--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Nov 02 10:40:21 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/139/CG40498-PK/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1673.25         -1688.15
2      -1673.33         -1686.30
--------------------------------------
TOTAL    -1673.29         -1687.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.191774    0.000788    0.137623    0.244201    0.189300   1335.03   1340.05    1.000
r(A<->C){all}   0.163841    0.001953    0.083028    0.255560    0.161236    907.24    979.98    1.000
r(A<->G){all}   0.219379    0.002449    0.129117    0.320130    0.214876    671.31    762.40    1.000
r(A<->T){all}   0.141953    0.001348    0.075400    0.217419    0.138754    927.65    956.63    1.000
r(C<->G){all}   0.080053    0.001141    0.021072    0.147203    0.075570    651.97    756.57    1.000
r(C<->T){all}   0.319654    0.003262    0.210049    0.430387    0.316561    629.73    709.99    1.000
r(G<->T){all}   0.075119    0.000797    0.025072    0.130261    0.072479    872.18    951.80    1.000
pi(A){all}      0.303955    0.000242    0.273407    0.333209    0.303565    881.97   1163.91    1.000
pi(C){all}      0.185692    0.000164    0.162076    0.212787    0.185225   1099.70   1300.35    1.000
pi(G){all}      0.230487    0.000204    0.204576    0.261189    0.230336   1209.01   1234.92    1.000
pi(T){all}      0.279866    0.000223    0.250750    0.309714    0.279732   1200.29   1280.31    1.000
alpha{1,2}      0.079961    0.004467    0.000179    0.201425    0.065103   1194.08   1330.99    1.000
alpha{3}        1.689791    0.567472    0.485843    3.161860    1.565703   1391.50   1427.30    1.000
pinvar{all}     0.315369    0.018679    0.039240    0.543808    0.323720   1099.62   1165.28    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1612.34319
Model 2: PositiveSelection	-1609.229767
Model 0: one-ratio	-1619.591069
Model 3: discrete	-1609.229767
Model 7: beta	-1613.242351
Model 8: beta&w>1	-1609.254657


Model 0 vs 1	14.495758000000023

Model 2 vs 1	6.226846000000023

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.879         4.631
   212 S      1.000**       5.254
   252 L      0.889         4.681
   259 L      0.878         4.624

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.759         3.433 +- 2.310
   212 S      0.947         4.067 +- 2.183
   252 L      0.770         3.496 +- 2.328
   259 L      0.742         3.318 +- 2.253


Model 8 vs 7	7.975388000000294

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.870         4.605
   212 S      1.000**       5.278
   252 L      0.880         4.658
   259 L      0.867         4.593

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG40498-PK)

            Pr(w>1)     post mean +- SE for w

    63 T      0.831         2.904 +- 1.917
   212 S      0.980*        3.277 +- 1.766
   252 L      0.835         2.926 +- 1.925
   259 L      0.835         2.887 +- 1.882

>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 

C1              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C2              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C3              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C4              MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C5              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
C6              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
C7              MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
                ****.******************************************:**

C1              KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C2              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C3              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C4              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C5              KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C6              KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
C7              KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
                ******:.**.*.*************************************

C1              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C2              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C3              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C4              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C5              MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
C6              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
C7              MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
                ***::**************************:******************

C1              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
C2              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C3              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C4              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
C5              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
C6              RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
C7              RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
                ***************:*********************  **********.

C1              SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C2              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C3              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C4              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
C5              SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
C6              SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
C7              SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
                *:***.**.** ******:**:********.:*****.******:*****

C1              KLLLRRESLNDAISITRI
C2              KQLLRRESLSDAISITRI
C3              KQLLRREFLSDAISITRI
C4              KQLLRRESLSDAISITRI
C5              KQLLRRESLSDAISITRI
C6              KQLLRRESTNDAINITRI
C7              KLLLRRESINDAINITRI
                * *****  .***.****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  268 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  268 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11256]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [11256]--->[11256]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/139/CG40498-PK/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.390 Mb, Max= 30.781 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI

FORMAT of file /tmp/tmp6968097659462679997aln Not Supported[FATAL:T-COFFEE]
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:268 S:100 BS:268
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.27 C1	 C2	 96.27
TOP	    1    0	 96.27 C2	 C1	 96.27
BOT	    0    2	 95.90 C1	 C3	 95.90
TOP	    2    0	 95.90 C3	 C1	 95.90
BOT	    0    3	 95.90 C1	 C4	 95.90
TOP	    3    0	 95.90 C4	 C1	 95.90
BOT	    0    4	 95.90 C1	 C5	 95.90
TOP	    4    0	 95.90 C5	 C1	 95.90
BOT	    0    5	 93.28 C1	 C6	 93.28
TOP	    5    0	 93.28 C6	 C1	 93.28
BOT	    0    6	 95.90 C1	 C7	 95.90
TOP	    6    0	 95.90 C7	 C1	 95.90
BOT	    1    2	 99.63 C2	 C3	 99.63
TOP	    2    1	 99.63 C3	 C2	 99.63
BOT	    1    3	 99.63 C2	 C4	 99.63
TOP	    3    1	 99.63 C4	 C2	 99.63
BOT	    1    4	 98.88 C2	 C5	 98.88
TOP	    4    1	 98.88 C5	 C2	 98.88
BOT	    1    5	 93.66 C2	 C6	 93.66
TOP	    5    1	 93.66 C6	 C2	 93.66
BOT	    1    6	 94.78 C2	 C7	 94.78
TOP	    6    1	 94.78 C7	 C2	 94.78
BOT	    2    3	 99.25 C3	 C4	 99.25
TOP	    3    2	 99.25 C4	 C3	 99.25
BOT	    2    4	 98.51 C3	 C5	 98.51
TOP	    4    2	 98.51 C5	 C3	 98.51
BOT	    2    5	 93.28 C3	 C6	 93.28
TOP	    5    2	 93.28 C6	 C3	 93.28
BOT	    2    6	 94.40 C3	 C7	 94.40
TOP	    6    2	 94.40 C7	 C3	 94.40
BOT	    3    4	 98.51 C4	 C5	 98.51
TOP	    4    3	 98.51 C5	 C4	 98.51
BOT	    3    5	 93.28 C4	 C6	 93.28
TOP	    5    3	 93.28 C6	 C4	 93.28
BOT	    3    6	 94.40 C4	 C7	 94.40
TOP	    6    3	 94.40 C7	 C4	 94.40
BOT	    4    5	 93.28 C5	 C6	 93.28
TOP	    5    4	 93.28 C6	 C5	 93.28
BOT	    4    6	 94.40 C5	 C7	 94.40
TOP	    6    4	 94.40 C7	 C5	 94.40
BOT	    5    6	 95.15 C6	 C7	 95.15
TOP	    6    5	 95.15 C7	 C6	 95.15
AVG	 0	 C1	  *	 95.52
AVG	 1	 C2	  *	 97.14
AVG	 2	 C3	  *	 96.83
AVG	 3	 C4	  *	 96.83
AVG	 4	 C5	  *	 96.58
AVG	 5	 C6	  *	 93.66
AVG	 6	 C7	  *	 94.84
TOT	 TOT	  *	 95.91
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C2              ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C3              ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C4              ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C5              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
C6              ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA
C7              ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
                ********.** .********** **************************

C1              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA
C2              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C3              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C4              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C5              ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
C6              ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA
C7              ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA
                ******:********.******** **.******** *************

C1              GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C2              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C3              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C4              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C5              GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
C6              GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA
C7              GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA
                *******.***** **************************  ****.***

C1              AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA
C2              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C3              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C4              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C5              AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
C6              AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA
C7              AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA
                ***** ***** ***** .** ******** * ***.* ***********

C1              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C2              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C3              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C4              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C5              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C6              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
C7              CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
                **************************************************

C1              TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT
C2              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C3              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C4              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C5              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C6              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
C7              TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
                ************************* ************************

C1              ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC
C2              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C3              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C4              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C5              ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
C6              ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC
C7              ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC
                ***********  ****************:**.**************:**

C1              TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA
C2              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C3              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C4              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
C5              TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA
C6              ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA
C7              TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA
                :******** ******** ** *** ****************:.******

C1              ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C2              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C3              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C4              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C5              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C6              ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
C7              ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA
                ************* *****.**************************.***

C1              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C2              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C3              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C4              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C5              CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
C6              CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA
C7              CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA
                ************.*******.************************.****

C1              AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA
C2              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C3              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C4              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C5              AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
C6              AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA
C7              AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA
                *********************.*****:**.***** ***** *******

C1              AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC
C2              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C3              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C4              AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C5              AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
C6              AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC
C7              AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT
                **** *******:**:.******************** ******** .* 

C1              TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA
C2              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C3              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C4              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C5              TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
C6              TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA
C7              TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA
                *** *:**.******:********.******* . ********* *****

C1              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C2              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C3              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C4              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
C5              CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT
C6              CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT
C7              CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT
                *** :*******::**** *****************.****.:.******

C1              TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG
C2              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C3              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C4              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C5              TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
C6              TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG
C7              TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG
                ********** *.*** ***********.*****:***************

C1              AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG
C2              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C3              AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG
C4              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C5              AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
C6              AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG
C7              AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG
                **.*:. * ************* *. .*.***********.***:**.**

C1              TATT
C2              TATT
C3              TATT
C4              TATT
C5              TATT
C6              TATT
C7              TATT
                ****



>C1
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA
GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC
TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC
TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG
AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG
TATT
>C2
ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C3
ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C4
ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C5
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA
AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC
TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA
AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC
TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA
CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT
TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG
TATT
>C6
ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA
GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA
AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC
ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA
ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA
CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA
AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA
AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC
TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA
CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT
TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG
AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG
TATT
>C7
ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA
ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA
GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA
AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA
CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG
TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT
ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC
TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA
ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA
CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA
AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA
AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT
TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA
CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT
TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG
AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG
TATT
>C1
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KLLLRRESLNDAISITRI
>C2
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C3
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRREFLSDAISITRI
>C4
MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C5
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG
SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK
KQLLRRESLSDAISITRI
>C6
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR
KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG
SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK
KQLLRRESTNDAINITRI
>C7
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR
KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET
MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ
RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS
SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK
KLLLRRESINDAINITRI


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 7 taxa and 804 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478082874
      Setting output file names to "/opt/ADOPS/139/CG40498-PK/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 119105681
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0921445789
      Seed = 1783177223
      Swapseed = 1478082874
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 21 unique site patterns
      Division 2 has 14 unique site patterns
      Division 3 has 38 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2420.895436 -- -24.557203
         Chain 2 -- -2425.018516 -- -24.557203
         Chain 3 -- -2425.018517 -- -24.557203
         Chain 4 -- -2424.658399 -- -24.557203

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2323.671928 -- -24.557203
         Chain 2 -- -2420.734829 -- -24.557203
         Chain 3 -- -2423.901976 -- -24.557203
         Chain 4 -- -2408.130008 -- -24.557203


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2420.895] (-2425.019) (-2425.019) (-2424.658) * [-2323.672] (-2420.735) (-2423.902) (-2408.130) 
        500 -- [-1695.752] (-1697.332) (-1695.874) (-1695.339) * (-1702.148) (-1699.151) (-1698.639) [-1696.797] -- 0:00:00
       1000 -- (-1691.528) (-1688.445) (-1695.551) [-1679.016] * (-1691.807) [-1684.280] (-1685.046) (-1686.704) -- 0:00:00
       1500 -- (-1691.743) [-1687.673] (-1687.974) (-1681.737) * (-1686.355) [-1681.322] (-1689.832) (-1697.333) -- 0:00:00
       2000 -- (-1684.585) [-1680.845] (-1691.053) (-1681.450) * (-1687.289) [-1685.078] (-1687.611) (-1686.012) -- 0:00:00
       2500 -- (-1692.378) [-1675.862] (-1690.542) (-1683.247) * [-1680.730] (-1681.290) (-1692.842) (-1683.263) -- 0:00:00
       3000 -- (-1697.199) [-1684.116] (-1679.273) (-1679.621) * [-1678.847] (-1675.766) (-1694.520) (-1685.774) -- 0:00:00
       3500 -- (-1694.973) [-1672.038] (-1680.047) (-1687.566) * (-1676.987) [-1676.411] (-1684.481) (-1682.442) -- 0:00:00
       4000 -- (-1688.068) [-1677.629] (-1672.026) (-1691.796) * (-1679.886) [-1673.458] (-1681.862) (-1682.026) -- 0:00:00
       4500 -- (-1691.996) (-1677.424) [-1675.472] (-1670.953) * (-1680.761) [-1680.374] (-1683.338) (-1675.541) -- 0:03:41
       5000 -- (-1684.316) (-1672.480) (-1684.358) [-1677.248] * (-1677.398) (-1675.106) (-1678.166) [-1674.034] -- 0:03:19

      Average standard deviation of split frequencies: 0.026189

       5500 -- (-1675.055) [-1677.710] (-1677.538) (-1679.021) * (-1677.789) (-1680.034) (-1689.554) [-1678.020] -- 0:03:00
       6000 -- (-1675.544) (-1690.486) (-1686.022) [-1674.201] * [-1675.530] (-1682.474) (-1685.602) (-1676.658) -- 0:02:45
       6500 -- (-1681.817) (-1682.509) (-1682.981) [-1672.669] * (-1674.858) (-1678.833) (-1681.963) [-1676.788] -- 0:02:32
       7000 -- [-1683.109] (-1679.011) (-1684.462) (-1677.858) * (-1680.586) (-1679.139) [-1677.605] (-1676.640) -- 0:02:21
       7500 -- (-1673.089) [-1676.746] (-1678.558) (-1677.397) * [-1675.265] (-1676.533) (-1686.070) (-1687.019) -- 0:02:12
       8000 -- (-1674.811) (-1677.607) (-1691.397) [-1683.011] * (-1677.505) (-1676.204) (-1683.456) [-1673.389] -- 0:02:04
       8500 -- (-1682.093) (-1693.001) (-1684.201) [-1678.307] * (-1675.783) (-1679.257) [-1680.707] (-1676.981) -- 0:01:56
       9000 -- (-1681.874) (-1686.924) (-1683.286) [-1674.139] * (-1677.362) [-1687.831] (-1683.307) (-1674.388) -- 0:01:50
       9500 -- (-1684.220) (-1685.914) (-1701.002) [-1673.734] * (-1675.048) [-1684.385] (-1678.518) (-1672.907) -- 0:03:28
      10000 -- (-1679.602) (-1681.279) (-1687.915) [-1674.026] * (-1684.760) (-1681.819) (-1684.543) [-1676.640] -- 0:03:18

      Average standard deviation of split frequencies: 0.051560

      10500 -- (-1674.606) [-1675.901] (-1684.041) (-1679.454) * [-1676.319] (-1683.438) (-1684.528) (-1679.957) -- 0:03:08
      11000 -- (-1677.742) [-1680.693] (-1681.355) (-1674.571) * (-1685.771) (-1675.309) [-1671.599] (-1682.583) -- 0:02:59
      11500 -- (-1674.152) (-1677.638) [-1674.373] (-1675.073) * (-1677.984) [-1675.025] (-1674.240) (-1679.015) -- 0:02:51
      12000 -- (-1675.278) (-1684.532) (-1675.669) [-1677.696] * (-1684.060) (-1673.059) [-1675.718] (-1681.669) -- 0:02:44
      12500 -- (-1671.359) [-1669.898] (-1688.065) (-1676.337) * (-1683.480) (-1682.338) (-1676.242) [-1673.936] -- 0:02:38
      13000 -- [-1675.296] (-1682.487) (-1691.187) (-1678.102) * (-1678.877) [-1679.126] (-1694.917) (-1676.709) -- 0:02:31
      13500 -- [-1676.202] (-1673.361) (-1676.304) (-1677.224) * (-1676.807) (-1686.295) (-1684.968) [-1679.280] -- 0:02:26
      14000 -- (-1682.469) [-1676.344] (-1675.638) (-1677.262) * (-1680.271) [-1679.732] (-1680.870) (-1677.765) -- 0:02:20
      14500 -- (-1682.914) [-1674.503] (-1670.484) (-1676.732) * (-1675.613) [-1676.712] (-1694.698) (-1678.195) -- 0:03:23
      15000 -- (-1679.607) (-1676.023) [-1674.726] (-1683.685) * [-1681.010] (-1680.668) (-1691.961) (-1683.933) -- 0:03:17

      Average standard deviation of split frequencies: 0.044194

      15500 -- (-1678.351) [-1676.287] (-1677.239) (-1676.019) * (-1689.280) (-1684.496) (-1672.340) [-1676.512] -- 0:03:10
      16000 -- [-1674.259] (-1679.124) (-1671.438) (-1690.908) * (-1692.109) [-1676.425] (-1682.041) (-1675.346) -- 0:03:04
      16500 -- (-1685.714) (-1676.750) (-1673.469) [-1678.033] * (-1683.056) (-1676.115) (-1679.194) [-1682.360] -- 0:02:58
      17000 -- (-1686.918) [-1675.418] (-1677.622) (-1678.762) * (-1683.017) (-1678.349) (-1681.854) [-1677.384] -- 0:02:53
      17500 -- (-1685.997) (-1680.524) (-1677.435) [-1676.380] * (-1677.129) [-1675.303] (-1677.718) (-1686.091) -- 0:02:48
      18000 -- (-1678.015) (-1680.364) [-1673.812] (-1684.674) * (-1676.476) [-1678.361] (-1689.354) (-1673.952) -- 0:02:43
      18500 -- (-1679.294) (-1673.052) (-1677.532) [-1680.964] * (-1681.352) [-1675.779] (-1678.106) (-1676.152) -- 0:02:39
      19000 -- [-1680.631] (-1676.203) (-1677.138) (-1685.113) * (-1691.237) (-1678.896) (-1679.094) [-1675.448] -- 0:02:34
      19500 -- (-1676.215) (-1675.250) [-1680.857] (-1678.774) * (-1686.413) [-1679.145] (-1679.834) (-1678.357) -- 0:03:21
      20000 -- (-1678.314) [-1674.929] (-1678.871) (-1679.033) * (-1686.676) [-1675.989] (-1687.163) (-1673.785) -- 0:03:16

      Average standard deviation of split frequencies: 0.038016

      20500 -- (-1679.329) [-1673.684] (-1676.617) (-1679.367) * [-1670.734] (-1682.684) (-1680.075) (-1681.654) -- 0:03:11
      21000 -- (-1678.443) (-1676.095) (-1685.404) [-1677.915] * [-1683.552] (-1682.981) (-1683.810) (-1674.363) -- 0:03:06
      21500 -- [-1677.941] (-1681.059) (-1682.928) (-1678.395) * (-1683.333) (-1675.602) (-1678.859) [-1675.141] -- 0:03:02
      22000 -- (-1673.503) (-1679.773) (-1676.461) [-1682.377] * (-1674.880) (-1675.544) [-1677.041] (-1682.541) -- 0:02:57
      22500 -- (-1677.150) (-1671.897) [-1674.758] (-1681.705) * (-1682.170) (-1675.547) (-1685.802) [-1678.968] -- 0:02:53
      23000 -- [-1676.801] (-1677.762) (-1674.607) (-1683.603) * (-1673.014) (-1672.735) [-1676.363] (-1678.770) -- 0:02:49
      23500 -- (-1679.572) (-1674.322) [-1675.367] (-1682.759) * (-1677.075) (-1675.619) (-1673.493) [-1672.316] -- 0:02:46
      24000 -- [-1676.576] (-1677.401) (-1678.043) (-1688.416) * (-1676.895) (-1682.787) (-1675.819) [-1672.448] -- 0:02:42
      24500 -- (-1677.483) (-1677.334) [-1672.690] (-1688.908) * [-1677.123] (-1674.824) (-1675.023) (-1681.736) -- 0:03:19
      25000 -- (-1676.518) (-1675.947) (-1678.028) [-1680.234] * (-1684.310) (-1677.408) (-1685.796) [-1673.514] -- 0:03:15

      Average standard deviation of split frequencies: 0.042306

      25500 -- [-1676.520] (-1675.506) (-1676.994) (-1678.684) * (-1674.424) [-1681.776] (-1684.808) (-1673.004) -- 0:03:11
      26000 -- (-1679.075) (-1672.297) (-1674.738) [-1672.950] * (-1679.546) (-1683.069) (-1678.994) [-1672.681] -- 0:03:07
      26500 -- (-1681.656) [-1676.061] (-1681.410) (-1676.818) * [-1678.926] (-1685.103) (-1687.067) (-1678.922) -- 0:03:03
      27000 -- (-1676.260) (-1685.279) [-1680.226] (-1674.388) * (-1677.289) [-1676.814] (-1683.731) (-1681.103) -- 0:03:00
      27500 -- (-1677.616) [-1686.203] (-1697.446) (-1679.648) * [-1680.864] (-1685.032) (-1689.123) (-1681.624) -- 0:02:56
      28000 -- [-1680.920] (-1679.887) (-1691.573) (-1680.844) * (-1682.031) (-1678.420) (-1685.469) [-1682.989] -- 0:02:53
      28500 -- (-1676.804) (-1683.585) (-1680.013) [-1682.448] * (-1678.152) [-1678.329] (-1683.365) (-1690.691) -- 0:02:50
      29000 -- [-1678.259] (-1676.405) (-1679.222) (-1687.497) * (-1675.033) [-1680.609] (-1673.244) (-1687.424) -- 0:02:47
      29500 -- (-1692.401) [-1674.846] (-1675.250) (-1680.072) * [-1680.202] (-1693.056) (-1672.115) (-1686.009) -- 0:03:17
      30000 -- (-1677.731) (-1680.359) [-1676.777] (-1677.509) * (-1678.970) [-1675.835] (-1676.610) (-1686.729) -- 0:03:14

      Average standard deviation of split frequencies: 0.030744

      30500 -- (-1680.440) [-1679.885] (-1681.244) (-1678.483) * (-1679.768) (-1679.386) [-1680.824] (-1691.507) -- 0:03:10
      31000 -- (-1680.826) [-1679.340] (-1678.447) (-1688.507) * (-1672.845) (-1677.189) (-1670.975) [-1684.477] -- 0:03:07
      31500 -- (-1675.964) (-1674.545) [-1673.819] (-1683.812) * [-1676.087] (-1683.148) (-1671.815) (-1674.657) -- 0:03:04
      32000 -- (-1685.724) [-1670.816] (-1678.992) (-1681.445) * (-1674.589) (-1684.657) (-1697.875) [-1674.703] -- 0:03:01
      32500 -- (-1681.902) [-1673.796] (-1672.543) (-1681.770) * (-1673.138) (-1681.883) (-1679.025) [-1677.664] -- 0:02:58
      33000 -- (-1677.683) (-1672.031) [-1671.463] (-1690.173) * (-1673.780) (-1682.824) (-1680.147) [-1672.892] -- 0:02:55
      33500 -- (-1676.324) (-1675.156) [-1672.951] (-1683.787) * [-1672.281] (-1684.785) (-1683.531) (-1680.427) -- 0:02:53
      34000 -- (-1682.258) [-1677.634] (-1679.071) (-1691.069) * (-1680.341) (-1682.183) (-1685.427) [-1673.274] -- 0:02:50
      34500 -- (-1683.893) [-1678.472] (-1681.741) (-1683.950) * (-1673.976) (-1681.956) [-1675.935] (-1678.534) -- 0:03:15
      35000 -- (-1672.945) [-1678.191] (-1682.049) (-1685.230) * (-1679.761) (-1678.261) (-1680.490) [-1677.899] -- 0:03:13

      Average standard deviation of split frequencies: 0.026189

      35500 -- (-1669.832) [-1681.959] (-1680.285) (-1690.842) * [-1675.224] (-1676.433) (-1676.745) (-1680.377) -- 0:03:10
      36000 -- (-1681.880) [-1678.340] (-1680.680) (-1688.751) * (-1682.205) [-1677.082] (-1676.918) (-1682.296) -- 0:03:07
      36500 -- [-1681.206] (-1678.699) (-1677.824) (-1683.782) * (-1677.342) (-1685.126) (-1678.567) [-1674.289] -- 0:03:04
      37000 -- (-1673.298) (-1682.345) [-1673.812] (-1688.506) * (-1690.996) (-1683.780) (-1678.350) [-1679.847] -- 0:03:02
      37500 -- [-1676.507] (-1683.275) (-1675.838) (-1687.417) * (-1679.696) (-1685.050) [-1684.288] (-1676.534) -- 0:02:59
      38000 -- (-1678.986) (-1685.196) (-1680.075) [-1680.472] * (-1691.535) (-1677.674) (-1674.035) [-1675.784] -- 0:02:57
      38500 -- (-1686.418) [-1672.431] (-1674.928) (-1676.244) * (-1683.745) [-1681.188] (-1677.759) (-1681.777) -- 0:02:54
      39000 -- (-1678.832) (-1675.936) (-1671.077) [-1678.301] * (-1680.612) (-1676.407) (-1678.831) [-1671.899] -- 0:02:52
      39500 -- (-1680.360) (-1680.873) [-1672.534] (-1681.199) * (-1680.880) (-1680.768) (-1680.837) [-1674.318] -- 0:03:14
      40000 -- [-1684.444] (-1682.867) (-1675.885) (-1680.975) * [-1676.034] (-1677.827) (-1677.785) (-1675.688) -- 0:03:12

      Average standard deviation of split frequencies: 0.021252

      40500 -- [-1681.997] (-1672.608) (-1682.615) (-1679.386) * (-1674.366) (-1674.746) (-1678.596) [-1670.883] -- 0:03:09
      41000 -- [-1680.648] (-1688.702) (-1672.749) (-1682.149) * [-1677.350] (-1679.769) (-1677.233) (-1689.708) -- 0:03:07
      41500 -- (-1684.146) (-1674.933) [-1676.379] (-1679.573) * (-1672.306) [-1674.922] (-1673.011) (-1680.380) -- 0:03:04
      42000 -- (-1679.467) (-1678.944) (-1676.190) [-1673.402] * (-1676.744) [-1674.201] (-1678.225) (-1674.393) -- 0:03:02
      42500 -- [-1672.697] (-1681.043) (-1673.331) (-1675.163) * (-1679.794) [-1674.990] (-1677.369) (-1681.762) -- 0:03:00
      43000 -- (-1676.022) (-1680.146) [-1670.570] (-1680.504) * [-1692.018] (-1677.251) (-1678.935) (-1677.665) -- 0:02:58
      43500 -- [-1682.149] (-1678.152) (-1682.306) (-1674.777) * (-1681.147) [-1679.298] (-1674.777) (-1684.311) -- 0:02:55
      44000 -- [-1673.122] (-1675.401) (-1676.679) (-1674.779) * (-1681.481) [-1681.340] (-1677.822) (-1674.591) -- 0:02:53
      44500 -- (-1676.694) (-1679.569) (-1679.708) [-1678.069] * (-1675.439) [-1677.055] (-1676.451) (-1683.894) -- 0:03:13
      45000 -- (-1673.043) [-1673.897] (-1681.238) (-1681.342) * (-1677.464) (-1687.033) (-1677.560) [-1679.265] -- 0:03:11

      Average standard deviation of split frequencies: 0.018788

      45500 -- (-1679.555) (-1688.619) [-1674.909] (-1690.323) * [-1676.441] (-1680.018) (-1679.581) (-1678.732) -- 0:03:08
      46000 -- (-1676.072) (-1680.246) [-1673.921] (-1680.772) * (-1682.464) [-1677.273] (-1678.546) (-1678.970) -- 0:03:06
      46500 -- (-1679.109) (-1680.189) [-1678.056] (-1678.526) * (-1678.077) (-1677.628) (-1674.151) [-1676.530] -- 0:03:04
      47000 -- (-1674.950) (-1680.993) (-1674.006) [-1679.870] * (-1683.036) (-1683.051) [-1678.160] (-1681.182) -- 0:03:02
      47500 -- (-1683.326) (-1673.729) [-1675.463] (-1687.360) * (-1679.850) (-1680.654) [-1672.382] (-1675.437) -- 0:03:00
      48000 -- (-1675.692) [-1680.983] (-1683.221) (-1681.243) * (-1674.868) (-1674.955) [-1676.368] (-1684.859) -- 0:02:58
      48500 -- (-1675.208) (-1671.619) (-1671.870) [-1678.307] * [-1674.106] (-1684.551) (-1678.151) (-1680.230) -- 0:02:56
      49000 -- (-1680.634) [-1675.451] (-1676.823) (-1678.655) * (-1679.445) (-1696.441) (-1674.236) [-1680.266] -- 0:02:54
      49500 -- (-1674.467) (-1681.390) (-1680.020) [-1671.541] * (-1680.713) (-1689.968) [-1679.460] (-1677.613) -- 0:03:12
      50000 -- (-1684.618) (-1681.872) (-1679.810) [-1672.967] * (-1678.292) (-1690.215) [-1680.071] (-1685.336) -- 0:03:10

      Average standard deviation of split frequencies: 0.017057

      50500 -- (-1679.497) (-1679.192) [-1677.872] (-1673.715) * [-1684.668] (-1677.996) (-1680.318) (-1683.118) -- 0:03:08
      51000 -- (-1684.692) (-1678.694) [-1669.502] (-1682.557) * [-1680.327] (-1675.934) (-1683.260) (-1690.132) -- 0:03:06
      51500 -- (-1680.173) (-1684.238) [-1678.428] (-1674.012) * (-1676.854) (-1675.838) (-1680.136) [-1677.339] -- 0:03:04
      52000 -- [-1674.842] (-1686.803) (-1683.563) (-1675.495) * (-1681.502) (-1680.758) [-1677.278] (-1677.129) -- 0:03:02
      52500 -- (-1677.288) (-1676.472) (-1694.994) [-1673.139] * (-1677.349) (-1681.652) [-1675.029] (-1678.989) -- 0:03:00
      53000 -- (-1685.340) (-1679.503) (-1682.106) [-1681.737] * (-1688.221) (-1678.037) [-1684.765] (-1678.704) -- 0:02:58
      53500 -- (-1677.896) [-1674.900] (-1680.078) (-1676.292) * (-1678.092) (-1675.712) (-1673.431) [-1674.356] -- 0:02:56
      54000 -- (-1680.280) [-1681.713] (-1686.789) (-1676.526) * (-1676.266) [-1676.509] (-1675.898) (-1675.820) -- 0:02:55
      54500 -- (-1683.239) (-1676.816) (-1686.641) [-1678.482] * (-1676.373) (-1674.642) (-1675.069) [-1677.162] -- 0:02:53
      55000 -- [-1677.787] (-1675.644) (-1683.101) (-1678.436) * (-1679.994) (-1677.319) (-1672.852) [-1677.289] -- 0:03:09

      Average standard deviation of split frequencies: 0.009821

      55500 -- (-1672.667) (-1678.638) (-1683.192) [-1674.101] * [-1676.125] (-1672.806) (-1679.691) (-1679.962) -- 0:03:07
      56000 -- (-1674.840) [-1672.136] (-1682.113) (-1678.554) * (-1679.309) (-1682.387) [-1676.988] (-1690.048) -- 0:03:05
      56500 -- (-1678.305) (-1679.558) (-1683.459) [-1675.077] * (-1683.140) (-1670.064) [-1675.260] (-1695.029) -- 0:03:03
      57000 -- (-1686.464) (-1678.071) (-1684.370) [-1679.146] * [-1682.899] (-1681.249) (-1678.981) (-1695.627) -- 0:03:01
      57500 -- (-1676.499) (-1688.382) (-1678.206) [-1680.236] * (-1681.712) (-1688.939) (-1679.475) [-1680.674] -- 0:03:00
      58000 -- (-1678.041) (-1686.288) (-1678.982) [-1677.646] * (-1679.385) [-1680.504] (-1688.151) (-1683.008) -- 0:02:58
      58500 -- (-1676.360) (-1677.638) [-1674.587] (-1685.664) * [-1677.413] (-1673.274) (-1676.048) (-1676.737) -- 0:02:57
      59000 -- (-1678.940) (-1683.622) [-1678.553] (-1680.262) * (-1683.226) (-1678.328) [-1682.564] (-1674.425) -- 0:02:55
      59500 -- (-1676.082) (-1679.985) [-1689.615] (-1681.521) * (-1674.688) (-1682.139) (-1679.340) [-1679.460] -- 0:02:53
      60000 -- (-1681.868) (-1676.894) (-1679.128) [-1677.351] * (-1676.675) (-1675.709) [-1679.119] (-1676.830) -- 0:03:08

      Average standard deviation of split frequencies: 0.011656

      60500 -- (-1684.509) [-1686.367] (-1681.206) (-1680.209) * (-1680.322) (-1676.753) [-1676.249] (-1686.628) -- 0:03:06
      61000 -- (-1680.444) [-1669.802] (-1681.962) (-1676.724) * (-1681.192) (-1677.228) (-1684.402) [-1672.728] -- 0:03:04
      61500 -- (-1682.328) (-1677.428) (-1676.009) [-1676.811] * (-1681.027) [-1670.868] (-1679.956) (-1676.950) -- 0:03:03
      62000 -- [-1684.425] (-1678.391) (-1673.884) (-1673.686) * (-1678.731) [-1676.750] (-1680.860) (-1676.975) -- 0:03:01
      62500 -- (-1681.262) (-1672.885) (-1674.070) [-1676.037] * (-1672.980) (-1681.581) (-1680.246) [-1678.091] -- 0:03:00
      63000 -- (-1686.234) (-1683.698) (-1672.566) [-1679.063] * (-1675.904) (-1676.361) (-1681.178) [-1681.244] -- 0:02:58
      63500 -- [-1676.875] (-1674.931) (-1679.501) (-1689.921) * (-1675.177) [-1679.111] (-1681.878) (-1683.140) -- 0:02:56
      64000 -- (-1676.715) (-1673.535) (-1691.939) [-1677.643] * [-1675.290] (-1679.553) (-1678.242) (-1683.395) -- 0:02:55
      64500 -- (-1676.346) (-1677.133) (-1691.515) [-1677.026] * (-1681.014) (-1677.574) [-1681.005] (-1686.015) -- 0:02:54
      65000 -- (-1684.896) (-1670.925) (-1681.092) [-1678.477] * (-1683.299) (-1677.511) (-1677.294) [-1679.210] -- 0:03:07

      Average standard deviation of split frequencies: 0.005952

      65500 -- (-1675.783) [-1681.310] (-1687.939) (-1680.443) * [-1683.670] (-1686.502) (-1674.708) (-1675.975) -- 0:03:05
      66000 -- (-1677.956) (-1684.721) (-1681.569) [-1683.178] * [-1680.002] (-1686.729) (-1699.992) (-1681.682) -- 0:03:03
      66500 -- (-1684.890) (-1680.452) [-1678.598] (-1681.054) * (-1678.197) (-1681.597) (-1691.169) [-1680.822] -- 0:03:02
      67000 -- (-1681.281) [-1678.333] (-1672.958) (-1677.014) * [-1673.766] (-1679.975) (-1690.078) (-1676.698) -- 0:03:01
      67500 -- (-1680.609) (-1687.937) [-1673.730] (-1671.791) * [-1680.423] (-1675.792) (-1681.182) (-1686.402) -- 0:02:59
      68000 -- (-1673.044) (-1680.063) [-1684.841] (-1677.556) * [-1682.172] (-1679.558) (-1681.437) (-1676.735) -- 0:02:58
      68500 -- [-1675.441] (-1680.803) (-1677.553) (-1676.272) * (-1680.855) (-1685.107) [-1685.325] (-1674.971) -- 0:02:56
      69000 -- (-1674.323) [-1678.290] (-1678.976) (-1680.038) * [-1681.934] (-1688.991) (-1677.511) (-1677.096) -- 0:02:55
      69500 -- (-1673.014) [-1677.012] (-1677.237) (-1678.374) * (-1672.377) (-1684.299) [-1676.037] (-1676.027) -- 0:02:54
      70000 -- (-1680.618) [-1678.085] (-1680.636) (-1682.937) *