1679.297) (-1687.045) * (-1676.149) (-1684.449) [-1672.678] (-1678.164) -- 0:00:23
      887500 -- (-1681.125) [-1675.808] (-1680.201) (-1686.268) * (-1680.982) [-1676.620] (-1683.757) (-1688.332) -- 0:00:23
      888000 -- (-1684.981) (-1681.189) [-1673.173] (-1687.844) * (-1677.219) (-1699.011) (-1674.552) [-1679.225] -- 0:00:22
      888500 -- (-1691.571) (-1690.417) (-1674.605) [-1679.380] * (-1675.109) (-1686.022) (-1676.850) [-1684.713] -- 0:00:22
      889000 -- (-1683.847) (-1680.513) (-1684.303) [-1675.046] * (-1674.116) (-1677.741) [-1675.920] (-1671.970) -- 0:00:22
      889500 -- (-1683.035) (-1683.012) (-1688.142) [-1673.099] * [-1672.191] (-1678.569) (-1678.300) (-1672.700) -- 0:00:22
      890000 -- (-1680.198) [-1683.998] (-1687.430) (-1674.992) * (-1675.047) [-1675.062] (-1675.608) (-1674.520) -- 0:00:22

      Average standard deviation of split frequencies: 0.009968

      890500 -- (-1675.982) (-1681.021) [-1681.464] (-1681.329) * (-1681.582) (-1671.691) (-1679.675) [-1674.293] -- 0:00:22
      891000 -- (-1683.198) [-1676.431] (-1678.332) (-1683.824) * (-1671.889) (-1676.323) [-1677.860] (-1675.511) -- 0:00:22
      891500 -- [-1677.382] (-1688.161) (-1687.729) (-1685.808) * [-1676.490] (-1677.272) (-1684.347) (-1675.447) -- 0:00:22
      892000 -- (-1674.079) (-1681.859) (-1680.798) [-1677.770] * (-1675.343) (-1675.918) [-1673.301] (-1676.631) -- 0:00:22
      892500 -- (-1676.365) (-1680.171) (-1681.457) [-1682.069] * (-1682.078) (-1681.678) [-1676.872] (-1672.314) -- 0:00:22
      893000 -- (-1683.695) (-1679.393) (-1675.009) [-1672.929] * (-1675.243) [-1677.725] (-1680.189) (-1680.651) -- 0:00:21
      893500 -- (-1674.319) [-1678.856] (-1682.161) (-1673.716) * (-1678.350) (-1672.637) (-1694.439) [-1680.634] -- 0:00:21
      894000 -- (-1674.359) (-1680.429) (-1684.960) [-1677.685] * (-1678.928) (-1677.779) (-1674.736) [-1678.819] -- 0:00:21
      894500 -- [-1673.168] (-1675.302) (-1689.156) (-1675.312) * (-1684.065) (-1683.681) (-1677.306) [-1674.101] -- 0:00:21
      895000 -- [-1679.619] (-1680.336) (-1679.677) (-1675.817) * (-1677.939) (-1679.096) [-1672.646] (-1675.468) -- 0:00:21

      Average standard deviation of split frequencies: 0.010347

      895500 -- (-1680.354) (-1675.486) [-1683.493] (-1676.017) * (-1684.683) (-1678.330) (-1682.290) [-1672.998] -- 0:00:21
      896000 -- (-1681.218) (-1674.219) [-1683.222] (-1675.222) * (-1691.700) (-1688.711) [-1681.462] (-1676.852) -- 0:00:21
      896500 -- (-1680.509) (-1680.514) (-1681.799) [-1682.014] * (-1680.154) [-1673.614] (-1675.440) (-1676.412) -- 0:00:21
      897000 -- [-1683.912] (-1679.081) (-1679.852) (-1675.074) * (-1678.558) (-1675.382) [-1676.887] (-1678.416) -- 0:00:21
      897500 -- (-1693.638) (-1686.433) (-1683.093) [-1674.411] * [-1677.654] (-1679.647) (-1673.258) (-1680.340) -- 0:00:21
      898000 -- (-1678.550) [-1680.324] (-1682.447) (-1676.651) * (-1676.760) (-1676.699) (-1680.932) [-1681.186] -- 0:00:20
      898500 -- (-1683.499) [-1675.211] (-1678.364) (-1676.579) * (-1681.547) (-1677.903) [-1676.654] (-1678.095) -- 0:00:20
      899000 -- [-1676.777] (-1682.049) (-1672.708) (-1680.233) * (-1683.704) [-1683.248] (-1684.387) (-1676.825) -- 0:00:20
      899500 -- (-1675.526) [-1673.942] (-1679.987) (-1677.802) * (-1681.315) (-1678.502) (-1677.478) [-1677.905] -- 0:00:20
      900000 -- (-1673.669) (-1676.571) [-1670.485] (-1680.177) * (-1680.586) (-1677.810) (-1677.171) [-1675.574] -- 0:00:20

      Average standard deviation of split frequencies: 0.010817

      900500 -- [-1672.737] (-1676.125) (-1672.090) (-1676.417) * (-1675.827) [-1676.750] (-1682.704) (-1680.502) -- 0:00:20
      901000 -- (-1677.245) (-1679.351) (-1680.598) [-1672.376] * (-1676.275) (-1677.134) [-1674.198] (-1680.667) -- 0:00:20
      901500 -- (-1676.603) (-1679.920) (-1687.419) [-1677.321] * (-1680.284) (-1680.100) [-1676.542] (-1679.755) -- 0:00:20
      902000 -- (-1678.568) (-1682.807) [-1680.503] (-1677.137) * (-1680.249) [-1683.116] (-1676.364) (-1682.717) -- 0:00:20
      902500 -- [-1682.201] (-1674.275) (-1674.710) (-1686.576) * (-1677.207) [-1673.986] (-1673.877) (-1685.156) -- 0:00:19
      903000 -- [-1675.966] (-1682.938) (-1676.275) (-1680.712) * [-1675.255] (-1675.865) (-1680.364) (-1685.581) -- 0:00:19
      903500 -- (-1680.354) [-1675.947] (-1677.211) (-1684.547) * (-1679.482) [-1675.933] (-1673.770) (-1686.067) -- 0:00:19
      904000 -- (-1679.804) (-1671.481) [-1678.974] (-1673.962) * (-1676.258) (-1682.188) (-1679.804) [-1680.686] -- 0:00:19
      904500 -- (-1691.236) (-1680.524) [-1676.993] (-1678.138) * [-1678.657] (-1679.116) (-1679.783) (-1685.051) -- 0:00:19
      905000 -- [-1684.350] (-1680.417) (-1677.677) (-1675.020) * [-1673.030] (-1675.997) (-1677.239) (-1678.700) -- 0:00:19

      Average standard deviation of split frequencies: 0.010580

      905500 -- (-1682.513) (-1674.760) (-1676.134) [-1672.615] * (-1683.896) [-1678.407] (-1673.904) (-1678.483) -- 0:00:19
      906000 -- (-1680.375) (-1680.886) (-1673.227) [-1669.579] * [-1676.960] (-1675.665) (-1679.345) (-1679.526) -- 0:00:19
      906500 -- (-1687.405) (-1684.718) (-1672.018) [-1676.997] * [-1678.938] (-1674.390) (-1678.338) (-1673.250) -- 0:00:19
      907000 -- [-1677.355] (-1675.999) (-1676.334) (-1676.772) * [-1674.433] (-1678.213) (-1687.624) (-1671.607) -- 0:00:19
      907500 -- [-1678.338] (-1677.349) (-1686.011) (-1677.915) * (-1682.354) (-1677.736) (-1677.513) [-1675.940] -- 0:00:18
      908000 -- (-1680.341) (-1681.936) [-1681.269] (-1681.005) * (-1684.123) (-1683.445) [-1676.717] (-1677.943) -- 0:00:18
      908500 -- (-1674.781) (-1685.473) [-1675.417] (-1677.253) * (-1679.210) [-1675.512] (-1677.870) (-1689.055) -- 0:00:18
      909000 -- (-1677.521) (-1675.546) (-1679.593) [-1673.158] * [-1678.706] (-1674.239) (-1675.994) (-1681.690) -- 0:00:18
      909500 -- (-1677.622) [-1686.461] (-1677.473) (-1682.611) * [-1679.800] (-1676.036) (-1680.422) (-1677.641) -- 0:00:18
      910000 -- [-1677.664] (-1679.448) (-1680.268) (-1674.520) * (-1680.742) (-1684.458) [-1684.461] (-1677.902) -- 0:00:18

      Average standard deviation of split frequencies: 0.011388

      910500 -- (-1676.266) (-1684.812) [-1675.094] (-1677.232) * (-1676.669) (-1679.452) [-1680.202] (-1680.312) -- 0:00:18
      911000 -- (-1688.410) (-1670.891) (-1680.355) [-1679.363] * (-1678.126) (-1682.058) (-1678.727) [-1683.409] -- 0:00:18
      911500 -- [-1681.155] (-1678.591) (-1684.160) (-1675.576) * (-1676.166) (-1685.738) (-1677.308) [-1674.681] -- 0:00:18
      912000 -- (-1679.593) [-1674.980] (-1676.342) (-1676.735) * [-1673.075] (-1686.603) (-1689.128) (-1680.797) -- 0:00:18
      912500 -- (-1677.582) [-1677.083] (-1680.861) (-1675.449) * (-1675.026) (-1677.910) [-1677.061] (-1687.470) -- 0:00:17
      913000 -- (-1681.503) [-1676.531] (-1680.865) (-1688.301) * (-1675.265) (-1682.883) [-1677.295] (-1687.393) -- 0:00:17
      913500 -- (-1684.076) [-1674.982] (-1682.531) (-1678.749) * (-1680.053) [-1687.559] (-1675.138) (-1679.502) -- 0:00:17
      914000 -- (-1687.661) [-1675.210] (-1684.678) (-1679.693) * (-1672.877) (-1681.392) (-1681.969) [-1675.556] -- 0:00:17
      914500 -- (-1676.653) [-1671.654] (-1682.444) (-1684.090) * [-1676.703] (-1685.448) (-1676.350) (-1679.107) -- 0:00:17
      915000 -- (-1679.348) (-1678.044) [-1674.397] (-1675.091) * (-1677.560) (-1677.140) (-1694.109) [-1674.927] -- 0:00:17

      Average standard deviation of split frequencies: 0.010807

      915500 -- (-1683.147) [-1673.311] (-1679.557) (-1680.832) * (-1677.490) (-1682.378) [-1676.988] (-1678.532) -- 0:00:17
      916000 -- (-1679.592) (-1681.203) (-1682.509) [-1679.684] * (-1697.775) (-1678.089) [-1674.741] (-1677.582) -- 0:00:17
      916500 -- [-1675.994] (-1679.190) (-1678.853) (-1675.726) * (-1683.141) (-1685.712) [-1679.944] (-1682.936) -- 0:00:17
      917000 -- (-1679.360) (-1679.960) [-1678.207] (-1682.381) * (-1671.809) [-1686.721] (-1679.592) (-1683.977) -- 0:00:17
      917500 -- [-1676.647] (-1680.726) (-1688.484) (-1682.233) * (-1678.455) (-1684.877) [-1677.429] (-1678.322) -- 0:00:16
      918000 -- (-1675.712) (-1673.312) (-1684.702) [-1677.861] * (-1682.053) (-1678.113) [-1671.238] (-1671.993) -- 0:00:16
      918500 -- (-1682.092) (-1676.893) (-1675.888) [-1677.045] * (-1675.943) (-1682.354) [-1677.814] (-1676.691) -- 0:00:16
      919000 -- (-1681.452) [-1675.936] (-1674.133) (-1682.296) * (-1679.216) [-1674.716] (-1680.011) (-1675.831) -- 0:00:16
      919500 -- (-1683.155) (-1677.980) [-1673.334] (-1674.238) * (-1677.609) (-1679.652) (-1678.531) [-1674.753] -- 0:00:16
      920000 -- (-1682.307) (-1681.107) [-1674.806] (-1677.725) * (-1673.978) (-1681.704) (-1676.484) [-1678.436] -- 0:00:16

      Average standard deviation of split frequencies: 0.010753

      920500 -- (-1676.456) [-1678.104] (-1677.815) (-1674.629) * (-1680.573) [-1677.766] (-1679.628) (-1680.595) -- 0:00:16
      921000 -- (-1683.400) (-1682.389) (-1679.666) [-1674.160] * (-1677.152) (-1683.003) [-1680.383] (-1680.720) -- 0:00:16
      921500 -- (-1677.953) [-1675.923] (-1678.313) (-1683.244) * (-1687.987) (-1677.601) (-1678.762) [-1680.009] -- 0:00:16
      922000 -- [-1677.952] (-1690.400) (-1679.939) (-1680.677) * (-1689.958) (-1675.835) [-1676.850] (-1671.501) -- 0:00:15
      922500 -- (-1675.521) [-1680.205] (-1675.767) (-1678.433) * (-1683.890) (-1672.316) [-1678.520] (-1680.957) -- 0:00:15
      923000 -- [-1671.894] (-1679.069) (-1672.994) (-1677.255) * (-1682.520) (-1685.824) (-1679.974) [-1675.810] -- 0:00:15
      923500 -- [-1678.713] (-1675.711) (-1676.056) (-1681.734) * (-1679.517) (-1683.878) [-1673.921] (-1679.922) -- 0:00:15
      924000 -- (-1681.431) [-1685.201] (-1681.948) (-1675.986) * (-1680.248) (-1686.960) (-1672.167) [-1677.202] -- 0:00:15
      924500 -- [-1677.544] (-1679.071) (-1676.296) (-1678.011) * (-1676.647) (-1689.343) [-1679.123] (-1679.559) -- 0:00:15
      925000 -- (-1684.196) (-1674.426) (-1681.373) [-1677.380] * (-1679.307) (-1676.840) [-1676.558] (-1673.973) -- 0:00:15

      Average standard deviation of split frequencies: 0.010521

      925500 -- (-1685.588) (-1680.260) (-1684.185) [-1678.418] * [-1673.691] (-1674.450) (-1676.136) (-1690.185) -- 0:00:15
      926000 -- [-1673.985] (-1684.512) (-1680.435) (-1673.216) * (-1684.249) (-1684.745) (-1672.853) [-1671.505] -- 0:00:15
      926500 -- (-1683.407) (-1674.289) (-1677.142) [-1679.605] * [-1679.907] (-1679.069) (-1680.878) (-1680.480) -- 0:00:15
      927000 -- (-1680.119) (-1675.931) (-1681.236) [-1674.348] * (-1683.415) (-1678.511) [-1675.803] (-1678.981) -- 0:00:14
      927500 -- (-1679.079) (-1678.361) [-1675.786] (-1684.375) * (-1680.262) [-1682.451] (-1680.976) (-1683.344) -- 0:00:14
      928000 -- (-1681.039) [-1680.126] (-1671.915) (-1678.832) * (-1678.573) [-1677.745] (-1681.291) (-1683.407) -- 0:00:14
      928500 -- [-1676.934] (-1677.581) (-1677.769) (-1679.841) * [-1675.282] (-1690.841) (-1682.647) (-1677.817) -- 0:00:14
      929000 -- [-1670.923] (-1677.568) (-1680.829) (-1684.800) * (-1681.286) (-1676.136) [-1679.264] (-1678.822) -- 0:00:14
      929500 -- (-1683.995) (-1680.746) (-1688.288) [-1680.028] * (-1680.101) (-1685.591) (-1691.264) [-1678.178] -- 0:00:14
      930000 -- (-1685.321) [-1672.048] (-1673.136) (-1675.241) * (-1676.119) [-1675.334] (-1675.059) (-1676.983) -- 0:00:14

      Average standard deviation of split frequencies: 0.010130

      930500 -- [-1679.526] (-1673.489) (-1678.363) (-1679.301) * (-1674.060) [-1677.804] (-1677.975) (-1684.588) -- 0:00:14
      931000 -- (-1684.728) (-1677.485) [-1672.103] (-1670.075) * (-1685.912) (-1682.202) [-1679.037] (-1684.516) -- 0:00:14
      931500 -- [-1676.930] (-1677.038) (-1677.628) (-1685.961) * [-1675.094] (-1687.418) (-1681.287) (-1682.290) -- 0:00:14
      932000 -- (-1684.654) [-1673.509] (-1679.146) (-1681.576) * (-1677.880) (-1684.346) (-1678.871) [-1675.460] -- 0:00:13
      932500 -- (-1677.519) (-1674.091) [-1677.609] (-1684.688) * (-1681.725) (-1681.797) (-1682.228) [-1674.135] -- 0:00:13
      933000 -- (-1679.859) (-1673.870) (-1678.420) [-1675.366] * (-1688.861) (-1683.164) (-1682.557) [-1679.168] -- 0:00:13
      933500 -- (-1677.448) [-1677.712] (-1679.482) (-1681.818) * (-1680.749) (-1677.200) (-1673.910) [-1676.636] -- 0:00:13
      934000 -- [-1677.375] (-1678.208) (-1679.193) (-1671.513) * (-1674.066) (-1679.453) (-1681.715) [-1679.549] -- 0:00:13
      934500 -- (-1677.434) [-1677.960] (-1683.835) (-1680.887) * (-1680.344) (-1675.010) (-1682.765) [-1677.275] -- 0:00:13
      935000 -- (-1681.468) (-1676.411) [-1678.126] (-1680.370) * (-1678.753) [-1673.262] (-1676.453) (-1677.611) -- 0:00:13

      Average standard deviation of split frequencies: 0.010073

      935500 -- (-1676.415) (-1674.648) (-1677.525) [-1674.143] * (-1679.868) (-1679.488) (-1681.563) [-1672.655] -- 0:00:13
      936000 -- (-1675.693) (-1685.640) [-1674.231] (-1675.070) * (-1680.097) [-1677.514] (-1675.183) (-1682.506) -- 0:00:13
      936500 -- (-1680.061) [-1680.853] (-1674.163) (-1680.001) * [-1677.193] (-1676.842) (-1680.490) (-1680.043) -- 0:00:13
      937000 -- (-1676.129) (-1677.586) [-1676.691] (-1675.904) * (-1683.414) (-1683.879) [-1676.622] (-1679.561) -- 0:00:12
      937500 -- (-1671.419) (-1677.560) [-1677.544] (-1676.201) * (-1683.353) [-1676.879] (-1676.655) (-1680.569) -- 0:00:12
      938000 -- (-1673.712) (-1682.529) [-1675.476] (-1676.296) * (-1681.160) (-1675.400) (-1677.919) [-1671.658] -- 0:00:12
      938500 -- (-1679.042) (-1677.582) (-1677.225) [-1675.437] * [-1681.574] (-1674.434) (-1689.253) (-1674.900) -- 0:00:12
      939000 -- (-1672.919) (-1677.135) [-1681.292] (-1684.720) * [-1673.355] (-1673.688) (-1678.628) (-1677.197) -- 0:00:12
      939500 -- (-1681.517) [-1681.237] (-1687.601) (-1686.010) * (-1681.642) (-1682.455) [-1677.747] (-1681.336) -- 0:00:12
      940000 -- [-1678.992] (-1680.724) (-1683.355) (-1685.905) * (-1680.418) (-1676.922) [-1674.025] (-1673.705) -- 0:00:12

      Average standard deviation of split frequencies: 0.010691

      940500 -- [-1678.998] (-1680.571) (-1679.970) (-1674.038) * (-1678.683) [-1670.145] (-1686.065) (-1672.460) -- 0:00:12
      941000 -- (-1682.247) (-1681.299) [-1671.725] (-1672.417) * (-1685.386) [-1672.805] (-1678.362) (-1678.638) -- 0:00:12
      941500 -- (-1683.803) (-1687.378) [-1673.146] (-1672.286) * [-1680.585] (-1677.819) (-1679.269) (-1678.167) -- 0:00:11
      942000 -- (-1680.516) (-1687.435) (-1675.775) [-1673.865] * (-1680.958) (-1673.321) (-1676.780) [-1672.686] -- 0:00:11
      942500 -- (-1677.918) (-1679.544) [-1673.570] (-1678.598) * (-1686.522) (-1672.680) [-1672.729] (-1681.891) -- 0:00:11
      943000 -- (-1684.344) (-1676.048) [-1672.812] (-1677.874) * [-1681.516] (-1676.367) (-1680.396) (-1674.121) -- 0:00:11
      943500 -- [-1684.929] (-1675.728) (-1677.759) (-1677.966) * (-1678.860) (-1674.172) (-1686.062) [-1677.097] -- 0:00:11
      944000 -- (-1678.268) (-1678.967) (-1673.746) [-1671.653] * [-1679.494] (-1675.772) (-1674.564) (-1674.349) -- 0:00:11
      944500 -- (-1674.582) [-1680.994] (-1675.418) (-1683.517) * (-1684.159) [-1681.294] (-1675.008) (-1690.606) -- 0:00:11
      945000 -- (-1673.423) [-1673.274] (-1676.721) (-1674.081) * (-1677.360) (-1676.458) [-1675.392] (-1682.228) -- 0:00:11

      Average standard deviation of split frequencies: 0.010797

      945500 -- (-1682.615) [-1676.449] (-1675.599) (-1680.688) * (-1679.172) [-1685.135] (-1675.741) (-1687.153) -- 0:00:11
      946000 -- (-1674.221) (-1682.813) (-1674.046) [-1678.983] * (-1677.821) (-1681.025) [-1679.423] (-1681.316) -- 0:00:11
      946500 -- (-1680.845) [-1673.689] (-1677.147) (-1675.955) * (-1677.370) (-1676.483) (-1684.115) [-1680.247] -- 0:00:10
      947000 -- (-1681.099) [-1675.586] (-1678.035) (-1684.832) * (-1679.421) (-1680.742) [-1680.597] (-1682.679) -- 0:00:10
      947500 -- [-1673.122] (-1678.265) (-1685.364) (-1675.318) * (-1685.198) [-1675.449] (-1687.395) (-1675.443) -- 0:00:10
      948000 -- (-1676.907) (-1673.523) [-1687.162] (-1676.901) * (-1679.431) (-1679.335) (-1679.691) [-1677.642] -- 0:00:10
      948500 -- (-1676.274) (-1679.560) [-1679.399] (-1683.122) * (-1676.855) (-1675.282) (-1683.637) [-1677.778] -- 0:00:10
      949000 -- (-1691.269) [-1673.171] (-1676.175) (-1679.529) * (-1673.539) (-1676.259) (-1680.914) [-1685.257] -- 0:00:10
      949500 -- (-1672.907) (-1682.051) (-1683.837) [-1675.656] * (-1683.193) [-1677.532] (-1693.614) (-1679.244) -- 0:00:10
      950000 -- (-1679.980) (-1683.058) (-1676.484) [-1683.003] * [-1684.656] (-1680.586) (-1685.998) (-1686.616) -- 0:00:10

      Average standard deviation of split frequencies: 0.010579

      950500 -- (-1675.472) (-1680.025) (-1681.976) [-1674.055] * (-1675.015) [-1672.394] (-1684.020) (-1677.409) -- 0:00:10
      951000 -- (-1680.461) (-1684.145) (-1676.508) [-1675.141] * (-1674.629) (-1682.298) [-1686.132] (-1678.017) -- 0:00:10
      951500 -- (-1679.294) [-1675.919] (-1678.083) (-1677.923) * [-1675.113] (-1682.094) (-1686.379) (-1678.265) -- 0:00:09
      952000 -- [-1679.622] (-1684.712) (-1678.696) (-1673.529) * (-1685.345) (-1681.733) [-1686.211] (-1682.065) -- 0:00:09
      952500 -- (-1675.107) (-1674.811) [-1673.232] (-1676.836) * (-1679.623) [-1681.575] (-1673.779) (-1693.178) -- 0:00:09
      953000 -- (-1678.458) [-1678.027] (-1676.169) (-1673.721) * [-1676.488] (-1674.555) (-1680.969) (-1687.188) -- 0:00:09
      953500 -- [-1675.075] (-1683.808) (-1681.681) (-1686.537) * [-1671.042] (-1677.333) (-1682.301) (-1679.545) -- 0:00:09
      954000 -- (-1678.108) [-1683.699] (-1679.157) (-1680.520) * (-1675.059) (-1685.395) (-1677.204) [-1680.583] -- 0:00:09
      954500 -- [-1677.298] (-1679.842) (-1675.541) (-1677.409) * (-1682.647) (-1680.401) (-1671.464) [-1680.369] -- 0:00:09
      955000 -- (-1676.859) [-1678.480] (-1672.010) (-1678.955) * [-1676.190] (-1676.597) (-1674.278) (-1676.749) -- 0:00:09

      Average standard deviation of split frequencies: 0.009862

      955500 -- (-1685.659) (-1681.029) [-1675.792] (-1672.617) * (-1677.902) (-1679.450) [-1678.249] (-1682.938) -- 0:00:09
      956000 -- (-1681.611) (-1677.877) (-1679.305) [-1676.884] * (-1677.067) [-1678.435] (-1688.007) (-1674.623) -- 0:00:09
      956500 -- (-1678.866) [-1671.904] (-1680.910) (-1674.694) * (-1678.055) (-1679.385) [-1673.601] (-1677.016) -- 0:00:08
      957000 -- (-1678.410) [-1681.869] (-1678.044) (-1686.669) * (-1674.108) [-1684.860] (-1679.309) (-1677.836) -- 0:00:08
      957500 -- [-1677.845] (-1679.760) (-1677.350) (-1682.807) * (-1681.703) (-1672.488) [-1675.679] (-1688.044) -- 0:00:08
      958000 -- (-1680.381) [-1676.324] (-1679.185) (-1676.261) * [-1674.929] (-1676.019) (-1678.645) (-1679.733) -- 0:00:08
      958500 -- (-1673.504) [-1672.372] (-1674.537) (-1681.268) * [-1681.672] (-1678.691) (-1677.629) (-1683.265) -- 0:00:08
      959000 -- (-1679.388) (-1675.789) [-1676.421] (-1674.040) * (-1681.990) [-1674.720] (-1673.337) (-1682.426) -- 0:00:08
      959500 -- (-1678.260) (-1671.214) [-1677.680] (-1675.130) * [-1680.967] (-1677.093) (-1682.496) (-1674.758) -- 0:00:08
      960000 -- (-1679.667) (-1681.178) (-1677.055) [-1673.885] * (-1680.064) (-1682.174) [-1680.432] (-1682.620) -- 0:00:08

      Average standard deviation of split frequencies: 0.010141

      960500 -- (-1684.096) [-1681.390] (-1679.604) (-1674.333) * (-1678.621) [-1678.393] (-1678.805) (-1675.726) -- 0:00:08
      961000 -- (-1679.603) (-1683.328) [-1671.449] (-1674.695) * [-1676.043] (-1679.423) (-1682.466) (-1681.680) -- 0:00:07
      961500 -- (-1676.439) (-1688.173) (-1674.942) [-1675.979] * (-1692.412) [-1678.081] (-1673.381) (-1676.310) -- 0:00:07
      962000 -- (-1683.723) [-1684.427] (-1673.278) (-1685.703) * (-1679.892) [-1677.479] (-1678.240) (-1688.268) -- 0:00:07
      962500 -- (-1683.095) (-1678.981) [-1673.606] (-1681.963) * [-1674.314] (-1681.437) (-1674.715) (-1680.596) -- 0:00:07
      963000 -- [-1679.488] (-1678.176) (-1678.687) (-1689.148) * [-1677.413] (-1683.405) (-1677.587) (-1681.696) -- 0:00:07
      963500 -- [-1683.542] (-1679.117) (-1680.826) (-1691.069) * (-1674.941) (-1681.378) [-1677.504] (-1679.917) -- 0:00:07
      964000 -- (-1676.279) (-1680.617) [-1680.323] (-1684.387) * (-1684.859) (-1687.249) [-1679.519] (-1681.423) -- 0:00:07
      964500 -- [-1681.443] (-1674.390) (-1679.350) (-1683.347) * (-1678.234) (-1680.198) (-1687.253) [-1674.241] -- 0:00:07
      965000 -- (-1689.807) (-1680.410) (-1682.429) [-1675.574] * (-1682.128) [-1673.947] (-1673.934) (-1682.656) -- 0:00:07

      Average standard deviation of split frequencies: 0.009923

      965500 -- (-1694.176) (-1673.842) (-1682.864) [-1676.077] * (-1680.563) (-1679.804) [-1679.142] (-1680.301) -- 0:00:07
      966000 -- (-1689.372) (-1677.278) [-1677.897] (-1678.188) * (-1677.708) (-1677.847) [-1676.708] (-1678.257) -- 0:00:06
      966500 -- [-1681.178] (-1687.867) (-1673.039) (-1677.379) * [-1671.545] (-1679.132) (-1688.460) (-1680.144) -- 0:00:06
      967000 -- (-1678.107) (-1685.102) [-1674.098] (-1685.060) * (-1678.113) (-1676.555) (-1681.691) [-1672.221] -- 0:00:06
      967500 -- [-1679.172] (-1673.243) (-1678.201) (-1678.229) * [-1676.321] (-1679.649) (-1682.599) (-1679.505) -- 0:00:06
      968000 -- (-1690.433) (-1684.170) (-1680.357) [-1680.109] * [-1677.347] (-1677.819) (-1682.883) (-1678.527) -- 0:00:06
      968500 -- (-1677.750) (-1680.251) [-1673.829] (-1670.765) * (-1679.513) (-1674.827) [-1674.516] (-1679.926) -- 0:00:06
      969000 -- [-1681.653] (-1674.552) (-1678.960) (-1676.455) * (-1677.498) (-1687.815) (-1683.510) [-1673.342] -- 0:00:06
      969500 -- (-1674.709) (-1683.485) (-1673.639) [-1680.757] * (-1680.703) (-1685.172) [-1677.416] (-1687.490) -- 0:00:06
      970000 -- (-1675.822) [-1677.207] (-1673.919) (-1679.257) * (-1687.908) (-1676.020) (-1688.275) [-1682.574] -- 0:00:06

      Average standard deviation of split frequencies: 0.010037

      970500 -- [-1677.087] (-1691.290) (-1682.217) (-1673.195) * (-1687.630) (-1676.666) (-1681.292) [-1678.784] -- 0:00:06
      971000 -- (-1672.268) (-1683.610) (-1686.856) [-1673.937] * (-1685.892) [-1677.726] (-1682.088) (-1672.770) -- 0:00:05
      971500 -- (-1675.088) [-1679.960] (-1678.612) (-1675.591) * (-1678.896) (-1689.085) [-1675.269] (-1677.753) -- 0:00:05
      972000 -- (-1677.456) (-1673.789) (-1684.327) [-1675.896] * (-1683.887) (-1676.706) [-1672.145] (-1680.624) -- 0:00:05
      972500 -- [-1674.859] (-1680.782) (-1676.670) (-1675.826) * (-1678.307) (-1673.597) (-1670.778) [-1677.252] -- 0:00:05
      973000 -- [-1678.872] (-1677.737) (-1674.822) (-1685.453) * [-1672.991] (-1675.512) (-1682.547) (-1673.379) -- 0:00:05
      973500 -- (-1682.193) (-1688.822) [-1674.413] (-1682.295) * (-1674.012) (-1676.161) [-1686.827] (-1677.018) -- 0:00:05
      974000 -- (-1676.877) (-1680.909) (-1682.012) [-1676.260] * [-1676.929] (-1676.556) (-1678.780) (-1682.851) -- 0:00:05
      974500 -- [-1679.103] (-1681.696) (-1678.549) (-1682.199) * [-1676.393] (-1679.587) (-1682.466) (-1673.519) -- 0:00:05
      975000 -- (-1681.809) (-1679.295) [-1673.268] (-1685.823) * (-1682.740) [-1673.857] (-1672.166) (-1684.923) -- 0:00:05

      Average standard deviation of split frequencies: 0.010304

      975500 -- [-1672.984] (-1680.059) (-1678.546) (-1674.301) * [-1677.888] (-1687.585) (-1682.312) (-1682.619) -- 0:00:05
      976000 -- [-1672.289] (-1673.856) (-1681.774) (-1678.804) * (-1688.506) [-1673.611] (-1681.726) (-1676.627) -- 0:00:04
      976500 -- [-1676.004] (-1689.673) (-1683.740) (-1681.426) * [-1675.712] (-1683.380) (-1695.566) (-1686.624) -- 0:00:04
      977000 -- (-1685.592) (-1681.014) [-1686.173] (-1681.523) * (-1677.719) (-1680.251) (-1684.572) [-1681.785] -- 0:00:04
      977500 -- (-1677.737) (-1686.708) [-1678.034] (-1676.520) * (-1678.853) [-1672.143] (-1674.872) (-1681.106) -- 0:00:04
      978000 -- (-1678.772) (-1678.142) (-1686.239) [-1671.485] * (-1684.254) [-1672.975] (-1676.153) (-1681.530) -- 0:00:04
      978500 -- (-1677.928) [-1676.497] (-1679.620) (-1682.328) * [-1680.530] (-1683.570) (-1670.103) (-1678.782) -- 0:00:04
      979000 -- (-1677.860) (-1676.469) (-1685.506) [-1681.346] * (-1679.918) (-1679.333) [-1674.788] (-1682.714) -- 0:00:04
      979500 -- (-1690.011) [-1674.265] (-1680.616) (-1679.197) * (-1675.070) [-1676.034] (-1684.534) (-1681.873) -- 0:00:04
      980000 -- (-1680.774) [-1671.389] (-1673.772) (-1680.274) * (-1680.608) [-1678.037] (-1681.309) (-1678.259) -- 0:00:04

      Average standard deviation of split frequencies: 0.010575

      980500 -- (-1684.098) [-1671.994] (-1676.927) (-1682.551) * [-1676.412] (-1677.631) (-1680.235) (-1683.585) -- 0:00:03
      981000 -- [-1683.976] (-1677.265) (-1676.229) (-1676.828) * [-1678.346] (-1686.552) (-1689.476) (-1683.494) -- 0:00:03
      981500 -- [-1673.456] (-1676.343) (-1679.737) (-1695.633) * (-1673.226) (-1680.694) [-1672.745] (-1678.462) -- 0:00:03
      982000 -- (-1674.906) (-1680.363) [-1671.911] (-1680.224) * (-1676.269) (-1674.608) (-1678.993) [-1676.190] -- 0:00:03
      982500 -- (-1678.059) (-1685.635) [-1674.913] (-1679.102) * [-1674.170] (-1682.289) (-1676.109) (-1672.825) -- 0:00:03
      983000 -- [-1683.997] (-1675.163) (-1683.575) (-1677.569) * (-1682.436) [-1683.419] (-1678.410) (-1682.596) -- 0:00:03
      983500 -- (-1678.427) [-1678.441] (-1684.881) (-1691.021) * (-1678.199) [-1678.709] (-1673.465) (-1680.565) -- 0:00:03
      984000 -- (-1677.706) (-1682.074) (-1684.368) [-1674.057] * (-1682.275) (-1679.400) [-1687.570] (-1682.769) -- 0:00:03
      984500 -- (-1675.973) [-1676.591] (-1682.729) (-1692.216) * (-1674.756) (-1679.299) [-1676.495] (-1675.746) -- 0:00:03
      985000 -- (-1676.032) (-1675.712) [-1678.474] (-1679.002) * (-1687.025) (-1672.462) (-1677.838) [-1673.302] -- 0:00:03

      Average standard deviation of split frequencies: 0.010678

      985500 -- (-1673.910) (-1680.062) [-1678.749] (-1688.362) * [-1676.194] (-1676.292) (-1678.881) (-1680.242) -- 0:00:02
      986000 -- [-1677.086] (-1683.319) (-1671.934) (-1680.014) * [-1673.878] (-1677.588) (-1673.920) (-1675.570) -- 0:00:02
      986500 -- (-1686.803) (-1674.705) (-1676.093) [-1680.108] * [-1679.619] (-1675.175) (-1680.801) (-1679.749) -- 0:00:02
      987000 -- (-1679.480) (-1678.392) (-1684.497) [-1675.239] * (-1683.116) (-1676.661) (-1684.949) [-1681.988] -- 0:00:02
      987500 -- (-1675.939) [-1685.239] (-1678.165) (-1686.233) * (-1682.365) (-1679.177) (-1682.356) [-1686.067] -- 0:00:02
      988000 -- (-1675.168) [-1681.001] (-1675.206) (-1688.480) * [-1678.967] (-1680.689) (-1683.136) (-1677.088) -- 0:00:02
      988500 -- [-1680.904] (-1685.326) (-1677.645) (-1675.053) * [-1669.783] (-1677.803) (-1680.377) (-1681.325) -- 0:00:02
      989000 -- (-1671.372) (-1676.521) (-1683.371) [-1681.053] * (-1674.215) (-1675.013) (-1681.581) [-1688.017] -- 0:00:02
      989500 -- (-1674.718) [-1672.468] (-1682.381) (-1676.334) * [-1672.393] (-1684.077) (-1684.818) (-1678.472) -- 0:00:02
      990000 -- (-1683.190) (-1679.327) (-1678.949) [-1678.821] * (-1673.408) (-1679.542) (-1679.584) [-1676.366] -- 0:00:02

      Average standard deviation of split frequencies: 0.010786

      990500 -- (-1681.268) (-1680.475) [-1683.959] (-1676.055) * (-1680.754) (-1677.610) [-1678.225] (-1683.626) -- 0:00:01
      991000 -- (-1682.669) (-1679.216) [-1674.595] (-1676.712) * (-1673.269) (-1681.631) [-1674.644] (-1685.072) -- 0:00:01
      991500 -- (-1678.204) (-1683.253) [-1672.911] (-1679.555) * (-1676.865) (-1673.843) [-1677.191] (-1683.526) -- 0:00:01
      992000 -- (-1673.060) [-1679.084] (-1677.771) (-1675.558) * [-1670.155] (-1674.509) (-1676.243) (-1684.207) -- 0:00:01
      992500 -- [-1675.270] (-1682.445) (-1683.393) (-1675.932) * [-1682.149] (-1673.389) (-1679.067) (-1683.722) -- 0:00:01
      993000 -- [-1680.581] (-1682.949) (-1680.158) (-1673.924) * [-1673.619] (-1680.509) (-1685.877) (-1673.358) -- 0:00:01
      993500 -- (-1679.121) [-1674.306] (-1688.698) (-1677.838) * [-1678.359] (-1678.558) (-1680.521) (-1685.450) -- 0:00:01
      994000 -- (-1693.084) (-1680.029) (-1692.009) [-1680.212] * (-1674.345) (-1688.450) [-1677.589] (-1676.230) -- 0:00:01
      994500 -- (-1687.856) (-1691.733) (-1681.056) [-1673.553] * [-1681.222] (-1670.406) (-1675.270) (-1676.164) -- 0:00:01
      995000 -- (-1685.900) (-1686.274) [-1673.809] (-1676.588) * (-1684.948) [-1676.834] (-1672.032) (-1681.250) -- 0:00:01

      Average standard deviation of split frequencies: 0.010097

      995500 -- [-1676.990] (-1688.387) (-1680.734) (-1681.447) * (-1676.651) (-1681.098) (-1676.765) [-1677.112] -- 0:00:00
      996000 -- [-1680.752] (-1684.241) (-1681.032) (-1680.447) * (-1683.420) [-1676.429] (-1674.771) (-1677.271) -- 0:00:00
      996500 -- (-1677.095) (-1692.176) [-1678.480] (-1683.325) * [-1677.358] (-1687.012) (-1676.697) (-1676.734) -- 0:00:00
      997000 -- [-1674.606] (-1686.303) (-1673.619) (-1677.836) * (-1675.735) (-1683.019) [-1674.841] (-1677.272) -- 0:00:00
      997500 -- (-1679.392) (-1676.651) (-1684.768) [-1683.347] * (-1673.836) (-1680.854) (-1675.935) [-1674.379] -- 0:00:00
      998000 -- (-1678.230) (-1676.776) [-1674.912] (-1680.779) * (-1683.562) (-1682.578) (-1675.483) [-1684.349] -- 0:00:00
      998500 -- (-1683.016) (-1680.802) [-1680.975] (-1681.649) * (-1681.252) (-1698.282) (-1670.920) [-1674.353] -- 0:00:00
      999000 -- (-1682.565) (-1680.022) (-1675.599) [-1677.981] * (-1683.090) (-1678.985) (-1684.305) [-1676.530] -- 0:00:00
      999500 -- (-1679.186) (-1687.544) [-1680.808] (-1680.789) * [-1676.294] (-1674.938) (-1681.515) (-1678.197) -- 0:00:00
      1000000 -- [-1674.407] (-1684.006) (-1685.112) (-1676.716) * (-1677.697) (-1688.109) [-1685.374] (-1672.906) -- 0:00:00

      Average standard deviation of split frequencies: 0.010364
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -1674.407098 -- 21.606205
         Chain 1 -- -1674.407098 -- 21.606205
         Chain 2 -- -1684.005664 -- 20.433565
         Chain 2 -- -1684.005664 -- 20.433565
         Chain 3 -- -1685.111715 -- 18.816683
         Chain 3 -- -1685.111720 -- 18.816683
         Chain 4 -- -1676.715682 -- 21.143750
         Chain 4 -- -1676.715686 -- 21.143750
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -1677.696970 -- 21.692352
         Chain 1 -- -1677.696970 -- 21.692352
         Chain 2 -- -1688.109033 -- 21.176000
         Chain 2 -- -1688.109032 -- 21.176000
         Chain 3 -- -1685.373721 -- 20.343041
         Chain 3 -- -1685.373721 -- 20.343041
         Chain 4 -- -1672.906200 -- 22.151408
         Chain 4 -- -1672.906201 -- 22.151408

      Analysis completed in 3 mins 25 seconds
      Analysis used 205.29 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -1666.74
      Likelihood of best state for "cold" chain of run 2 was -1667.00

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            59.0 %     ( 49 %)     Dirichlet(Revmat{all})
            72.7 %     ( 54 %)     Slider(Revmat{all})
            26.6 %     ( 22 %)     Dirichlet(Pi{all})
            28.3 %     ( 35 %)     Slider(Pi{all})
            70.2 %     ( 38 %)     Multiplier(Alpha{1,2})
            52.2 %     ( 23 %)     Multiplier(Alpha{3})
            76.3 %     ( 62 %)     Slider(Pinvar{all})
            12.5 %     ( 13 %)     ExtSPR(Tau{all},V{all})
             6.2 %     (  6 %)     ExtTBR(Tau{all},V{all})
            25.4 %     ( 20 %)     NNI(Tau{all},V{all})
            20.7 %     ( 27 %)     ParsSPR(Tau{all},V{all})
            26.8 %     ( 26 %)     Multiplier(V{all})
            42.9 %     ( 40 %)     Nodeslider(V{all})
            25.7 %     ( 33 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            58.7 %     ( 51 %)     Dirichlet(Revmat{all})
            72.4 %     ( 62 %)     Slider(Revmat{all})
            26.4 %     ( 22 %)     Dirichlet(Pi{all})
            28.3 %     ( 23 %)     Slider(Pi{all})
            69.7 %     ( 51 %)     Multiplier(Alpha{1,2})
            52.1 %     ( 30 %)     Multiplier(Alpha{3})
            75.8 %     ( 55 %)     Slider(Pinvar{all})
            12.6 %     ( 14 %)     ExtSPR(Tau{all},V{all})
             6.1 %     (  6 %)     ExtTBR(Tau{all},V{all})
            25.0 %     ( 27 %)     NNI(Tau{all},V{all})
            20.6 %     ( 20 %)     ParsSPR(Tau{all},V{all})
            26.8 %     ( 26 %)     Multiplier(V{all})
            43.1 %     ( 47 %)     Nodeslider(V{all})
            25.8 %     ( 32 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.80    0.63    0.48 
         2 |  166723            0.82    0.65 
         3 |  166860  166174            0.83 
         4 |  167509  166346  166388         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.80    0.63    0.49 
         2 |  166787            0.82    0.65 
         3 |  166675  166458            0.83 
         4 |  166999  166793  166288         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -1675.40
      |                      1                     1               |
      |                                                            |
      |    1                  1         2       2                  |
      |        2           2                             2         |
      |2      2                            2           1    11  21 |
      |   * 1 1  2    1  1   22    2        1 2  2 2 1       21    |
      | 2  2   1 1 1        1  1    1    1      1   1            2 |
      |  1      1    12        222      1 2  1      2 2   21   1   |
      |           *     22*1    1        21 22    2  2     2  2    |
      |      1      1   1         1  122       1      1     2     2|
      |  2   2  2  2   *    2      122     1  1        2*       1  |
      |             22            2   11          1      11       1|
      |1                                         1                 |
      | 1   2                                                  2   |
      |                          1             2                   |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1678.98
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -1673.25         -1688.15
        2      -1673.33         -1686.30
      --------------------------------------
      TOTAL    -1673.29         -1687.60
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.191774    0.000788    0.137623    0.244201    0.189300   1335.03   1340.05    1.000
      r(A<->C){all}   0.163841    0.001953    0.083028    0.255560    0.161236    907.24    979.98    1.000
      r(A<->G){all}   0.219379    0.002449    0.129117    0.320130    0.214876    671.31    762.40    1.000
      r(A<->T){all}   0.141953    0.001348    0.075400    0.217419    0.138754    927.65    956.63    1.000
      r(C<->G){all}   0.080053    0.001141    0.021072    0.147203    0.075570    651.97    756.57    1.000
      r(C<->T){all}   0.319654    0.003262    0.210049    0.430387    0.316561    629.73    709.99    1.000
      r(G<->T){all}   0.075119    0.000797    0.025072    0.130261    0.072479    872.18    951.80    1.000
      pi(A){all}      0.303955    0.000242    0.273407    0.333209    0.303565    881.97   1163.91    1.000
      pi(C){all}      0.185692    0.000164    0.162076    0.212787    0.185225   1099.70   1300.35    1.000
      pi(G){all}      0.230487    0.000204    0.204576    0.261189    0.230336   1209.01   1234.92    1.000
      pi(T){all}      0.279866    0.000223    0.250750    0.309714    0.279732   1200.29   1280.31    1.000
      alpha{1,2}      0.079961    0.004467    0.000179    0.201425    0.065103   1194.08   1330.99    1.000
      alpha{3}        1.689791    0.567472    0.485843    3.161860    1.565703   1391.50   1427.30    1.000
      pinvar{all}     0.315369    0.018679    0.039240    0.543808    0.323720   1099.62   1165.28    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7

   Key to taxon bipartitions (saved to file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   -------------
    1 -- .******
    2 -- .*.....
    3 -- ..*....
    4 -- ...*...
    5 -- ....*..
    6 -- .....*.
    7 -- ......*
    8 -- .****..
    9 -- .....**
   10 -- .***...
   11 -- .**....
   12 -- ..**...
   13 -- .*.*...
   -------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    8  3002    1.000000    0.000000    1.000000    1.000000    2
    9  3002    1.000000    0.000000    1.000000    1.000000    2
   10  2984    0.994004    0.000942    0.993338    0.994670    2
   11  1011    0.336775    0.005182    0.333111    0.340440    2
   12  1003    0.334111    0.025910    0.315789    0.352432    2
   13   980    0.326449    0.030150    0.305130    0.347768    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.021691    0.000052    0.008880    0.036202    0.020916    1.001    2
   length{all}[2]     0.001471    0.000002    0.000000    0.004519    0.000995    1.000    2
   length{all}[3]     0.002962    0.000005    0.000006    0.007143    0.002500    1.000    2
   length{all}[4]     0.002987    0.000005    0.000012    0.007166    0.002503    1.000    2
   length{all}[5]     0.004194    0.000007    0.000019    0.009379    0.003689    1.000    2
   length{all}[6]     0.054808    0.000173    0.030621    0.079571    0.053567    1.000    2
   length{all}[7]     0.032180    0.000095    0.014853    0.050942    0.030858    1.001    2
   length{all}[8]     0.023932    0.000061    0.010049    0.039818    0.023254    1.000    2
   length{all}[9]     0.041283    0.000127    0.019885    0.062239    0.040045    1.000    2
   length{all}[10]    0.004796    0.000009    0.000385    0.010682    0.004241    1.000    2
   length{all}[11]    0.001481    0.000002    0.000000    0.004287    0.001022    0.999    2
   length{all}[12]    0.001470    0.000002    0.000004    0.004261    0.001029    0.999    2
   length{all}[13]    0.001518    0.000003    0.000002    0.004470    0.001022    0.999    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.010364
       Maximum standard deviation of split frequencies = 0.030150
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.001


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |                                               /------------------------ C6 (6)
   |----------------------100----------------------+                               
   |                                               \------------------------ C7 (7)
   +                                                                               
   |                                               /------------------------ C2 (2)
   |                                               |                               
   |                       /-----------99----------+------------------------ C3 (3)
   |                       |                       |                               
   \----------100----------+                       \------------------------ C4 (4)
                           |                                                       
                           \------------------------------------------------ C5 (5)
                                                                                   

   Phylogram (based on average branch lengths):

   /---------------- C1 (1)
   |                                                                               
   |                              /----------------------------------------- C6 (6)
   |------------------------------+                                                
   |                              \------------------------ C7 (7)
   +                                                                               
   |                    /- C2 (2)
   |                    |                                                          
   |                 /--+-- C3 (3)
   |                 |  |                                                          
   \-----------------+  \-- C4 (4)
                     |                                                             
                     \--- C5 (5)
                                                                                   
   |--------------| 0.020 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (14 trees sampled):
      50 % credible set contains 2 trees
      90 % credible set contains 3 trees
      95 % credible set contains 3 trees
      99 % credible set contains 3 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 7  	ls = 804
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Sequences read..
Counting site patterns..  0:00

         129 patterns at      268 /      268 sites (100.0%),  0:00
Counting codons..


      168 bytes for distance
   125904 bytes for conP
    17544 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, (6, 7), ((2, 3, 4), 5));   MP score: 91
   251808 bytes for conP, adjusted

    0.049548    0.084008    0.107280    0.079722    0.047513    0.008124    0.000000    0.003851    0.003910    0.007029    0.300000    1.300000

ntime & nrate & np:    10     2    12

Bounds (np=12):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    12
lnL0 = -1714.440139

Iterating by ming2
Initial: fx=  1714.440139
x=  0.04955  0.08401  0.10728  0.07972  0.04751  0.00812  0.00000  0.00385  0.00391  0.00703  0.30000  1.30000

  1 h-m-p  0.0000 0.0000 296.7319 ++     1714.439873  m 0.0000    17 | 1/12
  2 h-m-p  0.0000 0.0001 1229.9121 +CCYCC  1708.258973  4 0.0001    41 | 1/12
  3 h-m-p  0.0000 0.0001 2156.0596 CYCCC  1706.459684  4 0.0000    63 | 1/12
  4 h-m-p  0.0000 0.0001 407.4853 +YYYYYCCCCC  1703.000461  9 0.0001    92 | 1/12
  5 h-m-p  0.0000 0.0001 1033.1696 +YYYCCC  1698.468081  5 0.0001   115 | 1/12
  6 h-m-p  0.0002 0.0008 258.8824 CYCC   1696.912221  3 0.0002   135 | 1/12
  7 h-m-p  0.0006 0.0048  80.5676 CC     1695.108506  1 0.0009   152 | 1/12
  8 h-m-p  0.0003 0.0033 249.3654 +CYCYCCC  1680.962067  6 0.0019   178 | 1/12
  9 h-m-p  0.0000 0.0001 4719.8264 +YYYYCCC  1659.855287  6 0.0001   202 | 1/12
 10 h-m-p  0.0000 0.0001 872.8241 YYCC   1659.331016  3 0.0000   221 | 1/12
 11 h-m-p  0.0035 0.0558   6.4196 CCC    1659.292886  2 0.0007   240 | 1/12
 12 h-m-p  0.0049 0.1515   0.9402 ++YYCCC  1652.984809  4 0.0619   263 | 1/12
 13 h-m-p  0.1176 0.5881   0.3751 +YYCCC  1630.494385  4 0.4279   296 | 1/12
 14 h-m-p  0.1505 0.7524   0.1067 +YYCCC  1628.704416  4 0.4782   329 | 1/12
 15 h-m-p  0.4698 2.7905   0.1086 +YYYC  1623.526528  3 1.7581   359 | 1/12
 16 h-m-p  0.4836 2.4180   0.1012 YCCC   1621.878252  3 0.9931   390 | 1/12
 17 h-m-p  0.8518 4.2588   0.0966 CCC    1620.865317  2 0.8460   420 | 1/12
 18 h-m-p  0.4656 2.3279   0.0545 YCCCC  1620.364425  4 0.9961   453 | 1/12
 19 h-m-p  0.8465 4.2843   0.0641 CCCC   1620.034522  3 1.0827   485 | 1/12
 20 h-m-p  1.6000 8.0000   0.0411 CCC    1619.877533  2 1.3586   515 | 1/12
 21 h-m-p  1.6000 8.0000   0.0216 CC     1619.801171  1 1.8820   543 | 1/12
 22 h-m-p  1.6000 8.0000   0.0140 CCC    1619.734456  2 2.4183   573 | 1/12
 23 h-m-p  1.6000 8.0000   0.0066 YC     1619.650709  1 3.2832   600 | 1/12
 24 h-m-p  1.5849 8.0000   0.0137 CCC    1619.613988  2 2.3072   630 | 1/12
 25 h-m-p  1.6000 8.0000   0.0187 CCC    1619.594052  2 1.4345   660 | 1/12
 26 h-m-p  1.6000 8.0000   0.0097 YC     1619.591094  1 1.1600   687 | 1/12
 27 h-m-p  1.6000 8.0000   0.0006 Y      1619.591070  0 1.1206   713 | 1/12
 28 h-m-p  1.6000 8.0000   0.0001 C      1619.591069  0 1.5781   739 | 1/12
 29 h-m-p  1.6000 8.0000   0.0000 C      1619.591069  0 1.8135   765 | 1/12
 30 h-m-p  1.6000 8.0000   0.0000 Y      1619.591069  0 2.9066   791 | 1/12
 31 h-m-p  1.6000 8.0000   0.0000 C      1619.591069  0 1.4049   817 | 1/12
 32 h-m-p  1.6000 8.0000   0.0000 -C     1619.591069  0 0.1468   844 | 1/12
 33 h-m-p  0.1330 8.0000   0.0000 -------Y  1619.591069  0 0.0000   877
Out..
lnL  = -1619.591069
878 lfun, 878 eigenQcodon, 8780 P(t)

Time used:  0:03


Model 1: NearlyNeutral

TREE #  1
(1, (6, 7), ((2, 3, 4), 5));   MP score: 91
    0.049627    0.084060    0.107247    0.079749    0.047419    0.008062    0.000000    0.003802    0.003831    0.007035    1.510113    0.877411    0.315445

ntime & nrate & np:    10     2    13

Bounds (np=13):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 9.974221

np =    13
lnL0 = -1630.424267

Iterating by ming2
Initial: fx=  1630.424267
x=  0.04963  0.08406  0.10725  0.07975  0.04742  0.00806  0.00000  0.00380  0.00383  0.00703  1.51011  0.87741  0.31544

  1 h-m-p  0.0000 0.0000 272.8647 ++     1630.424034  m 0.0000    18 | 1/13
  2 h-m-p  0.0000 0.0001 713.0303 +CYYYYC  1627.888327  5 0.0001    41 | 1/13
  3 h-m-p  0.0000 0.0000 6366.5829 +YCYCCC  1625.253602  5 0.0000    66 | 1/13
  4 h-m-p  0.0000 0.0000 6142.8383 CCC    1624.728115  2 0.0000    86 | 1/13
  5 h-m-p  0.0000 0.0002 732.8534 +CYCCC  1621.128270  4 0.0001   111 | 1/13
  6 h-m-p  0.0000 0.0002 621.1065 YCYCCC  1619.132020  5 0.0001   135 | 1/13
  7 h-m-p  0.0003 0.0014  80.5834 CCCCC  1618.371009  4 0.0004   159 | 1/13
  8 h-m-p  0.0009 0.0044  28.1319 CYC    1618.287799  2 0.0003   178 | 1/13
  9 h-m-p  0.0022 0.0389   3.3513 YC     1618.271767  1 0.0013   195 | 1/13
 10 h-m-p  0.0004 0.0215  10.9892 CC     1618.246199  1 0.0006   213 | 1/13
 11 h-m-p  0.0006 0.0674  11.3609 ++CCCC  1617.579143  3 0.0127   237 | 1/13
 12 h-m-p  0.0009 0.0045 169.6184 YCCCC  1615.884445  4 0.0022   260 | 1/13
 13 h-m-p  0.1166 0.5829   1.6405 YCYCCC  1613.689666  5 0.3110   284 | 1/13
 14 h-m-p  0.3443 1.7216   0.8896 YCCC   1612.920474  3 0.1802   305 | 1/13
 15 h-m-p  0.8086 8.0000   0.1983 CYCC   1612.495748  3 1.0724   338 | 1/13
 16 h-m-p  1.6000 8.0000   0.0931 YC     1612.378437  1 0.8695   367 | 1/13
 17 h-m-p  1.6000 8.0000   0.0124 YC     1612.351097  1 0.9873   396 | 1/13
 18 h-m-p  1.6000 8.0000   0.0033 CC     1612.346057  1 1.7724   426 | 1/13
 19 h-m-p  0.7750 8.0000   0.0075 CC     1612.343777  1 1.0723   456 | 1/13
 20 h-m-p  1.6000 8.0000   0.0037 C      1612.343362  0 1.5456   484 | 1/13
 21 h-m-p  1.6000 8.0000   0.0006 Y      1612.343258  0 2.5894   512 | 1/13
 22 h-m-p  1.6000 8.0000   0.0002 C      1612.343211  0 2.3575   540 | 1/13
 23 h-m-p  1.6000 8.0000   0.0001 C      1612.343192  0 1.9498   568 | 1/13
 24 h-m-p  0.8795 8.0000   0.0002 C      1612.343190  0 1.1355   596 | 1/13
 25 h-m-p  1.6000 8.0000   0.0000 C      1612.343190  0 2.0992   624 | 1/13
 26 h-m-p  1.6000 8.0000   0.0000 C      1612.343190  0 1.9784   652 | 1/13
 27 h-m-p  1.6000 8.0000   0.0000 C      1612.343190  0 0.4778   680 | 1/13
 28 h-m-p  0.7384 8.0000   0.0000 ---Y   1612.343190  0 0.0029   711
Out..
lnL  = -1612.343190
712 lfun, 2136 eigenQcodon, 14240 P(t)

Time used:  0:08


Model 2: PositiveSelection

TREE #  1
(1, (6, 7), ((2, 3, 4), 5));   MP score: 91
initial w for M2:NSpselection reset.

    0.049586    0.084064    0.107250    0.079811    0.047444    0.008020    0.000000    0.003783    0.003789    0.007009    1.494368    1.591876    0.136540    0.318247    2.382499

ntime & nrate & np:    10     3    15

Bounds (np=15):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 6.826840

np =    15
lnL0 = -1643.363853

Iterating by ming2
Initial: fx=  1643.363853
x=  0.04959  0.08406  0.10725  0.07981  0.04744  0.00802  0.00000  0.00378  0.00379  0.00701  1.49437  1.59188  0.13654  0.31825  2.38250

  1 h-m-p  0.0000 0.0000 259.5771 ++     1643.363626  m 0.0000    20 | 1/15
  2 h-m-p  0.0000 0.0001 224.8315 +CYCCC  1642.683343  4 0.0001    46 | 1/15
  3 h-m-p  0.0000 0.0001 622.0992 YCYCCC  1641.354448  5 0.0001    72 | 1/15
  4 h-m-p  0.0000 0.0002 175.3830 CYCCC  1640.960127  4 0.0001    97 | 1/15
  5 h-m-p  0.0000 0.0001 638.6593 YCYCCC  1640.283183  5 0.0000   123 | 1/15
  6 h-m-p  0.0000 0.0001 2143.9995 ++     1630.640069  m 0.0001   141 | 2/15
  7 h-m-p  0.0009 0.0043  44.8917 YCC    1630.506964  2 0.0004   162 | 2/15
  8 h-m-p  0.0002 0.0200  87.3670 +YCCC  1629.649700  3 0.0013   186 | 2/15
  9 h-m-p  0.0010 0.0050 105.4010 CCCCC  1628.441659  4 0.0015   212 | 2/15
 10 h-m-p  0.0023 0.0234  68.6182 CCC    1627.498357  2 0.0020   234 | 1/15
 11 h-m-p  0.0007 0.0075 211.5165 YCCCC  1626.637192  4 0.0004   259 | 1/15
 12 h-m-p  0.0092 0.0880  10.0948 +YYYYC  1621.443712  4 0.0353   282 | 1/15
 13 h-m-p  0.3055 1.6325   1.1675 CCCCC  1615.836196  4 0.5023   308 | 1/15
 14 h-m-p  0.1590 0.7952   2.6303 CYCCCC  1613.773577  5 0.2304   335 | 1/15
 15 h-m-p  0.3650 8.0000   1.6604 CCCC   1612.025153  3 0.3444   359 | 1/15
 16 h-m-p  0.7238 7.3249   0.7900 CCC    1611.124560  2 0.9472   381 | 1/15
 17 h-m-p  0.6984 3.4920   0.3262 YYYC   1610.521134  3 0.6493   416 | 1/15
 18 h-m-p  0.5695 8.0000   0.3719 +YCC   1609.956676  2 1.4984   452 | 1/15
 19 h-m-p  0.8276 8.0000   0.6733 CCC    1609.628714  2 1.0900   488 | 1/15
 20 h-m-p  1.6000 8.0000   0.2249 YCC    1609.395323  2 2.7590   523 | 1/15
 21 h-m-p  1.6000 8.0000   0.2996 CYC    1609.328348  2 1.8319   558 | 1/15
 22 h-m-p  1.6000 8.0000   0.1303 CC     1609.313662  1 1.7448   592 | 1/15
 23 h-m-p  1.6000 8.0000   0.1411 CC     1609.304505  1 1.8425   626 | 1/15
 24 h-m-p  1.6000 8.0000   0.0888 CC     1609.298860  1 2.0113   660 | 1/15
 25 h-m-p  1.6000 8.0000   0.0557 YC     1609.290860  1 2.9264   693 | 1/15
 26 h-m-p  1.0000 8.0000   0.1631 +YC    1609.265420  1 4.9811   727 | 1/15
 27 h-m-p  1.6000 8.0000   0.1898 YC     1609.247706  1 2.5990   760 | 1/15
 28 h-m-p  1.3225 8.0000   0.3731 YC     1609.237229  1 2.6691   793 | 1/15
 29 h-m-p  1.6000 8.0000   0.2930 CC     1609.233316  1 1.9927   827 | 1/15
 30 h-m-p  1.6000 8.0000   0.2943 YC     1609.231614  1 3.1149   860 | 1/15
 31 h-m-p  1.6000 8.0000   0.2556 YC     1609.230568  1 2.7325   893 | 1/15
 32 h-m-p  1.6000 8.0000   0.3251 CC     1609.230161  1 2.1353   927 | 1/15
 33 h-m-p  1.6000 8.0000   0.2482 YC     1609.229956  1 3.3318   960 | 1/15
 34 h-m-p  1.6000 8.0000   0.3350 C      1609.229842  0 2.2022   992 | 1/15
 35 h-m-p  1.6000 8.0000   0.2604 Y      1609.229809  0 2.6972  1024 | 1/15
 36 h-m-p  1.6000 8.0000   0.3080 Y      1609.229783  0 2.9326  1056 | 1/15
 37 h-m-p  1.6000 8.0000   0.3256 C      1609.229775  0 2.1412  1088 | 1/15
 38 h-m-p  1.6000 8.0000   0.3115 Y      1609.229770  0 3.0162  1120 | 1/15
 39 h-m-p  1.6000 8.0000   0.3463 C      1609.229768  0 2.1180  1152 | 1/15
 40 h-m-p  1.6000 8.0000   0.2952 Y      1609.229768  0 2.8643  1184 | 1/15
 41 h-m-p  1.6000 8.0000   0.3240 Y      1609.229767  0 2.9871  1216 | 1/15
 42 h-m-p  1.6000 8.0000   0.3285 C      1609.229767  0 2.0640  1248 | 1/15
 43 h-m-p  1.6000 8.0000   0.3031 Y      1609.229767  0 3.3469  1280 | 1/15
 44 h-m-p  1.6000 8.0000   0.3007 C      1609.229767  0 1.9649  1312 | 1/15
 45 h-m-p  1.6000 8.0000   0.3633 Y      1609.229767  0 3.4172  1344 | 1/15
 46 h-m-p  1.6000 8.0000   0.3007 +Y     1609.229767  0 4.0578  1377 | 1/15
 47 h-m-p  1.6000 8.0000   0.0010 C      1609.229767  0 0.6212  1409 | 1/15
 48 h-m-p  0.0160 8.0000   0.1020 Y      1609.229767  0 0.0160  1441 | 1/15
 49 h-m-p  0.0160 8.0000   4.4247 ------C  1609.229767  0 0.0000  1479 | 1/15
 50 h-m-p  0.0160 8.0000   0.0784 --C    1609.229767  0 0.0004  1499 | 1/15
 51 h-m-p  0.0160 8.0000   0.0026 -------------..  | 1/15
 52 h-m-p  0.0160 8.0000   0.0039 ------------Y  1609.229767  0 0.0000  1586 | 1/15
 53 h-m-p  0.0054 2.7012   0.0980 ------------..  | 1/15
 54 h-m-p  0.0160 8.0000   0.0039 ----------C  1609.229767  0 0.0000  1670 | 1/15
 55 h-m-p  0.0160 8.0000   0.0015 -------------..  | 1/15
 56 h-m-p  0.0160 8.0000   0.0039 ------------- | 1/15
 57 h-m-p  0.0160 8.0000   0.0039 -------------
Out..
lnL  = -1609.229767
1800 lfun, 7200 eigenQcodon, 54000 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1619.075286  S = -1538.448974   -73.055856
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 129 patterns   0:27
	did  20 / 129 patterns   0:27
	did  30 / 129 patterns   0:27
	did  40 / 129 patterns   0:27
	did  50 / 129 patterns   0:27
	did  60 / 129 patterns   0:27
	did  70 / 129 patterns   0:27
	did  80 / 129 patterns   0:27
	did  90 / 129 patterns   0:27
	did 100 / 129 patterns   0:27
	did 110 / 129 patterns   0:27
	did 120 / 129 patterns   0:27
	did 129 / 129 patterns   0:27
Time used:  0:27


Model 3: discrete

TREE #  1
(1, (6, 7), ((2, 3, 4), 5));   MP score: 91
    0.049696    0.084116    0.107312    0.079641    0.047369    0.008070    0.000000    0.003901    0.003860    0.007189    1.541542    0.465673    0.549129    0.067804    0.150911    0.281925

ntime & nrate & np:    10     4    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 15.459136

np =    16
lnL0 = -1618.378341

Iterating by ming2
Initial: fx=  1618.378341
x=  0.04970  0.08412  0.10731  0.07964  0.04737  0.00807  0.00000  0.00390  0.00386  0.00719  1.54154  0.46567  0.54913  0.06780  0.15091  0.28193

  1 h-m-p  0.0000 0.0000 151.6394 ++     1618.378116  m 0.0000    37 | 1/16
  2 h-m-p  0.0000 0.0003 188.1242 +YCCC  1617.945005  3 0.0001    78 | 1/16
  3 h-m-p  0.0000 0.0002 102.9655 YC     1617.877767  1 0.0000   113 | 1/16
  4 h-m-p  0.0000 0.0003  96.5268 CCC    1617.781578  2 0.0001   151 | 1/16
  5 h-m-p  0.0000 0.0005 147.6134 +YCC   1617.514449  2 0.0001   189 | 1/16
  6 h-m-p  0.0000 0.0001 393.9532 CCCC   1617.220967  3 0.0001   229 | 1/16
  7 h-m-p  0.0001 0.0003 121.8885 ++     1616.578986  m 0.0003   263 | 2/16
  8 h-m-p  0.0003 0.0023  75.0074 YCCC   1616.054899  3 0.0007   302 | 2/16
  9 h-m-p  0.0004 0.0018  96.8832 YCCC   1615.442008  3 0.0007   340 | 2/16
 10 h-m-p  0.0005 0.0024  85.4320 +YCCC  1614.506107  3 0.0016   379 | 2/16
 11 h-m-p  0.0009 0.0045  28.8570 YCCC   1614.419161  3 0.0005   417 | 2/16
 12 h-m-p  0.0198 4.5469   0.7314 +CYC   1614.364020  2 0.0620   454 | 1/16
 13 h-m-p  0.0016 0.0082   9.9201 +CCC   1614.288320  2 0.0055   492 | 1/16
 14 h-m-p  0.0197 0.2159   2.7725 ++     1613.885814  m 0.2159   526 | 2/16
 15 h-m-p  1.6000 8.0000   0.1752 YCC    1613.671595  2 0.9984   563 | 1/16
 16 h-m-p  0.0013 0.0265 129.8483 -CC    1613.670715  1 0.0001   599 | 1/16
 17 h-m-p  0.0160 8.0000   0.8160 ++YCC  1613.597030  2 0.1852   638 | 1/16
 18 h-m-p  0.2151 8.0000   0.7026 +CCC   1613.361727  2 1.0869   677 | 1/16
 19 h-m-p  1.3752 8.0000   0.5554 YCCC   1612.648943  3 2.9848   716 | 1/16
 20 h-m-p  0.5731 2.8656   0.7009 CCC    1612.546795  2 0.2163   754 | 1/16
 21 h-m-p  0.2647 4.8144   0.5729 +YYCCCC  1611.829830  5 1.1035   797 | 1/16
 22 h-m-p  1.0785 5.3923   0.2866 CYCCCC  1611.234936  5 1.7220   840 | 1/16
 23 h-m-p  0.2557 8.0000   1.9300 CYC    1611.005563  2 0.2970   877 | 1/16
 24 h-m-p  0.9517 4.7583   0.1902 CCCC   1610.663882  3 1.5735   917 | 1/16
 25 h-m-p  1.1664 8.0000   0.2566 YCCC   1610.227649  3 1.9975   956 | 1/16
 26 h-m-p  0.8175 8.0000   0.6270 YC     1609.749502  1 1.8249   991 | 1/16
 27 h-m-p  1.2406 6.2031   0.4697 CCCC   1609.394563  3 1.3146  1031 | 1/16
 28 h-m-p  1.3220 8.0000   0.4670 YCC    1609.311003  2 0.7679  1068 | 1/16
 29 h-m-p  1.0845 7.2113   0.3307 YYC    1609.273231  2 0.9176  1104 | 1/16
 30 h-m-p  1.6000 8.0000   0.1160 YC     1609.262379  1 1.0534  1139 | 1/16
 31 h-m-p  1.6000 8.0000   0.0198 C      1609.261395  0 1.5616  1173 | 1/16
 32 h-m-p  1.6000 8.0000   0.0029 ++     1609.259859  m 8.0000  1207 | 1/16
 33 h-m-p  0.7563 8.0000   0.0309 ++     1609.252047  m 8.0000  1241 | 1/16
 34 h-m-p  1.6000 8.0000   0.0292 YC     1609.237890  1 3.0505  1276 | 1/16
 35 h-m-p  0.9166 8.0000   0.0973 CCC    1609.232641  2 1.3410  1314 | 1/16
 36 h-m-p  1.6000 8.0000   0.0478 CC     1609.230414  1 1.5700  1350 | 1/16
 37 h-m-p  1.6000 8.0000   0.0262 C      1609.229928  0 1.6000  1384 | 1/16
 38 h-m-p  1.6000 8.0000   0.0076 YC     1609.229784  1 1.1901  1419 | 1/16
 39 h-m-p  1.5815 8.0000   0.0057 Y      1609.229767  0 1.1826  1453 | 1/16
 40 h-m-p  1.6000 8.0000   0.0008 Y      1609.229767  0 1.1037  1487 | 1/16
 41 h-m-p  1.6000 8.0000   0.0001 Y      1609.229767  0 0.9235  1521 | 1/16
 42 h-m-p  0.9371 8.0000   0.0001 C      1609.229767  0 1.0591  1555 | 1/16
 43 h-m-p  1.6000 8.0000   0.0000 Y      1609.229767  0 3.8737  1589 | 1/16
 44 h-m-p  1.3961 8.0000   0.0001 --Y    1609.229767  0 0.0218  1625 | 1/16
 45 h-m-p  0.0206 8.0000   0.0001 Y      1609.229767  0 0.0206  1659 | 1/16
 46 h-m-p  0.0221 8.0000   0.0001 --------C  1609.229767  0 0.0000  1701
Out..
lnL  = -1609.229767
1702 lfun, 6808 eigenQcodon, 51060 P(t)

Time used:  0:45


Model 7: beta

TREE #  1
(1, (6, 7), ((2, 3, 4), 5));   MP score: 91
    0.049894    0.084170    0.107295    0.079595    0.047335    0.008236    0.000000    0.003844    0.003817    0.007355    1.541544    0.702842    1.818396

ntime & nrate & np:    10     1    13

Bounds (np=13):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 12.019217

np =    13
lnL0 = -1621.540511

Iterating by ming2
Initial: fx=  1621.540511
x=  0.04989  0.08417  0.10730  0.07959  0.04733  0.00824  0.00000  0.00384  0.00382  0.00736  1.54154  0.70284  1.81840

  1 h-m-p  0.0000 0.0000 148.8694 ++     1621.540289  m 0.0000    31 | 1/13
  2 h-m-p  0.0000 0.0001 198.8735 +YYYCCCC  1621.315467  6 0.0000    70 | 1/13
  3 h-m-p  0.0000 0.0001 250.7213 CCCC   1621.148486  3 0.0000   104 | 1/13
  4 h-m-p  0.0001 0.0003  61.4012 YC     1621.120438  1 0.0000   133 | 1/13
  5 h-m-p  0.0000 0.0005 104.6630 +CYC   1621.014772  2 0.0001   165 | 1/13
  6 h-m-p  0.0001 0.0007 132.9333 +YCCC  1620.741429  3 0.0002   199 | 1/13
  7 h-m-p  0.0003 0.0084  84.7041 ++YYCCC  1617.355014  4 0.0034   235 | 1/13
  8 h-m-p  0.0002 0.0009 440.3413 CYCCCC  1615.862858  5 0.0003   272 | 1/13
  9 h-m-p  0.0016 0.0080  20.2787 CCC    1615.799931  2 0.0005   304 | 1/13
 10 h-m-p  0.0044 1.1926   2.1927 +++YCC  1614.926977  2 0.2034   338 | 1/13
 11 h-m-p  0.0019 0.0095  44.7086 CYC    1614.890420  2 0.0004   369 | 1/13
 12 h-m-p  0.0205 1.7790   0.9043 +YCCC  1614.771787  3 0.1668   403 | 1/13
 13 h-m-p  0.3906 4.5628   0.3862 YCCC   1614.464108  3 0.9629   436 | 1/13
 14 h-m-p  0.9621 5.3346   0.3866 +YYYCCC  1613.698921  5 3.5392   472 | 1/13
 15 h-m-p  0.0399 0.1997   3.4614 YCYCCCC  1613.584808  6 0.0581   510 | 1/13
 16 h-m-p  0.7895 7.3358   0.2549 CYC    1613.365263  2 0.9299   541 | 1/13
 17 h-m-p  0.3859 1.9295   0.3783 CCCC   1613.256495  3 0.4489   575 | 1/13
 18 h-m-p  1.6000 8.0000   0.0152 YC     1613.243937  1 0.8791   604 | 1/13
 19 h-m-p  0.9046 8.0000   0.0148 CC     1613.242566  1 0.7784   634 | 1/13
 20 h-m-p  1.6000 8.0000   0.0068 YC     1613.242372  1 0.9563   663 | 1/13
 21 h-m-p  1.6000 8.0000   0.0015 Y      1613.242352  0 0.9090   691 | 1/13
 22 h-m-p  1.6000 8.0000   0.0002 Y      1613.242351  0 0.8665   719 | 1/13
 23 h-m-p  1.6000 8.0000   0.0001 Y      1613.242351  0 0.9548   747 | 1/13
 24 h-m-p  1.6000 8.0000   0.0000 C      1613.242351  0 1.8487   775 | 1/13
 25 h-m-p  1.6000 8.0000   0.0000 C      1613.242351  0 0.3617   803 | 1/13
 26 h-m-p  0.5477 8.0000   0.0000 ---------------C  1613.242351  0 0.0000   846
Out..
lnL  = -1613.242351
847 lfun, 9317 eigenQcodon, 84700 P(t)

Time used:  1:13


Model 8: beta&w>1

TREE #  1
(1, (6, 7), ((2, 3, 4), 5));   MP score: 91
initial w for M8:NSbetaw>1 reset.

    0.049633    0.084080    0.107252    0.079770    0.047432    0.008053    0.000000    0.003840    0.003820    0.007031    1.511833    0.900000    1.017304    1.339697    2.499728

ntime & nrate & np:    10     2    15

Bounds (np=15):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 7.403730

np =    15
lnL0 = -1638.715371

Iterating by ming2
Initial: fx=  1638.715371
x=  0.04963  0.08408  0.10725  0.07977  0.04743  0.00805  0.00000  0.00384  0.00382  0.00703  1.51183  0.90000  1.01730  1.33970  2.49973

  1 h-m-p  0.0000 0.0000 184.3329 ++     1638.715073  m 0.0000    35 | 1/15
  2 h-m-p  0.0000 0.0001 513.8962 +YCYCCC  1636.809419  5 0.0001    78 | 1/15
  3 h-m-p  0.0000 0.0000 1758.2402 +YCYCCC  1634.068307  5 0.0000   119 | 1/15
  4 h-m-p  0.0000 0.0000 1076.6930 CCC    1633.795974  2 0.0000   155 | 1/15
  5 h-m-p  0.0000 0.0001 299.0529 YCYCCC  1633.172193  5 0.0000   195 | 1/15
  6 h-m-p  0.0000 0.0001 480.4861 +CCCC  1632.103442  3 0.0000   234 | 1/15
  7 h-m-p  0.0009 0.0088  24.7631 YCCC   1631.457993  3 0.0021   271 | 1/15
  8 h-m-p  0.0003 0.0067 175.0586 ++YYYYYCC  1617.663124  6 0.0047   312 | 1/15
  9 h-m-p  0.0001 0.0005 679.2103 CCCCC  1616.589850  4 0.0001   352 | 1/15
 10 h-m-p  0.0019 0.0094  11.2796 YCC    1616.538794  2 0.0008   387 | 1/15
 11 h-m-p  0.0003 0.0437  32.3539 ++YCCC  1614.907627  3 0.0106   426 | 1/15
 12 h-m-p  0.0014 0.0069 123.7926 CYC    1614.261547  2 0.0012   461 | 1/15
 13 h-m-p  0.0938 1.3491   1.5451 +YYYC  1612.561206  3 0.3431   497 | 1/15
 14 h-m-p  0.3103 1.5515   1.2462 YCC    1611.594017  2 0.2336   532 | 1/15
 15 h-m-p  0.4474 4.4963   0.6506 YCCC   1610.812847  3 0.9577   569 | 1/15
 16 h-m-p  0.7417 8.0000   0.8400 CYC    1610.616102  2 0.6459   604 | 1/15
 17 h-m-p  0.9362 4.6810   0.4671 CYCCC  1610.195366  4 1.8608   643 | 1/15
 18 h-m-p  1.6000 8.0000   0.4948 CCC    1609.944268  2 2.1177   679 | 1/15
 19 h-m-p  1.6000 8.0000   0.3277 CCC    1609.857159  2 1.4717   715 | 1/15
 20 h-m-p  1.6000 8.0000   0.2867 CYC    1609.830310  2 1.4715   750 | 1/15
 21 h-m-p  1.6000 8.0000   0.1906 CC     1609.821829  1 0.4640   784 | 1/15
 22 h-m-p  0.8956 8.0000   0.0988 +YC    1609.809019  1 2.7708   818 | 1/15
 23 h-m-p  1.6000 8.0000   0.0684 ++     1609.755691  m 8.0000   850 | 1/15
 24 h-m-p  0.7510 8.0000   0.7285 +YCC   1609.671906  2 2.4991   886 | 1/15
 25 h-m-p  1.6000 8.0000   0.6343 YCCC   1609.555644  3 3.3296   923 | 1/15
 26 h-m-p  1.6000 8.0000   1.1141 CCC    1609.477116  2 2.2979   959 | 1/15
 27 h-m-p  1.6000 8.0000   1.3819 YC     1609.401113  1 3.9465   992 | 1/15
 28 h-m-p  1.6000 8.0000   1.9169 YC     1609.353086  1 3.0260  1025 | 1/15
 29 h-m-p  1.6000 8.0000   2.8533 YCC    1609.325563  2 2.5538  1060 | 1/15
 30 h-m-p  1.6000 8.0000   3.2763 YC     1609.309912  1 2.6506  1093 | 1/15
 31 h-m-p  1.6000 8.0000   3.9527 +YC    1609.289897  1 4.4087  1127 | 1/15
 32 h-m-p  1.1192 5.5960   8.0731 YC     1609.273236  1 2.6463  1160 | 1/15
 33 h-m-p  0.5498 2.7492   8.6620 ++     1609.264814  m 2.7492  1192 | 2/15
 34 h-m-p  0.6066 8.0000   4.3676 ----------------..  | 2/15
 35 h-m-p  0.0000 0.0008  10.7469 YC     1609.263688  1 0.0000  1270 | 2/15
 36 h-m-p  0.0001 0.0039   3.0305 YC     1609.263532  1 0.0000  1302 | 2/15
 37 h-m-p  0.0034 1.7232   0.9136 --C    1609.263501  0 0.0001  1335 | 2/15
 38 h-m-p  0.0000 0.0099   1.7068 C      1609.263475  0 0.0000  1366 | 2/15
 39 h-m-p  0.0001 0.0660   1.7151 Y      1609.263428  0 0.0001  1397 | 2/15
 40 h-m-p  0.0008 0.2590   0.2227 -C     1609.263427  0 0.0001  1429 | 2/15
 41 h-m-p  0.0011 0.5645   0.2238 C      1609.263422  0 0.0003  1460 | 2/15
 42 h-m-p  0.0115 5.7604   0.0939 -Y     1609.263418  0 0.0013  1492 | 2/15
 43 h-m-p  0.0033 1.6688   0.1622 Y      1609.263410  0 0.0018  1523 | 2/15
 44 h-m-p  0.0053 2.6394   0.7073 C      1609.263306  0 0.0056  1554 | 2/15
 45 h-m-p  0.0022 1.1200   4.8224 C      1609.263046  0 0.0021  1585 | 2/15
 46 h-m-p  0.1023 8.0000   0.0973 ++YC   1609.255272  1 3.8837  1619 | 2/15
 47 h-m-p  1.6000 8.0000   0.0146 +C     1609.254731  0 6.1182  1651 | 2/15
 48 h-m-p  1.6000 8.0000   0.0138 Y      1609.254657  0 1.1596  1682 | 2/15
 49 h-m-p  1.6000 8.0000   0.0007 Y      1609.254657  0 1.0246  1713 | 2/15
 50 h-m-p  1.6000 8.0000   0.0000 Y      1609.254657  0 0.7955  1744 | 2/15
 51 h-m-p  1.6000 8.0000   0.0000 --C    1609.254657  0 0.0250  1777
Out..
lnL  = -1609.254657
1778 lfun, 21336 eigenQcodon, 195580 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1618.037759  S = -1538.472894   -72.900657
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 129 patterns   2:20
	did  20 / 129 patterns   2:20
	did  30 / 129 patterns   2:20
	did  40 / 129 patterns   2:20
	did  50 / 129 patterns   2:21
	did  60 / 129 patterns   2:21
	did  70 / 129 patterns   2:21
	did  80 / 129 patterns   2:21
	did  90 / 129 patterns   2:21
	did 100 / 129 patterns   2:22
	did 110 / 129 patterns   2:22
	did 120 / 129 patterns   2:22
	did 129 / 129 patterns   2:22
Time used:  2:22
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 

D_melanogaster_CG40498-PK   MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
D_sechellia_CG40498-PK      MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
D_sechellia_CG40498-PK      MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
D_sechellia_CG40498-PK      MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
D_simulans_CG40498-PK       MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
D_yakuba_CG40498-PK         MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
D_erecta_CG40498-PK         MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
                            ****.******************************************:**

D_melanogaster_CG40498-PK   KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
D_sechellia_CG40498-PK      KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
D_sechellia_CG40498-PK      KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
D_sechellia_CG40498-PK      KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
D_simulans_CG40498-PK       KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
D_yakuba_CG40498-PK         KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
D_erecta_CG40498-PK         KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
                            ******:.**.*.*************************************

D_melanogaster_CG40498-PK   MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
D_sechellia_CG40498-PK      MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
D_sechellia_CG40498-PK      MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
D_sechellia_CG40498-PK      MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
D_simulans_CG40498-PK       MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
D_yakuba_CG40498-PK         MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
D_erecta_CG40498-PK         MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
                            ***::**************************:******************

D_melanogaster_CG40498-PK   RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
D_sechellia_CG40498-PK      RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
D_sechellia_CG40498-PK      RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
D_sechellia_CG40498-PK      RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
D_simulans_CG40498-PK       RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
D_yakuba_CG40498-PK         RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
D_erecta_CG40498-PK         RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
                            ***************:*********************  **********.

D_melanogaster_CG40498-PK   SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
D_sechellia_CG40498-PK      SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
D_sechellia_CG40498-PK      SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
D_sechellia_CG40498-PK      SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
D_simulans_CG40498-PK       SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
D_yakuba_CG40498-PK         SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
D_erecta_CG40498-PK         SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
                            *:***.**.** ******:**:********.:*****.******:*****

D_melanogaster_CG40498-PK   KLLLRRESLNDAISITRI
D_sechellia_CG40498-PK      KQLLRRESLSDAISITRI
D_sechellia_CG40498-PK      KQLLRREFLSDAISITRI
D_sechellia_CG40498-PK      KQLLRRESLSDAISITRI
D_simulans_CG40498-PK       KQLLRRESLSDAISITRI
D_yakuba_CG40498-PK         KQLLRRESTNDAINITRI
D_erecta_CG40498-PK         KLLLRRESINDAINITRI
                            * *****  .***.****



>D_melanogaster_CG40498-PK
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA
GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC
TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC
TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG
AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG
TATT
>D_sechellia_CG40498-PK
ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>D_sechellia_CG40498-PK
ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG
TATT
>D_sechellia_CG40498-PK
ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>D_simulans_CG40498-PK
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>D_yakuba_CG40498-PK
ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA
AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC
ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA
AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA
AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC
TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA
CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT
TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG
AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG
TATT
>D_erecta_CG40498-PK
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA
GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA
AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC
TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA
CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA
AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT
TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA
CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT
TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG
TATT
>D_melanogaster_CG40498-PK
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>D_sechellia_CG40498-PK
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>D_sechellia_CG40498-PK
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>D_sechellia_CG40498-PK
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>D_simulans_CG40498-PK
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>D_yakuba_CG40498-PK
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>D_erecta_CG40498-PK
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI
#NEXUS

[ID: 0921445789]
begin taxa;
	dimensions ntax=7;
	taxlabels
		D_melanogaster_CG40498-PK
		D_sechellia_CG40498-PK
		D_sechellia_CG40498-PK
		D_sechellia_CG40498-PK
		D_simulans_CG40498-PK
		D_yakuba_CG40498-PK
		D_erecta_CG40498-PK
		;
end;
begin trees;
	translate
		1	D_melanogaster_CG40498-PK,
		2	D_sechellia_CG40498-PK,
		3	D_sechellia_CG40498-PK,
		4	D_sechellia_CG40498-PK,
		5	D_simulans_CG40498-PK,
		6	D_yakuba_CG40498-PK,
		7	D_erecta_CG40498-PK
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.02091603,(6:0.05356652,7:0.03085751)1.000:0.04004452,((2:9.949856E-4,3:0.002499746,4:0.002502792)0.994:0.004241214,5:0.003689019)1.000:0.02325358);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.02091603,(6:0.05356652,7:0.03085751):0.04004452,((2:9.949856E-4,3:0.002499746,4:0.002502792):0.004241214,5:0.003689019):0.02325358);
end;
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1673.25         -1688.15
2      -1673.33         -1686.30
--------------------------------------
TOTAL    -1673.29         -1687.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.191774    0.000788    0.137623    0.244201    0.189300   1335.03   1340.05    1.000
r(A<->C){all}   0.163841    0.001953    0.083028    0.255560    0.161236    907.24    979.98    1.000
r(A<->G){all}   0.219379    0.002449    0.129117    0.320130    0.214876    671.31    762.40    1.000
r(A<->T){all}   0.141953    0.001348    0.075400    0.217419    0.138754    927.65    956.63    1.000
r(C<->G){all}   0.080053    0.001141    0.021072    0.147203    0.075570    651.97    756.57    1.000
r(C<->T){all}   0.319654    0.003262    0.210049    0.430387    0.316561    629.73    709.99    1.000
r(G<->T){all}   0.075119    0.000797    0.025072    0.130261    0.072479    872.18    951.80    1.000
pi(A){all}      0.303955    0.000242    0.273407    0.333209    0.303565    881.97   1163.91    1.000
pi(C){all}      0.185692    0.000164    0.162076    0.212787    0.185225   1099.70   1300.35    1.000
pi(G){all}      0.230487    0.000204    0.204576    0.261189    0.230336   1209.01   1234.92    1.000
pi(T){all}      0.279866    0.000223    0.250750    0.309714    0.279732   1200.29   1280.31    1.000
alpha{1,2}      0.079961    0.004467    0.000179    0.201425    0.065103   1194.08   1330.99    1.000
alpha{3}        1.689791    0.567472    0.485843    3.161860    1.565703   1391.50   1427.30    1.000
pinvar{all}     0.315369    0.018679    0.039240    0.543808    0.323720   1099.62   1165.28    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS/139/CG40498-PK/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =   7  ls = 268

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   6   6   7   6   6   6 | Ser TCT  11  11  10  11  11  11 | Tyr TAT   3   4   4   4   4   4 | Cys TGT   1   1   1   1   1   2
    TTC   1   1   1   1   1   1 |     TCC   4   4   4   4   4   3 |     TAC   1   0   0   0   0   0 |     TGC   3   4   4   4   4   3
Leu TTA   8   9   9   9   9   9 |     TCA   5   5   5   5   5   2 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   3   3   3   3   3   2 |     TCG   0   0   0   0   0   1 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   7   7   7   7   7   7 | Pro CCT   2   2   2   2   2   2 | His CAT   7   8   8   8   8   8 | Arg CGT   5   6   6   6   6   7
    CTC   0   1   1   1   1   1 |     CCC   0   0   0   0   0   2 |     CAC   2   2   2   2   2   2 |     CGC   5   4   4   4   4   0
    CTA   3   3   3   3   3   1 |     CCA   3   2   2   2   2   3 | Gln CAA   6   6   6   6   6   6 |     CGA   6   6   6   6   6   8
    CTG   3   1   1   1   1   3 |     CCG   0   3   3   3   3   2 |     CAG   1   2   2   2   2   2 |     CGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   9  10  10  10   8  11 | Thr ACT   6   6   6   6   5   6 | Asn AAT  10   7   7   7   8   9 | Ser AGT   5   7   7   7   7   4
    ATC   3   3   3   3   3   3 |     ACC   1   0   0   0   0   0 |     AAC   5   4   4   4   4   6 |     AGC   9   6   6   7   6   6
    ATA   5   5   5   5   5   5 |     ACA   6   5   5   5   5   8 | Lys AAA   8   8   8   8   8   7 | Arg AGA   4   4   4   4   4   6
Met ATG   6   6   6   6   6   6 |     ACG   3   3   3   3   3   3 |     AAG   2   3   3   3   3   3 |     AGG   3   3   3   3   3   2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT  11  10  10  10  10  10 | Ala GCT   4   3   3   3   4   5 | Asp GAT   8   8   8   8   8   7 | Gly GGT   5   3   3   3   3   3
    GTC   1   3   3   3   3   1 |     GCC   2   2   2   2   2   1 |     GAC   5   5   5   5   5   5 |     GGC   6   6   6   5   6   7
    GTA   4   4   4   4   4   4 |     GCA   3   4   4   4   4   4 | Glu GAA  11  12  12  12  12  14 |     GGA   9  10  10  10  10  10
    GTG   5   4   4   4   5   4 |     GCG   2   2   2   2   2   1 |     GAG   7   6   6   6   6   5 |     GGG   0   1   1   1   1   0
--------------------------------------------------------------------------------------------------------------------------------------

------------------------------------------------------
Phe TTT   6 | Ser TCT  11 | Tyr TAT   4 | Cys TGT   1
    TTC   2 |     TCC   3 |     TAC   0 |     TGC   4
Leu TTA   9 |     TCA   4 | *** TAA   0 | *** TGA   0
    TTG   2 |     TCG   0 |     TAG   0 | Trp TGG   3
------------------------------------------------------
Leu CTT   6 | Pro CCT   2 | His CAT   7 | Arg CGT   6
    CTC   1 |     CCC   1 |     CAC   3 |     CGC   2
    CTA   2 |     CCA   2 | Gln CAA   6 |     CGA   6
    CTG   3 |     CCG   2 |     CAG   1 |     CGG   3
------------------------------------------------------
Ile ATT   9 | Thr ACT   7 | Asn AAT   9 | Ser AGT   5
    ATC   2 |     ACC   1 |     AAC   5 |     AGC   7
    ATA   6 |     ACA   6 | Lys AAA   6 | Arg AGA   5
Met ATG   6 |     ACG   2 |     AAG   4 |     AGG   2
------------------------------------------------------
Val GTT  10 | Ala GCT   6 | Asp GAT   8 | Gly GGT   4
    GTC   2 |     GCC   0 |     GAC   5 |     GGC   6
    GTA   5 |     GCA   4 | Glu GAA  13 |     GGA  10
    GTG   4 |     GCG   2 |     GAG   5 |     GGG   0
------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: D_melanogaster_CG40498-PK             
position  1:    T:0.18284    C:0.19030    A:0.31716    G:0.30970
position  2:    T:0.27985    C:0.19403    A:0.28358    G:0.24254
position  3:    T:0.37313    C:0.17910    A:0.30224    G:0.14552
Average         T:0.27861    C:0.18781    A:0.30100    G:0.23259

#2: D_sechellia_CG40498-PK             
position  1:    T:0.19030    C:0.20149    A:0.29851    G:0.30970
position  2:    T:0.28358    C:0.19403    A:0.27985    G:0.24254
position  3:    T:0.36940    C:0.16791    A:0.30970    G:0.15299
Average         T:0.28109    C:0.18781    A:0.29602    G:0.23507

#3: D_sechellia_CG40498-PK             
position  1:    T:0.19030    C:0.20149    A:0.29851    G:0.30970
position  2:    T:0.28731    C:0.19030    A:0.27985    G:0.24254
position  3:    T:0.36940    C:0.16791    A:0.30970    G:0.15299
Average         T:0.28234    C:0.18657    A:0.29602    G:0.23507

#4: D_sechellia_CG40498-PK             
position  1:    T:0.19030    C:0.20149    A:0.30224    G:0.30597
position  2:    T:0.28358    C:0.19403    A:0.27985    G:0.24254
position  3:    T:0.36940    C:0.16791    A:0.30970    G:0.15299
Average         T:0.28109    C:0.18781    A:0.29726    G:0.23383

#5: D_simulans_CG40498-PK             
position  1:    T:0.19030    C:0.20149    A:0.29104    G:0.31716
position  2:    T:0.27985    C:0.19403    A:0.28358    G:0.24254
position  3:    T:0.36567    C:0.16791    A:0.30970    G:0.15672
Average         T:0.27861    C:0.18781    A:0.29478    G:0.23881

#6: D_yakuba_CG40498-PK             
position  1:    T:0.17537    C:0.20522    A:0.31716    G:0.30224
position  2:    T:0.27612    C:0.20149    A:0.29104    G:0.23134
position  3:    T:0.38060    C:0.15299    A:0.32463    G:0.14179
Average         T:0.27736    C:0.18657    A:0.31095    G:0.22512

#7: D_erecta_CG40498-PK             
position  1:    T:0.18284    C:0.19776    A:0.30597    G:0.31343
position  2:    T:0.27985    C:0.19776    A:0.28358    G:0.23881
position  3:    T:0.37687    C:0.16418    A:0.31343    G:0.14552
Average         T:0.27985    C:0.18657    A:0.30100    G:0.23259

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      43 | Ser S TCT      76 | Tyr Y TAT      27 | Cys C TGT       8
      TTC       8 |       TCC      26 |       TAC       1 |       TGC      26
Leu L TTA      62 |       TCA      31 | *** * TAA       0 | *** * TGA       0
      TTG      19 |       TCG       1 |       TAG       0 | Trp W TGG      21
------------------------------------------------------------------------------
Leu L CTT      48 | Pro P CCT      14 | His H CAT      54 | Arg R CGT      42
      CTC       6 |       CCC       3 |       CAC      15 |       CGC      23
      CTA      18 |       CCA      16 | Gln Q CAA      42 |       CGA      44
      CTG      13 |       CCG      16 |       CAG      12 |       CGG       9
------------------------------------------------------------------------------
Ile I ATT      67 | Thr T ACT      42 | Asn N AAT      57 | Ser S AGT      42
      ATC      20 |       ACC       2 |       AAC      32 |       AGC      47
      ATA      36 |       ACA      40 | Lys K AAA      53 | Arg R AGA      31
Met M ATG      42 |       ACG      20 |       AAG      21 |       AGG      19
------------------------------------------------------------------------------
Val V GTT      71 | Ala A GCT      28 | Asp D GAT      55 | Gly G GGT      24
      GTC      16 |       GCC      11 |       GAC      35 |       GGC      42
      GTA      29 |       GCA      27 | Glu E GAA      86 |       GGA      69
      GTG      30 |       GCG      13 |       GAG      41 |       GGG       4
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.18603    C:0.19989    A:0.30437    G:0.30970
position  2:    T:0.28145    C:0.19510    A:0.28305    G:0.24041
position  3:    T:0.37207    C:0.16684    A:0.31130    G:0.14979
Average         T:0.27985    C:0.18728    A:0.29957    G:0.23330


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

D_melanogaster_CG40498-PK                  
D_sechellia_CG40498-PK                   0.2064 (0.0182 0.0882)
D_sechellia_CG40498-PK                   0.2248 (0.0199 0.0884)-1.0000 (0.0016 0.0000)
D_sechellia_CG40498-PK                   0.2248 (0.0199 0.0884)-1.0000 (0.0016 0.0000)-1.0000 (0.0033 0.0000)
D_simulans_CG40498-PK                   0.2413 (0.0199 0.0824) 0.9422 (0.0049 0.0052) 1.2547 (0.0066 0.0052) 1.2547 (0.0066 0.0052)
D_yakuba_CG40498-PK                   0.1507 (0.0354 0.2352) 0.1552 (0.0354 0.2282) 0.1623 (0.0371 0.2287) 0.1623 (0.0371 0.2287) 0.1679 (0.0371 0.2212)
D_erecta_CG40498-PK                   0.0896 (0.0199 0.2219) 0.1089 (0.0249 0.2290) 0.1160 (0.0266 0.2295) 0.1160 (0.0266 0.2295) 0.1200 (0.0266 0.2220) 0.1377 (0.0249 0.1811)


Model 0: one-ratio


TREE #  1:  (1, (6, 7), ((2, 3, 4), 5));   MP score: 91
lnL(ntime: 10  np: 12):  -1619.591069      +0.000000
   8..1     8..9     9..6     9..7     8..10   10..11   11..2    11..3    11..4    10..5  
 0.047403 0.090038 0.121792 0.069511 0.053571 0.007748 0.000004 0.003866 0.003869 0.007780 1.510113 0.135607

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.40558

(1: 0.047403, (6: 0.121792, 7: 0.069511): 0.090038, ((2: 0.000004, 3: 0.003866, 4: 0.003869): 0.007748, 5: 0.007780): 0.053571);

(D_melanogaster_CG40498-PK: 0.047403, (D_yakuba_CG40498-PK: 0.121792, D_erecta_CG40498-PK: 0.069511): 0.090038, ((D_sechellia_CG40498-PK: 0.000004, D_sechellia_CG40498-PK: 0.003866, D_sechellia_CG40498-PK: 0.003869): 0.007748, D_simulans_CG40498-PK: 0.007780): 0.053571);

Detailed output identifying parameters

kappa (ts/tv) =  1.51011

omega (dN/dS) =  0.13561

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1      0.047   623.8   180.2  0.1356  0.0065  0.0480   4.1   8.6
   8..9      0.090   623.8   180.2  0.1356  0.0124  0.0911   7.7  16.4
   9..6      0.122   623.8   180.2  0.1356  0.0167  0.1233  10.4  22.2
   9..7      0.070   623.8   180.2  0.1356  0.0095  0.0703   6.0  12.7
   8..10     0.054   623.8   180.2  0.1356  0.0074  0.0542   4.6   9.8
  10..11     0.008   623.8   180.2  0.1356  0.0011  0.0078   0.7   1.4
  11..2      0.000   623.8   180.2  0.1356  0.0000  0.0000   0.0   0.0
  11..3      0.004   623.8   180.2  0.1356  0.0005  0.0039   0.3   0.7
  11..4      0.004   623.8   180.2  0.1356  0.0005  0.0039   0.3   0.7
  10..5      0.008   623.8   180.2  0.1356  0.0011  0.0079   0.7   1.4

tree length for dN:       0.0557
tree length for dS:       0.4105


Time used:  0:03


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, (6, 7), ((2, 3, 4), 5));   MP score: 91
lnL(ntime: 10  np: 13):  -1612.343190      +0.000000
   8..1     8..9     9..6     9..7     8..10   10..11   11..2    11..3    11..4    10..5  
 0.049127 0.093976 0.126350 0.072029 0.055134 0.008001 0.000004 0.003965 0.003968 0.007940 1.494368 0.920016 0.062293

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.42049

(1: 0.049127, (6: 0.126350, 7: 0.072029): 0.093976, ((2: 0.000004, 3: 0.003965, 4: 0.003968): 0.008001, 5: 0.007940): 0.055134);

(D_melanogaster_CG40498-PK: 0.049127, (D_yakuba_CG40498-PK: 0.126350, D_erecta_CG40498-PK: 0.072029): 0.093976, ((D_sechellia_CG40498-PK: 0.000004, D_sechellia_CG40498-PK: 0.003965, D_sechellia_CG40498-PK: 0.003968): 0.008001, D_simulans_CG40498-PK: 0.007940): 0.055134);

Detailed output identifying parameters

kappa (ts/tv) =  1.49437


dN/dS (w) for site classes (K=2)

p:   0.92002  0.07998
w:   0.06229  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.049    624.0    180.0   0.1373   0.0068   0.0496    4.2    8.9
   8..9       0.094    624.0    180.0   0.1373   0.0130   0.0948    8.1   17.1
   9..6       0.126    624.0    180.0   0.1373   0.0175   0.1275   10.9   22.9
   9..7       0.072    624.0    180.0   0.1373   0.0100   0.0727    6.2   13.1
   8..10      0.055    624.0    180.0   0.1373   0.0076   0.0556    4.8   10.0
  10..11      0.008    624.0    180.0   0.1373   0.0011   0.0081    0.7    1.5
  11..2       0.000    624.0    180.0   0.1373   0.0000   0.0000    0.0    0.0
  11..3       0.004    624.0    180.0   0.1373   0.0005   0.0040    0.3    0.7
  11..4       0.004    624.0    180.0   0.1373   0.0005   0.0040    0.3    0.7
  10..5       0.008    624.0    180.0   0.1373   0.0011   0.0080    0.7    1.4


Time used:  0:08


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, (6, 7), ((2, 3, 4), 5));   MP score: 91
check convergence..
lnL(ntime: 10  np: 15):  -1609.229767      +0.000000
   8..1     8..9     9..6     9..7     8..10   10..11   11..2    11..3    11..4    10..5  
 0.053422 0.101742 0.133629 0.077686 0.057705 0.008392 0.000004 0.004177 0.004179 0.008418 1.541542 0.982328 0.000000 0.096823 5.254437

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.44935

(1: 0.053422, (6: 0.133629, 7: 0.077686): 0.101742, ((2: 0.000004, 3: 0.004177, 4: 0.004179): 0.008392, 5: 0.008418): 0.057705);

(D_melanogaster_CG40498-PK: 0.053422, (D_yakuba_CG40498-PK: 0.133629, D_erecta_CG40498-PK: 0.077686): 0.101742, ((D_sechellia_CG40498-PK: 0.000004, D_sechellia_CG40498-PK: 0.004177, D_sechellia_CG40498-PK: 0.004179): 0.008392, D_simulans_CG40498-PK: 0.008418): 0.057705);

Detailed output identifying parameters

kappa (ts/tv) =  1.54154


dN/dS (w) for site classes (K=3)

p:   0.98233  0.00000  0.01767
w:   0.09682  1.00000  5.25444

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.053    623.4    180.6   0.1880   0.0090   0.0481    5.6    8.7
   8..9       0.102    623.4    180.6   0.1880   0.0172   0.0916   10.7   16.5
   9..6       0.134    623.4    180.6   0.1880   0.0226   0.1203   14.1   21.7
   9..7       0.078    623.4    180.6   0.1880   0.0131   0.0699    8.2   12.6
   8..10      0.058    623.4    180.6   0.1880   0.0098   0.0519    6.1    9.4
  10..11      0.008    623.4    180.6   0.1880   0.0014   0.0076    0.9    1.4
  11..2       0.000    623.4    180.6   0.1880   0.0000   0.0000    0.0    0.0
  11..3       0.004    623.4    180.6   0.1880   0.0007   0.0038    0.4    0.7
  11..4       0.004    623.4    180.6   0.1880   0.0007   0.0038    0.4    0.7
  10..5       0.008    623.4    180.6   0.1880   0.0014   0.0076    0.9    1.4


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.879         4.631
   212 S      1.000**       5.254
   252 L      0.889         4.681
   259 L      0.878         4.624


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.759         3.433 +- 2.310
   212 S      0.947         4.067 +- 2.183
   252 L      0.770         3.496 +- 2.328
   259 L      0.742         3.318 +- 2.253



The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.967  0.033  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.138  0.218  0.206  0.153  0.104  0.069  0.045  0.031  0.021  0.015

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.064
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.049 0.885

sum of density on p0-p1 =   1.000000

Time used:  0:27


Model 3: discrete (3 categories)


TREE #  1:  (1, (6, 7), ((2, 3, 4), 5));   MP score: 91
lnL(ntime: 10  np: 16):  -1609.229767      +0.000000
   8..1     8..9     9..6     9..7     8..10   10..11   11..2    11..3    11..4    10..5  
 0.053422 0.101741 0.133629 0.077685 0.057705 0.008392 0.000004 0.004177 0.004179 0.008418 1.541544 0.644956 0.337372 0.096822 0.096825 5.254413

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.44935

(1: 0.053422, (6: 0.133629, 7: 0.077685): 0.101741, ((2: 0.000004, 3: 0.004177, 4: 0.004179): 0.008392, 5: 0.008418): 0.057705);

(D_melanogaster_CG40498-PK: 0.053422, (D_yakuba_CG40498-PK: 0.133629, D_erecta_CG40498-PK: 0.077685): 0.101741, ((D_sechellia_CG40498-PK: 0.000004, D_sechellia_CG40498-PK: 0.004177, D_sechellia_CG40498-PK: 0.004179): 0.008392, D_simulans_CG40498-PK: 0.008418): 0.057705);

Detailed output identifying parameters

kappa (ts/tv) =  1.54154


dN/dS (w) for site classes (K=3)

p:   0.64496  0.33737  0.01767
w:   0.09682  0.09682  5.25441

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.053    623.4    180.6   0.1880   0.0090   0.0481    5.6    8.7
   8..9       0.102    623.4    180.6   0.1880   0.0172   0.0916   10.7   16.5
   9..6       0.134    623.4    180.6   0.1880   0.0226   0.1203   14.1   21.7
   9..7       0.078    623.4    180.6   0.1880   0.0131   0.0699    8.2   12.6
   8..10      0.058    623.4    180.6   0.1880   0.0098   0.0519    6.1    9.4
  10..11      0.008    623.4    180.6   0.1880   0.0014   0.0076    0.9    1.4
  11..2       0.000    623.4    180.6   0.1880   0.0000   0.0000    0.0    0.0
  11..3       0.004    623.4    180.6   0.1880   0.0007   0.0038    0.4    0.7
  11..4       0.004    623.4    180.6   0.1880   0.0007   0.0038    0.4    0.7
  10..5       0.008    623.4    180.6   0.1880   0.0014   0.0076    0.9    1.4


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.879         4.631
   212 S      1.000**       5.254
   252 L      0.889         4.681
   259 L      0.878         4.624


Time used:  0:45


Model 7: beta (10 categories)


TREE #  1:  (1, (6, 7), ((2, 3, 4), 5));   MP score: 91
lnL(ntime: 10  np: 13):  -1613.242351      +0.000000
   8..1     8..9     9..6     9..7     8..10   10..11   11..2    11..3    11..4    10..5  
 0.049000 0.093774 0.126106 0.071923 0.055038 0.008026 0.000004 0.003957 0.003959 0.007886 1.511833 0.094602 0.538856

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.41967

(1: 0.049000, (6: 0.126106, 7: 0.071923): 0.093774, ((2: 0.000004, 3: 0.003957, 4: 0.003959): 0.008026, 5: 0.007886): 0.055038);

(D_melanogaster_CG40498-PK: 0.049000, (D_yakuba_CG40498-PK: 0.126106, D_erecta_CG40498-PK: 0.071923): 0.093774, ((D_sechellia_CG40498-PK: 0.000004, D_sechellia_CG40498-PK: 0.003957, D_sechellia_CG40498-PK: 0.003959): 0.008026, D_simulans_CG40498-PK: 0.007886): 0.055038);

Detailed output identifying parameters

kappa (ts/tv) =  1.51183

Parameters in M7 (beta):
 p =   0.09460  q =   0.53886


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00005  0.00064  0.00536  0.03100  0.13434  0.43018  0.88995

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.049    623.8    180.2   0.1492   0.0072   0.0481    4.5    8.7
   8..9       0.094    623.8    180.2   0.1492   0.0137   0.0920    8.6   16.6
   9..6       0.126    623.8    180.2   0.1492   0.0184   0.1237   11.5   22.3
   9..7       0.072    623.8    180.2   0.1492   0.0105   0.0705    6.6   12.7
   8..10      0.055    623.8    180.2   0.1492   0.0081   0.0540    5.0    9.7
  10..11      0.008    623.8    180.2   0.1492   0.0012   0.0079    0.7    1.4
  11..2       0.000    623.8    180.2   0.1492   0.0000   0.0000    0.0    0.0
  11..3       0.004    623.8    180.2   0.1492   0.0006   0.0039    0.4    0.7
  11..4       0.004    623.8    180.2   0.1492   0.0006   0.0039    0.4    0.7
  10..5       0.008    623.8    180.2   0.1492   0.0012   0.0077    0.7    1.4


Time used:  1:13


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, (6, 7), ((2, 3, 4), 5));   MP score: 91
lnL(ntime: 10  np: 15):  -1609.254657      +0.000000
   8..1     8..9     9..6     9..7     8..10   10..11   11..2    11..3    11..4    10..5  
 0.053411 0.101717 0.133594 0.077662 0.057683 0.008391 0.000004 0.004176 0.004178 0.008415 1.541481 0.982508 10.724004 99.000000 5.278335

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.44923

(1: 0.053411, (6: 0.133594, 7: 0.077662): 0.101717, ((2: 0.000004, 3: 0.004176, 4: 0.004178): 0.008391, 5: 0.008415): 0.057683);

(D_melanogaster_CG40498-PK: 0.053411, (D_yakuba_CG40498-PK: 0.133594, D_erecta_CG40498-PK: 0.077662): 0.101717, ((D_sechellia_CG40498-PK: 0.000004, D_sechellia_CG40498-PK: 0.004176, D_sechellia_CG40498-PK: 0.004178): 0.008391, D_simulans_CG40498-PK: 0.008415): 0.057683);

Detailed output identifying parameters

kappa (ts/tv) =  1.54148

Parameters in M8 (beta&w>1):
  p0 =   0.98251  p =  10.72400 q =  99.00000
 (p1 =   0.01749) w =   5.27834


dN/dS (w) for site classes (K=11)

p:   0.09825  0.09825  0.09825  0.09825  0.09825  0.09825  0.09825  0.09825  0.09825  0.09825  0.01749
w:   0.05583  0.06888  0.07751  0.08486  0.09181  0.09886  0.10646  0.11532  0.12699  0.14799  5.27834

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.053    623.4    180.6   0.1881   0.0090   0.0481    5.6    8.7
   8..9       0.102    623.4    180.6   0.1881   0.0172   0.0915   10.7   16.5
   9..6       0.134    623.4    180.6   0.1881   0.0226   0.1202   14.1   21.7
   9..7       0.078    623.4    180.6   0.1881   0.0131   0.0699    8.2   12.6
   8..10      0.058    623.4    180.6   0.1881   0.0098   0.0519    6.1    9.4
  10..11      0.008    623.4    180.6   0.1881   0.0014   0.0075    0.9    1.4
  11..2       0.000    623.4    180.6   0.1881   0.0000   0.0000    0.0    0.0
  11..3       0.004    623.4    180.6   0.1881   0.0007   0.0038    0.4    0.7
  11..4       0.004    623.4    180.6   0.1881   0.0007   0.0038    0.4    0.7
  10..5       0.008    623.4    180.6   0.1881   0.0014   0.0076    0.9    1.4


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.870         4.605
   212 S      1.000**       5.278
   252 L      0.880         4.658
   259 L      0.867         4.593


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.831         2.904 +- 1.917
   212 S      0.980*        3.277 +- 1.766
   252 L      0.835         2.926 +- 1.925
   259 L      0.835         2.887 +- 1.882



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  1.000
p :   0.982  0.018  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.001  0.013  0.050  0.103  0.155  0.197  0.228  0.252
ws:   0.234  0.303  0.203  0.115  0.064  0.036  0.021  0.012  0.008  0.005

Time used:  2:22
Model 1: NearlyNeutral	-1612.34319
Model 2: PositiveSelection	-1609.229767
Model 0: one-ratio	-1619.591069
Model 3: discrete	-1609.229767
Model 7: beta	-1613.242351
Model 8: beta&w>1	-1609.254657


Model 0 vs 1	14.495758000000023

Model 2 vs 1	6.226846000000023

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.879         4.631
   212 S      1.000**       5.254
   252 L      0.889         4.681
   259 L      0.878         4.624

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.759         3.433 +- 2.310
   212 S      0.947         4.067 +- 2.183
   252 L      0.770         3.496 +- 2.328
   259 L      0.742         3.318 +- 2.253


Model 8 vs 7	7.975388000000294

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.870         4.605
   212 S      1.000**       5.278
   252 L      0.880         4.658
   259 L      0.867         4.593

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.831         2.904 +- 1.917
   212 S      0.980*        3.277 +- 1.766
   252 L      0.835         2.926 +- 1.925
   259 L      0.835         2.887 +- 1.882