--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Wed Nov 02 17:09:54 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/138/CG40498-PF/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1673.23 -1688.92 2 -1673.37 -1685.58 -------------------------------------- TOTAL -1673.30 -1688.26 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.190660 0.000783 0.140924 0.247460 0.188393 1413.45 1421.44 1.000 r(A<->C){all} 0.162236 0.002012 0.079987 0.252656 0.159264 792.69 852.70 1.000 r(A<->G){all} 0.219248 0.002299 0.123586 0.311306 0.216976 810.27 921.38 1.000 r(A<->T){all} 0.141515 0.001241 0.078625 0.210845 0.138640 980.96 1054.29 1.000 r(C<->G){all} 0.080594 0.001234 0.020637 0.151444 0.075934 709.48 758.09 1.000 r(C<->T){all} 0.321923 0.003292 0.211766 0.437870 0.320041 772.99 821.89 1.000 r(G<->T){all} 0.074484 0.000793 0.022586 0.128365 0.071487 840.37 973.50 1.000 pi(A){all} 0.303661 0.000243 0.272296 0.332785 0.303464 1135.61 1234.40 1.000 pi(C){all} 0.186293 0.000174 0.161011 0.212818 0.185683 1025.79 1102.18 1.000 pi(G){all} 0.231001 0.000210 0.202854 0.258815 0.230795 1369.51 1431.44 1.000 pi(T){all} 0.279045 0.000235 0.249413 0.308227 0.278883 964.48 1118.27 1.000 alpha{1,2} 0.080343 0.004599 0.000122 0.205071 0.065455 1436.12 1468.56 1.000 alpha{3} 1.664866 0.562131 0.440022 3.171361 1.519917 1357.56 1429.28 1.000 pinvar{all} 0.312698 0.019010 0.023165 0.540322 0.324277 1044.58 1171.10 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1612.34319 Model 2: PositiveSelection -1609.229767 Model 0: one-ratio -1619.591069 Model 3: discrete -1609.229767 Model 7: beta -1613.242351 Model 8: beta&w>1 -1609.254657 Model 0 vs 1 14.495758000000023 Model 2 vs 1 6.226846000000023 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.879 4.631 212 S 1.000** 5.254 252 L 0.889 4.681 259 L 0.878 4.624 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.759 3.433 +- 2.310 212 S 0.947 4.067 +- 2.183 252 L 0.770 3.496 +- 2.328 259 L 0.742 3.318 +- 2.253 Model 8 vs 7 7.975388000000294 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.870 4.605 212 S 1.000** 5.278 252 L 0.880 4.658 259 L 0.867 4.593 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.831 2.904 +- 1.917 212 S 0.980* 3.277 +- 1.766 252 L 0.835 2.926 +- 1.925 259 L 0.835 2.887 +- 1.882
>C1 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KLLLRRESLNDAISITRI >C2 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C3 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRREFLSDAISITRI >C4 MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C5 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C6 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK KQLLRRESTNDAINITRI >C7 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK KLLLRRESINDAINITRI CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 C1 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR C2 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR C3 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR C4 MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR C5 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR C6 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR C7 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR ****.******************************************:** C1 KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET C2 KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET C3 KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET C4 KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET C5 KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET C6 KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET C7 KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET ******:.**.*.************************************* C1 MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ C2 MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ C3 MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ C4 MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ C5 MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ C6 MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ C7 MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ ***::**************************:****************** C1 RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG C2 RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG C3 RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG C4 RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG C5 RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG C6 RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG C7 RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS ***************:********************* **********. C1 SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK C2 SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK C3 SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK C4 SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK C5 SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK C6 SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK C7 SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK *:***.**.** ******:**:********.:*****.******:***** C1 KLLLRRESLNDAISITRI C2 KQLLRRESLSDAISITRI C3 KQLLRREFLSDAISITRI C4 KQLLRRESLSDAISITRI C5 KQLLRRESLSDAISITRI C6 KQLLRRESTNDAINITRI C7 KLLLRRESINDAINITRI * ***** .***.**** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 268 type PROTEIN Struct Unchecked Input File /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 268 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11256] Library Relaxation: Multi_proc [72] Relaxation Summary: [11256]--->[11256] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/138/CG40498-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.400 Mb, Max= 30.791 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KLLLRRESLNDAISITRI >C2 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C3 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRREFLSDAISITRI >C4 MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C5 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C6 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK KQLLRRESTNDAINITRI >C7 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK KLLLRRESINDAINITRI FORMAT of file /tmp/tmp1402792299452565256aln Not Supported[FATAL:T-COFFEE] >C1 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KLLLRRESLNDAISITRI >C2 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C3 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRREFLSDAISITRI >C4 MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C5 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C6 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK KQLLRRESTNDAINITRI >C7 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK KLLLRRESINDAINITRI input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:268 S:100 BS:268 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # PW_SEQ_DISTANCES BOT 0 1 96.27 C1 C2 96.27 TOP 1 0 96.27 C2 C1 96.27 BOT 0 2 95.90 C1 C3 95.90 TOP 2 0 95.90 C3 C1 95.90 BOT 0 3 95.90 C1 C4 95.90 TOP 3 0 95.90 C4 C1 95.90 BOT 0 4 95.90 C1 C5 95.90 TOP 4 0 95.90 C5 C1 95.90 BOT 0 5 93.28 C1 C6 93.28 TOP 5 0 93.28 C6 C1 93.28 BOT 0 6 95.90 C1 C7 95.90 TOP 6 0 95.90 C7 C1 95.90 BOT 1 2 99.63 C2 C3 99.63 TOP 2 1 99.63 C3 C2 99.63 BOT 1 3 99.63 C2 C4 99.63 TOP 3 1 99.63 C4 C2 99.63 BOT 1 4 98.88 C2 C5 98.88 TOP 4 1 98.88 C5 C2 98.88 BOT 1 5 93.66 C2 C6 93.66 TOP 5 1 93.66 C6 C2 93.66 BOT 1 6 94.78 C2 C7 94.78 TOP 6 1 94.78 C7 C2 94.78 BOT 2 3 99.25 C3 C4 99.25 TOP 3 2 99.25 C4 C3 99.25 BOT 2 4 98.51 C3 C5 98.51 TOP 4 2 98.51 C5 C3 98.51 BOT 2 5 93.28 C3 C6 93.28 TOP 5 2 93.28 C6 C3 93.28 BOT 2 6 94.40 C3 C7 94.40 TOP 6 2 94.40 C7 C3 94.40 BOT 3 4 98.51 C4 C5 98.51 TOP 4 3 98.51 C5 C4 98.51 BOT 3 5 93.28 C4 C6 93.28 TOP 5 3 93.28 C6 C4 93.28 BOT 3 6 94.40 C4 C7 94.40 TOP 6 3 94.40 C7 C4 94.40 BOT 4 5 93.28 C5 C6 93.28 TOP 5 4 93.28 C6 C5 93.28 BOT 4 6 94.40 C5 C7 94.40 TOP 6 4 94.40 C7 C5 94.40 BOT 5 6 95.15 C6 C7 95.15 TOP 6 5 95.15 C7 C6 95.15 AVG 0 C1 * 95.52 AVG 1 C2 * 97.14 AVG 2 C3 * 96.83 AVG 3 C4 * 96.83 AVG 4 C5 * 96.58 AVG 5 C6 * 93.66 AVG 6 C7 * 94.84 TOT TOT * 95.91 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA C2 ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA C3 ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA C4 ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA C5 ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA C6 ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA C7 ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ********.** .********** ************************** C1 ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA C2 ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA C3 ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA C4 ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA C5 ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA C6 ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA C7 ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA ******:********.******** **.******** ************* C1 GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA C2 GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA C3 GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA C4 GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA C5 GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA C6 GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA C7 GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA *******.***** ************************** ****.*** C1 AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA C2 AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA C3 AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA C4 AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA C5 AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA C6 AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA C7 AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA ***** ***** ***** .** ******** * ***.* *********** C1 CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG C2 CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG C3 CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG C4 CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG C5 CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG C6 CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG C7 CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG ************************************************** C1 TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT C2 TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT C3 TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT C4 TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT C5 TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT C6 TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT C7 TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ************************* ************************ C1 ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC C2 ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC C3 ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC C4 ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC C5 ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC C6 ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC C7 ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC *********** ****************:**.**************:** C1 TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA C2 TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA C3 TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA C4 TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA C5 TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA C6 ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA C7 TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA :******** ******** ** *** ****************:.****** C1 ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA C2 ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA C3 ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA C4 ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA C5 ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA C6 ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA C7 ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA ************* *****.**************************.*** C1 CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA C2 CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA C3 CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA C4 CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA C5 CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA C6 CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA C7 CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA ************.*******.************************.**** C1 AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA C2 AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA C3 AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA C4 AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA C5 AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA C6 AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA C7 AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA *********************.*****:**.***** ***** ******* C1 AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC C2 AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC C3 AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC C4 AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC C5 AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC C6 AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC C7 AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT **** *******:**:.******************** ******** .* C1 TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA C2 TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA C3 TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA C4 TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA C5 TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA C6 TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA C7 TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA *** *:**.******:********.******* . ********* ***** C1 CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT C2 CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT C3 CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT C4 CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT C5 CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT C6 CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT C7 CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT *** :*******::**** *****************.****.:.****** C1 TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG C2 TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG C3 TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG C4 TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG C5 TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG C6 TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG C7 TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG ********** *.*** ***********.*****:*************** C1 AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG C2 AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG C3 AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG C4 AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG C5 AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG C6 AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG C7 AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG **.*:. * ************* *. .*.***********.***:**.** C1 TATT C2 TATT C3 TATT C4 TATT C5 TATT C6 TATT C7 TATT **** >C1 ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG TATT >C2 ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG TATT >C3 ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG TATT >C4 ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG TATT >C5 ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG TATT >C6 ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG TATT >C7 ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG TATT >C1 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KLLLRRESLNDAISITRI >C2 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C3 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRREFLSDAISITRI >C4 MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C5 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >C6 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK KQLLRRESTNDAINITRI >C7 MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK KLLLRRESINDAINITRI MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 7 taxa and 804 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1478106237 Setting output file names to "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 619042390 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 2045496021 Seed = 1860770178 Swapseed = 1478106237 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 21 unique site patterns Division 2 has 14 unique site patterns Division 3 has 38 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2423.900472 -- -24.557203 Chain 2 -- -2381.011885 -- -24.557203 Chain 3 -- -2317.534543 -- -24.557203 Chain 4 -- -2410.524264 -- -24.557203 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2423.900472 -- -24.557203 Chain 2 -- -2416.183483 -- -24.557203 Chain 3 -- -2410.524327 -- -24.557203 Chain 4 -- -2375.891749 -- -24.557203 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2423.900] (-2381.012) (-2317.535) (-2410.524) * [-2423.900] (-2416.183) (-2410.524) (-2375.892) 500 -- (-1690.169) (-1693.099) [-1692.318] (-1692.826) * (-1704.916) [-1691.809] (-1696.196) (-1688.288) -- 0:00:00 1000 -- (-1689.155) [-1682.541] (-1679.018) (-1686.456) * (-1685.467) (-1687.206) [-1679.394] (-1683.853) -- 0:00:00 1500 -- (-1689.876) [-1679.538] (-1686.718) (-1687.259) * (-1684.965) [-1685.375] (-1677.990) (-1685.695) -- 0:00:00 2000 -- (-1694.491) (-1684.160) (-1683.976) [-1688.049] * (-1682.427) [-1679.253] (-1686.192) (-1687.461) -- 0:08:19 2500 -- (-1683.737) (-1680.216) (-1678.184) [-1682.908] * (-1678.061) [-1684.388] (-1686.099) (-1683.148) -- 0:06:39 3000 -- (-1686.924) (-1675.790) (-1673.744) [-1675.310] * (-1685.018) (-1676.693) (-1686.506) [-1683.512] -- 0:05:32 3500 -- (-1680.196) (-1681.731) [-1678.826] (-1675.606) * (-1679.785) [-1678.203] (-1686.251) (-1685.884) -- 0:04:44 4000 -- (-1681.182) [-1687.247] (-1679.675) (-1672.742) * [-1687.363] (-1671.713) (-1681.274) (-1679.532) -- 0:04:09 4500 -- (-1676.985) (-1682.560) (-1686.222) [-1673.876] * (-1679.156) (-1677.285) [-1684.438] (-1681.650) -- 0:03:41 5000 -- (-1679.478) (-1688.027) [-1675.832] (-1681.668) * (-1683.760) (-1674.203) (-1682.863) [-1680.832] -- 0:03:19 Average standard deviation of split frequencies: 0.052378 5500 -- (-1675.219) (-1691.958) (-1677.545) [-1675.171] * (-1682.524) (-1679.277) [-1687.920] (-1678.471) -- 0:03:00 6000 -- [-1683.030] (-1681.999) (-1673.760) (-1683.832) * (-1678.747) (-1677.301) [-1682.335] (-1681.612) -- 0:02:45 6500 -- [-1672.444] (-1675.775) (-1679.588) (-1680.515) * (-1679.960) (-1679.004) [-1681.051] (-1679.964) -- 0:05:05 7000 -- (-1674.703) (-1676.282) (-1680.767) [-1675.082] * (-1675.639) [-1672.919] (-1677.852) (-1682.708) -- 0:04:43 7500 -- (-1677.366) (-1679.403) (-1675.719) [-1677.768] * (-1675.126) [-1679.860] (-1671.186) (-1679.506) -- 0:04:24 8000 -- [-1678.339] (-1678.574) (-1682.882) (-1678.365) * (-1670.839) (-1675.765) [-1672.848] (-1691.520) -- 0:04:08 8500 -- [-1674.899] (-1675.436) (-1680.067) (-1673.640) * [-1675.542] (-1684.758) (-1681.649) (-1687.839) -- 0:03:53 9000 -- (-1678.886) (-1687.801) (-1682.250) [-1679.657] * (-1679.101) (-1685.274) (-1680.650) [-1677.188] -- 0:03:40 9500 -- (-1676.256) (-1676.483) (-1677.602) [-1675.947] * (-1696.064) (-1686.765) [-1679.705] (-1694.063) -- 0:03:28 10000 -- [-1680.339] (-1681.274) (-1680.469) (-1688.216) * (-1673.908) (-1694.542) (-1682.525) [-1680.047] -- 0:03:18 Average standard deviation of split frequencies: 0.058926 10500 -- [-1676.482] (-1685.171) (-1683.131) (-1676.905) * (-1676.468) (-1684.247) [-1677.631] (-1683.216) -- 0:03:08 11000 -- [-1679.471] (-1688.341) (-1682.697) (-1677.945) * (-1673.718) (-1685.897) (-1674.877) [-1680.890] -- 0:04:29 11500 -- [-1677.753] (-1679.272) (-1683.811) (-1677.240) * [-1673.358] (-1677.512) (-1676.636) (-1685.879) -- 0:04:17 12000 -- [-1679.056] (-1677.499) (-1676.755) (-1683.071) * (-1684.192) (-1680.851) (-1680.450) [-1674.565] -- 0:04:07 12500 -- [-1675.383] (-1675.517) (-1682.252) (-1683.258) * (-1677.683) (-1674.493) (-1685.513) [-1671.562] -- 0:03:57 13000 -- (-1679.142) (-1679.907) (-1686.587) [-1677.040] * (-1677.347) [-1673.110] (-1683.334) (-1674.535) -- 0:03:47 13500 -- [-1678.246] (-1690.009) (-1681.080) (-1675.392) * (-1678.718) (-1678.227) [-1676.514] (-1675.812) -- 0:03:39 14000 -- (-1679.754) (-1691.494) [-1675.768] (-1683.041) * (-1681.743) (-1689.791) (-1678.838) [-1676.602] -- 0:03:31 14500 -- (-1678.127) (-1682.408) (-1687.128) [-1676.620] * (-1677.236) (-1679.351) [-1685.814] (-1680.672) -- 0:03:23 15000 -- [-1676.027] (-1675.956) (-1674.511) (-1680.035) * (-1675.549) (-1677.254) [-1679.414] (-1673.919) -- 0:03:17 Average standard deviation of split frequencies: 0.039284 15500 -- (-1677.443) (-1691.651) [-1679.686] (-1676.998) * [-1673.827] (-1682.299) (-1679.995) (-1675.244) -- 0:04:14 16000 -- (-1682.723) [-1679.605] (-1675.679) (-1680.160) * (-1682.719) [-1675.814] (-1678.211) (-1678.762) -- 0:04:06 16500 -- (-1679.163) (-1683.176) (-1679.299) [-1673.964] * (-1673.675) (-1675.472) (-1672.865) [-1677.358] -- 0:03:58 17000 -- (-1680.664) (-1685.315) [-1674.602] (-1679.934) * [-1676.393] (-1678.990) (-1681.494) (-1676.805) -- 0:03:51 17500 -- (-1674.055) (-1687.191) (-1682.941) [-1677.685] * (-1677.292) [-1678.351] (-1683.579) (-1675.961) -- 0:03:44 18000 -- (-1677.542) (-1682.000) (-1679.188) [-1673.659] * (-1683.175) [-1672.567] (-1686.256) (-1678.729) -- 0:03:38 18500 -- (-1671.230) (-1682.763) [-1681.723] (-1677.113) * (-1675.253) [-1675.149] (-1684.581) (-1676.560) -- 0:03:32 19000 -- (-1679.335) (-1690.943) (-1683.649) [-1678.075] * [-1675.503] (-1680.902) (-1680.228) (-1675.091) -- 0:03:26 19500 -- [-1675.620] (-1683.270) (-1681.739) (-1684.409) * (-1672.680) (-1688.805) [-1673.650] (-1678.799) -- 0:03:21 20000 -- (-1674.478) (-1678.539) [-1677.871] (-1680.811) * [-1673.089] (-1683.777) (-1681.106) (-1676.833) -- 0:04:05 Average standard deviation of split frequencies: 0.038016 20500 -- (-1685.240) [-1682.600] (-1677.680) (-1686.531) * (-1677.235) (-1682.024) [-1676.963] (-1681.588) -- 0:03:58 21000 -- (-1684.197) (-1680.117) (-1688.067) [-1679.814] * (-1679.566) [-1674.447] (-1679.036) (-1679.674) -- 0:03:53 21500 -- (-1682.811) [-1675.535] (-1687.435) (-1686.167) * (-1682.692) (-1682.277) (-1670.986) [-1684.404] -- 0:03:47 22000 -- (-1685.566) [-1676.776] (-1679.263) (-1679.235) * (-1672.019) [-1684.593] (-1676.786) (-1682.100) -- 0:03:42 22500 -- (-1681.259) (-1682.271) (-1682.716) [-1681.174] * (-1673.689) (-1680.227) [-1678.284] (-1677.597) -- 0:03:37 23000 -- (-1674.370) (-1680.026) (-1676.121) [-1685.098] * (-1682.002) (-1678.530) (-1690.059) [-1672.978] -- 0:03:32 23500 -- (-1673.038) (-1679.044) [-1676.533] (-1683.484) * (-1679.129) (-1678.157) (-1682.926) [-1672.673] -- 0:03:27 24000 -- [-1681.063] (-1673.230) (-1675.358) (-1686.521) * [-1680.540] (-1679.891) (-1675.952) (-1681.938) -- 0:04:04 24500 -- (-1677.872) [-1681.630] (-1674.948) (-1682.426) * [-1681.770] (-1680.114) (-1681.862) (-1672.700) -- 0:03:58 25000 -- (-1687.887) (-1681.801) [-1673.876] (-1677.941) * (-1674.783) [-1684.231] (-1681.601) (-1687.550) -- 0:03:54 Average standard deviation of split frequencies: 0.018131 25500 -- [-1681.346] (-1676.452) (-1676.851) (-1687.308) * (-1680.182) (-1675.640) [-1673.948] (-1675.279) -- 0:03:49 26000 -- [-1674.841] (-1683.510) (-1681.436) (-1675.538) * (-1678.898) (-1679.500) (-1676.627) [-1674.215] -- 0:03:44 26500 -- (-1679.090) [-1677.269] (-1684.169) (-1676.814) * (-1676.342) (-1684.228) [-1672.703] (-1687.554) -- 0:03:40 27000 -- [-1678.057] (-1680.621) (-1681.728) (-1683.589) * (-1678.207) [-1679.635] (-1677.784) (-1680.913) -- 0:03:36 27500 -- (-1675.467) (-1678.405) (-1683.817) [-1679.940] * (-1682.712) (-1683.418) [-1673.311] (-1672.348) -- 0:03:32 28000 -- [-1678.153] (-1691.688) (-1675.952) (-1678.230) * (-1673.755) (-1686.195) [-1675.092] (-1673.839) -- 0:03:28 28500 -- [-1684.845] (-1686.911) (-1672.605) (-1678.077) * [-1673.410] (-1683.345) (-1683.707) (-1680.400) -- 0:03:58 29000 -- (-1677.993) [-1683.787] (-1674.386) (-1676.041) * [-1676.174] (-1684.548) (-1685.362) (-1679.891) -- 0:03:54 29500 -- (-1675.682) (-1675.937) (-1676.444) [-1677.830] * (-1679.748) (-1684.341) (-1680.061) [-1674.126] -- 0:03:50 30000 -- (-1679.071) (-1680.596) [-1676.839] (-1672.259) * (-1673.250) (-1679.162) [-1682.512] (-1680.709) -- 0:03:46 Average standard deviation of split frequencies: 0.010248 30500 -- [-1674.695] (-1676.535) (-1684.483) (-1677.966) * (-1676.899) [-1676.235] (-1682.007) (-1692.467) -- 0:03:42 31000 -- (-1676.176) (-1685.308) [-1675.890] (-1676.939) * [-1689.467] (-1678.509) (-1679.833) (-1683.075) -- 0:03:38 31500 -- [-1674.725] (-1677.527) (-1688.987) (-1675.968) * [-1675.427] (-1675.689) (-1685.290) (-1683.969) -- 0:03:35 32000 -- (-1677.232) (-1682.783) [-1676.823] (-1682.656) * [-1674.305] (-1686.816) (-1676.837) (-1680.638) -- 0:03:31 32500 -- [-1678.310] (-1688.032) (-1681.918) (-1677.221) * [-1678.083] (-1679.894) (-1680.718) (-1684.977) -- 0:03:28 33000 -- (-1676.871) (-1682.041) [-1675.034] (-1689.080) * (-1675.848) (-1694.931) [-1675.427] (-1685.143) -- 0:03:25 33500 -- (-1672.823) (-1683.684) (-1673.290) [-1674.303] * (-1676.054) (-1679.887) [-1677.979] (-1685.109) -- 0:03:50 34000 -- (-1675.308) [-1675.438] (-1679.062) (-1677.158) * [-1679.205] (-1682.656) (-1674.466) (-1684.920) -- 0:03:47 34500 -- (-1680.981) [-1679.264] (-1684.425) (-1678.810) * (-1676.443) [-1682.082] (-1673.416) (-1681.069) -- 0:03:43 35000 -- (-1676.100) [-1678.091] (-1683.424) (-1676.648) * (-1672.851) (-1677.145) [-1680.592] (-1673.712) -- 0:03:40 Average standard deviation of split frequencies: 0.026189 35500 -- (-1686.941) (-1685.970) [-1673.947] (-1677.479) * (-1687.255) (-1680.214) (-1679.908) [-1673.356] -- 0:03:37 36000 -- [-1677.550] (-1677.394) (-1679.157) (-1672.927) * (-1675.935) (-1678.135) (-1680.805) [-1672.022] -- 0:03:34 36500 -- (-1679.131) (-1676.650) [-1677.811] (-1677.598) * (-1675.580) (-1673.753) (-1676.664) [-1672.176] -- 0:03:31 37000 -- (-1683.983) [-1682.065] (-1682.826) (-1683.598) * [-1682.002] (-1672.352) (-1676.626) (-1679.069) -- 0:03:28 37500 -- [-1678.045] (-1687.425) (-1677.567) (-1672.981) * (-1682.701) [-1679.616] (-1677.800) (-1680.071) -- 0:03:25 38000 -- [-1672.352] (-1682.041) (-1688.641) (-1675.942) * (-1679.197) (-1675.527) (-1681.882) [-1688.486] -- 0:03:47 38500 -- (-1676.267) [-1673.064] (-1679.127) (-1681.223) * (-1681.149) [-1673.836] (-1683.594) (-1683.281) -- 0:03:44 39000 -- (-1683.186) [-1673.780] (-1672.955) (-1681.755) * (-1676.585) (-1675.504) (-1688.560) [-1683.451] -- 0:03:41 39500 -- (-1682.936) (-1677.305) (-1683.110) [-1674.140] * (-1674.438) [-1676.462] (-1679.348) (-1687.760) -- 0:03:38 40000 -- (-1681.247) [-1681.403] (-1677.951) (-1685.493) * (-1673.289) [-1675.798] (-1685.660) (-1674.976) -- 0:03:36 Average standard deviation of split frequencies: 0.030912 40500 -- [-1677.933] (-1679.508) (-1675.686) (-1678.821) * [-1673.486] (-1678.109) (-1679.834) (-1676.894) -- 0:03:33 41000 -- [-1684.941] (-1679.394) (-1678.800) (-1679.755) * (-1678.899) (-1675.934) [-1676.527] (-1677.474) -- 0:03:30 41500 -- (-1682.230) (-1681.317) (-1690.776) [-1678.322] * [-1678.121] (-1682.737) (-1676.009) (-1678.552) -- 0:03:27 42000 -- (-1679.070) [-1670.037] (-1680.079) (-1680.310) * (-1678.741) (-1677.425) (-1678.586) [-1685.125] -- 0:03:25 42500 -- [-1677.870] (-1674.445) (-1681.581) (-1688.840) * (-1676.216) [-1685.313] (-1682.952) (-1686.326) -- 0:03:45 43000 -- [-1676.309] (-1687.264) (-1681.693) (-1682.195) * (-1681.060) [-1672.684] (-1681.123) (-1674.717) -- 0:03:42 43500 -- (-1679.399) (-1680.674) [-1685.294] (-1676.963) * [-1672.774] (-1681.082) (-1681.782) (-1674.583) -- 0:03:39 44000 -- (-1676.070) [-1681.260] (-1685.348) (-1674.685) * (-1686.005) [-1677.353] (-1683.782) (-1682.919) -- 0:03:37 44500 -- (-1681.247) (-1691.052) (-1689.873) [-1677.904] * (-1676.212) (-1689.872) (-1679.819) [-1677.224] -- 0:03:34 45000 -- (-1676.890) (-1678.539) (-1685.234) [-1676.340] * [-1673.717] (-1685.563) (-1680.130) (-1676.320) -- 0:03:32 Average standard deviation of split frequencies: 0.034160 45500 -- (-1676.024) (-1679.802) (-1674.636) [-1681.557] * (-1680.049) (-1678.237) [-1679.490] (-1677.325) -- 0:03:29 46000 -- (-1677.787) (-1685.709) (-1680.943) [-1678.544] * (-1681.619) [-1685.494] (-1681.548) (-1680.567) -- 0:03:27 46500 -- (-1680.348) [-1675.869] (-1675.941) (-1676.225) * (-1679.381) (-1674.530) (-1676.333) [-1680.109] -- 0:03:45 47000 -- (-1684.607) [-1675.823] (-1680.281) (-1672.854) * (-1680.359) [-1681.091] (-1674.559) (-1678.305) -- 0:03:43 47500 -- (-1684.471) (-1677.799) [-1675.565] (-1684.799) * [-1681.475] (-1679.722) (-1684.616) (-1681.013) -- 0:03:40 48000 -- (-1681.043) (-1680.894) (-1678.526) [-1671.619] * (-1675.491) (-1677.651) [-1682.096] (-1677.870) -- 0:03:38 48500 -- (-1677.847) (-1673.582) [-1679.775] (-1676.884) * (-1686.668) [-1674.395] (-1677.355) (-1681.831) -- 0:03:35 49000 -- [-1674.972] (-1680.455) (-1682.074) (-1679.134) * (-1675.886) (-1678.579) [-1676.334] (-1676.040) -- 0:03:33 49500 -- (-1672.670) [-1674.779] (-1680.830) (-1678.073) * (-1676.816) (-1678.001) (-1678.813) [-1675.438] -- 0:03:31 50000 -- (-1675.606) (-1673.649) (-1683.138) [-1674.254] * [-1674.105] (-1673.010) (-1679.935) (-1686.672) -- 0:03:29 Average standard deviation of split frequencies: 0.037216 50500 -- (-1683.677) (-1686.187) (-1684.800) [-1674.024] * [-1678.723] (-1685.453) (-1673.871) (-1680.539) -- 0:03:26 51000 -- (-1680.078) (-1676.874) [-1676.631] (-1679.767) * (-1682.450) (-1674.293) [-1672.454] (-1682.246) -- 0:03:24 51500 -- (-1678.528) [-1681.696] (-1681.194) (-1675.083) * (-1675.350) (-1678.469) (-1673.072) [-1678.024] -- 0:03:41 52000 -- (-1680.268) (-1683.690) (-1681.158) [-1671.682] * (-1681.619) (-1680.984) [-1673.718] (-1678.351) -- 0:03:38 52500 -- (-1675.828) (-1682.209) (-1682.342) [-1674.085] * (-1689.366) (-1673.293) (-1690.973) [-1676.802] -- 0:03:36 53000 -- (-1681.340) [-1680.810] (-1676.158) (-1680.281) * (-1679.482) [-1676.971] (-1678.023) (-1674.505) -- 0:03:34 53500 -- [-1676.156] (-1682.525) (-1673.069) (-1687.886) * (-1686.075) (-1680.126) [-1675.653] (-1679.309) -- 0:03:32 54000 -- (-1673.764) [-1672.662] (-1673.140) (-1679.290) * (-1673.053) [-1674.774] (-1681.951) (-1673.895) -- 0:03:30 54500 -- (-1677.576) [-1669.729] (-1680.778) (-1680.004) * [-1674.505] (-1685.555) (-1677.438) (-1680.324) -- 0:03:28 55000 -- (-1683.430) (-1677.364) [-1680.497] (-1682.357) * (-1674.327) (-1676.586) [-1681.702] (-1690.406) -- 0:03:26 Average standard deviation of split frequencies: 0.039284 55500 -- (-1684.381) (-1688.647) [-1671.602] (-1673.558) * [-1677.200] (-1675.742) (-1679.940) (-1687.570) -- 0:03:24 56000 -- (-1689.342) (-1682.602) (-1678.246) [-1671.991] * (-1682.163) (-1674.100) [-1677.176] (-1680.454) -- 0:03:39 56500 -- (-1681.584) (-1683.484) [-1675.725] (-1673.368) * [-1672.841] (-1679.504) (-1697.758) (-1674.427) -- 0:03:37 57000 -- (-1678.268) (-1684.862) (-1678.776) [-1679.464] * (-1686.721) (-1676.177) (-1680.130) [-1671.595] -- 0:03:35 57500 -- (-1687.226) (-1673.741) (-1680.175) [-1674.003] * (-1677.375) (-1679.970) [-1674.457] (-1684.082) -- 0:03:33 58000 -- (-1677.385) (-1674.252) [-1677.482] (-1673.022) * (-1679.594) [-1676.727] (-1676.926) (-1679.570) -- 0:03:31 58500 -- (-1673.127) (-1676.576) [-1677.923] (-1673.372) * (-1680.943) (-1674.719) [-1676.640] (-1685.263) -- 0:03:29 59000 -- [-1680.168] (-1673.388) (-1682.296) (-1674.822) * (-1677.962) (-1678.712) [-1682.068] (-1691.796) -- 0:03:27 59500 -- (-1683.985) (-1682.394) (-1676.255) [-1673.283] * (-1679.200) (-1680.480) [-1676.343] (-1686.702) -- 0:03:25 60000 -- (-1683.064) (-1674.726) (-1674.189) [-1672.621] * [-1672.417] (-1679.801) (-1675.170) (-1679.030) -- 0:03:39 Average standard deviation of split frequencies: 0.033672 60500 -- (-1676.171) [-1683.915] (-1679.239) (-1682.343) * (-1674.290) (-1673.172) [-1673.437] (-1688.963) -- 0:03:37 61000 -- (-1675.779) [-1681.760] (-1676.334) (-1687.076) * (-1671.513) [-1675.028] (-1674.389) (-1693.246) -- 0:03:35 61500 -- (-1673.352) [-1678.897] (-1681.706) (-1678.873) * (-1677.679) [-1677.672] (-1684.556) (-1686.254) -- 0:03:33 62000 -- (-1680.254) [-1676.407] (-1681.298) (-1675.017) * [-1678.956] (-1682.858) (-1682.412) (-1683.287) -- 0:03:31 62500 -- [-1674.986] (-1689.540) (-1682.632) (-1677.475) * [-1680.653] (-1677.475) (-1687.918) (-1676.691) -- 0:03:30 63000 -- [-1674.040] (-1676.526) (-1682.779) (-1674.688) * (-1690.054) [-1672.130] (-1682.542) (-1682.938) -- 0:03:28 63500 -- [-1675.841] (-1684.147) (-1677.655) (-1677.716) * (-1685.502) (-1681.020) [-1677.690] (-1683.986) -- 0:03:26 64000 -- (-1681.111) (-1678.774) [-1686.631] (-1670.232) * (-1696.638) (-1675.525) (-1683.277) [-1684.462] -- 0:03:24 64500 -- (-1676.056) (-1699.667) [-1683.352] (-1675.991) * [-1677.401] (-1679.219) (-1680.941) (-1687.870) -- 0:03:37 65000 -- [-1678.309] (-1693.810) (-1678.587) (-1679.745) * (-1677.313) [-1675.888] (-1681.107) (-1680.611) -- 0:03:35 Average standard deviation of split frequencies: 0.035712 65500 -- [-1679.263] (-1683.593) (-1673.984) (-1680.395) * (-1676.887) [-1675.587] (-1673.336) (-1678.935) -- 0:03:34 66000 -- [-1671.988] (-1673.965) (-1677.156) (-1675.063) * (-1686.774) (-1680.517) (-1680.972) [-1676.776] -- 0:03:32 66500 -- (-1679.755) (-1686.548) [-1673.233] (-1679.376) * (-1685.235) [-1675.383] (-1677.943) (-1679.322) -- 0:03:30 67000 -- [-1678.368] (-1696.306) (-1677.363) (-1675.195) * [-1681.138] (-1687.774) (-1685.251) (-1682.301) -- 0:03:28 67500 -- (-1676.612) [-1677.077] (-1671.681) (-1678.799) * [-1676.141] (-1680.257) (-1684.330) (-1675.173) -- 0:03:27 68000 -- (-1685.171) [-1682.646] (-1680.224) (-1676.198) * (-1678.485) (-1678.188) [-1682.201] (-1678.964) -- 0:03:25 68500 -- (-1677.819) (-1678.143) (-1690.936) [-1675.002] * [-1682.193] (-1674.295) (-1681.189) (-1676.663) -- 0:03:23 69000 -- (-1678.724) [-1679.902] (-1682.387) (-1675.883) * [-1676.992] (-1684.897) (-1681.740) (-1682.090) -- 0:03:35 69500 -- (-1686.774) [-1675.296] (-1671.187) (-1672.617) * (-1680.222) (-1685.246) (-1683.342) [-1679.945] -- 0:03:34 70000 -- (-1681.686) (-1674.877) (-1678.067) [-1673.781] * (-1675.891) (-1682.982) [-1676.207] (-1682.294) -- 0:03:32 Average standard deviation of split frequencies: 0.026683 70500 -- (-1685.526) (-1678.492) (-1675.554) [-1671.515] * [-1679.656] (-1682.524) (-1679.189) (-1689.772) -- 0:03:30 71000 -- [-1685.620] (-1675.745) (-1675.136) (-1672.565) * (-1686.037) [-1681.282] (-1676.011) (-1681.715) -- 0:03:29 71500 -- (-1693.634) (-1679.558) [-1680.099] (-1678.223) * (-1676.608) (-1681.490) [-1671.080] (-1676.550) -- 0:03:27 72000 -- (-1680.934) (-1677.839) [-1677.291] (-1681.873) * [-1673.794] (-1681.916) (-1677.662) (-1679.281) -- 0:03:26 72500 -- (-1687.493) (-1677.937) [-1676.131] (-1675.691) * (-1682.133) (-1681.176) (-1684.312) [-1674.046] -- 0:03:24 73000 -- (-1686.083) (-1673.499) [-1676.310] (-1684.898) * (-1675.453) (-1678.162) (-1680.046) [-1681.073] -- 0:03:23 73500 -- [-1685.659] (-1686.857) (-1678.288) (-1676.213) * [-1677.882] (-1682.700) (-1679.872) (-1682.165) -- 0:03:34 74000 -- (-1685.600) (-1680.422) (-1682.936) [-1674.848] * [-1674.259] (-1690.164) (-1682.347) (-1681.824) -- 0:03:32 74500 -- (-1684.432) (-1681.097) (-1692.734) [-1677.973] * (-1678.588) [-1676.258] (-1686.380) (-1680.213) -- 0:03:31 75000 -- (-1680.309) (-1675.964) [-1676.953] (-1683.210) * (-1673.574) (-1674.652) (-1675.638) [-1673.348] -- 0:03:29 Average standard deviation of split frequencies: 0.026878 75500 -- (-1682.561) (-1684.811) (-1674.088) [-1679.411] * [-1677.503] (-1679.334) (-1685.084) (-1680.570) -- 0:03:28 76000 -- (-1689.398) (-1679.852) [-1678.019] (-1676.141) * (-1670.795) (-1687.295) (-1690.046) [-1676.522] -- 0:03:26 76500 -- (-1682.591) (-1679.237) (-1692.934) [-1674.830] * (-1676.613) (-1674.487) (-1685.941) [-1680.911] -- 0:03:25 77000 -- (-1680.214) [-1675.537] (-1680.634) (-1682.220) * (-1673.972) (-1678.904) [-1680.984] (-1700.773) -- 0:03:23 77500 -- (-1672.767) [-1680.362] (-1679.891) (-1674.367) * (-1679.206) [-1680.889] (-1674.229) (-1682.495) -- 0:03:34 78000 -- [-1674.470] (-1684.620) (-1675.505) (-1680.858) * (-1676.155) (-1675.912) (-1680.437) [-1677.417] -- 0:03:32 78500 -- [-1671.439] (-1673.578) (-1674.578) (-1675.096) * [-1671.478] (-1674.700) (-1676.598) (-1677.061) -- 0:03:31 79000 -- (-1676.223) [-1675.510] (-1677.427) (-1683.777) * (-1677.539) (-1676.764) (-1679.614) [-1676.991] -- 0:03:29 79500 -- (-1674.936) [-1680.889] (-1676.447) (-1681.776) * (-1676.673) [-1674.161] (-1674.247) (-1672.276) -- 0:03:28 80000 -- (-1672.462) [-1682.252] (-1675.432) (-1677.412) * (-1678.876) (-1677.253) (-1675.353) [-1676.803] -- 0:03:27 Average standard deviation of split frequencies: 0.025323 80500 -- [-1680.458] (-1685.359) (-1675.361) (-1676.396) * (-1678.217) (-1674.116) [-1671.233] (-1675.386) -- 0:03:25 81000 -- (-1679.194) (-1680.374) [-1675.841] (-1681.953) * [-1678.153] (-1677.037) (-1673.856) (-1677.651) -- 0:03:24 81500 -- (-1674.912) (-1675.186) (-1681.025) [-1673.630] * (-1676.338) (-1690.081) [-1678.904] (-1679.328) -- 0:03:22 82000 -- [-1682.232] (-1674.205) (-1683.479) (-1681.345) * (-1683.202) (-1685.056) (-1681.594) [-1685.387] -- 0:03:32 82500 -- (-1683.587) (-1680.054) [-1674.478] (-1679.908) * (-1677.044) (-1675.429) [-1676.322] (-1683.643) -- 0:03:31 83000 -- (-1686.446) (-1681.732) (-1688.780) [-1681.489] * (-1678.716) (-1690.859) [-1675.862] (-1675.428) -- 0:03:29 83500 -- (-1682.309) (-1676.228) [-1677.345] (-1676.661) * (-1676.584) [-1675.460] (-1684.264) (-1679.121) -- 0:03:28 84000 -- [-1676.926] (-1675.993) (-1671.921) (-1673.926) * (-1676.656) [-1686.292] (-1676.522) (-1677.246) -- 0:03:27 84500 -- (-1682.319) [-1673.506] (-1677.192) (-1680.821) * [-1676.389] (-1680.087) (-1675.978) (-1679.046) -- 0:03:25 85000 -- [-1676.075] (-1675.610) (-1674.584) (-1674.713) * [-1677.439] (-1686.542) (-1678.167) (-1682.514) -- 0:03:24 Average standard deviation of split frequencies: 0.027407 85500 -- (-1681.338) (-1686.374) [-1674.685] (-1680.318) * [-1674.317] (-1680.301) (-1672.666) (-1676.908) -- 0:03:23 86000 -- [-1687.577] (-1676.770) (-1680.443) (-1673.880) * (-1676.221) (-1673.597) (-1681.431) [-1675.626] -- 0:03:32 86500 -- [-1682.486] (-1673.889) (-1677.541) (-1677.158) * (-1675.285) (-1683.340) [-1679.738] (-1677.930) -- 0:03:31 87000 -- (-1683.323) (-1681.820) [-1674.762] (-1681.375) * (-1678.269) [-1679.773] (-1684.111) (-1676.245) -- 0:03:29 87500 -- (-1670.319) (-1684.014) (-1670.090) [-1676.760] * [-1677.397] (-1673.516) (-1681.408) (-1679.114) -- 0:03:28 88000 -- [-1676.547] (-1689.091) (-1678.134) (-1680.545) * [-1673.723] (-1679.394) (-1677.889) (-1678.356) -- 0:03:27 88500 -- (-1673.399) (-1678.594) (-1674.154) [-1677.236] * (-1675.318) (-1678.394) (-1688.554) [-1680.110] -- 0:03:25 89000 -- (-1675.749) [-1678.557] (-1679.687) (-1679.338) * (-1679.046) (-1676.949) [-1672.805] (-1673.336) -- 0:03:24 89500 -- (-1682.137) (-1688.127) [-1678.409] (-1682.153) * (-1674.929) (-1682.848) (-1677.566) [-1680.009] -- 0:03:23 90000 -- [-1673.987] (-1688.787) (-1678.688) (-1676.772) * (-1676.829) (-1677.262) [-1675.929] (-1690.643) -- 0:03:22 Average standard deviation of split frequencies: 0.025130 90500 -- (-1675.420) (-1680.714) [-1677.239] (-1680.272) * (-1676.815) [-1671.664] (-1682.258) (-1677.904) -- 0:03:31 91000 -- (-1677.976) [-1674.637] (-1684.633) (-1682.570) * (-1682.465) (-1671.498) [-1672.584] (-1673.464) -- 0:03:29 91500 -- [-1674.587] (-1672.042) (-1686.536) (-1673.336) * [-1677.828] (-1674.268) (-1675.543) (-1675.333) -- 0:03:28 92000 -- (-1675.803) [-1675.682] (-1678.616) (-1674.157) * (-1685.088) [-1677.751] (-1674.124) (-1673.036) -- 0:03:27 92500 -- (-1679.145) [-1674.703] (-1673.955) (-1681.013) * [-1680.053] (-1680.892) (-1672.528) (-1676.151) -- 0:03:26 93000 -- [-1674.194] (-1684.383) (-1678.646) (-1684.310) * (-1681.478) (-1677.324) (-1675.399) [-1674.652] -- 0:03:24 93500 -- (-1681.635) [-1676.019] (-1682.946) (-1695.066) * (-1680.055) (-1675.188) [-1673.966] (-1689.493) -- 0:03:23 94000 -- (-1690.918) [-1673.458] (-1678.348) (-1680.635) * (-1672.433) [-1682.051] (-1676.820) (-1678.373) -- 0:03:22 94500 -- (-1675.913) (-1677.187) (-1675.551) [-1679.020] * (-1683.727) (-1681.673) (-1678.392) [-1676.697] -- 0:03:21 95000 -- (-1689.528) [-1672.635] (-1681.078) (-1672.979) * (-1677.427) (-1677.430) [-1676.683] (-1681.330) -- 0:03:29 Average standard deviation of split frequencies: 0.027008 95500 -- (-1683.521) [-1679.642] (-1678.671) (-1679.353) * (-1681.939) (-1675.254) (-1683.794) [-1681.757] -- 0:03:28 96000 -- (-1680.015) [-1675.236] (-1677.150) (-1678.255) * [-1677.501] (-1682.252) (-1681.728) (-1679.806) -- 0:03:27 96500 -- (-1679.371) (-1677.120) [-1673.270] (-1680.415) * (-1672.584) (-1683.102) [-1679.657] (-1674.742) -- 0:03:25 97000 -- (-1673.882) [-1680.629] (-1680.617) (-1680.566) * (-1674.635) (-1680.060) [-1674.559] (-1679.717) -- 0:03:24 97500 -- (-1673.069) (-1678.174) (-1685.438) [-1677.226] * (-1678.904) (-1674.077) [-1675.740] (-1680.731) -- 0:03:23 98000 -- (-1683.972) (-1679.791) [-1683.414] (-1677.733) * (-1674.588) [-1675.517] (-1674.289) (-1675.233) -- 0:03:22 98500 -- (-1680.486) (-1679.653) (-1680.597) [-1677.291] * (-1678.747) [-1675.791] (-1675.284) (-1674.951) -- 0:03:21 99000 -- (-1679.006) [-1678.612] (-1683.228) (-1683.638) * [-1676.620] (-1674.379) (-1675.827) (-1678.233) -- 0:03:20 99500 -- (-1681.769) [-1676.170] (-1682.929) (-1675.415) * (-1683.553) (-1676.473) (-1676.795) [-1674.002] -- 0:03:28 100000 -- (-1681.377) [-1676.061] (-1689.125) (-1684.504) * [-1674.378] (-1676.567) (-1686.415) (-1681.543) -- 0:03:27 Average standard deviation of split frequencies: 0.024195 100500 -- (-1690.792) (-1677.138) [-1682.484] (-1676.257) * [-1677.500] (-1681.277) (-1685.672) (-1676.493) -- 0:03:25 101000 -- (-1690.415) [-1680.632] (-1682.582) (-1681.800) * (-1682.519) (-1680.932) [-1674.772] (-1673.902) -- 0:03:24 101500 -- (-1683.574) [-1681.752] (-1686.704) (-1680.165) * (-1677.368) (-1686.095) [-1679.280] (-1678.969) -- 0:03:23 102000 -- (-1691.223) (-1675.994) (-1684.408) [-1676.682] * [-1677.828] (-1683.437) (-1680.459) (-1683.617) -- 0:03:22 102500 -- (-1678.689) (-1685.936) [-1680.978] (-1674.863) * (-1687.897) [-1677.287] (-1681.636) (-1680.312) -- 0:03:21 103000 -- (-1681.395) (-1678.572) [-1685.858] (-1681.432) * [-1676.604] (-1675.568) (-1683.323) (-1680.671) -- 0:03:20 103500 -- [-1674.886] (-1675.612) (-1680.902) (-1677.524) * [-1678.389] (-1682.191) (-1678.054) (-1687.460) -- 0:03:19 104000 -- (-1676.221) [-1673.884] (-1682.633) (-1679.010) * (-1679.701) (-1671.602) [-1674.179] (-1685.034) -- 0:03:18 104500 -- (-1676.886) (-1679.143) (-1680.012) [-1677.337] * (-1671.897) (-1675.768) (-1681.959) [-1676.979] -- 0:03:25 105000 -- [-1675.143] (-1679.400) (-1677.092) (-1681.887) * (-1677.843) (-1677.851) (-1671.965) [-1672.635] -- 0:03:24 Average standard deviation of split frequencies: 0.022977 105500 -- (-1686.460) [-1673.932] (-1685.823) (-1686.074) * [-1677.451] (-1675.852) (-1686.603) (-1681.780) -- 0:03:23 106000 -- (-1689.711) (-1677.599) [-1680.104] (-1679.028) * (-1686.674) (-1678.398) [-1679.096] (-1681.805) -- 0:03:22 106500 -- (-1686.414) (-1686.353) (-1688.838) [-1675.813] * (-1682.511) [-1679.030] (-1685.145) (-1686.504) -- 0:03:21 107000 -- [-1679.492] (-1678.930) (-1692.377) (-1677.121) * (-1680.710) (-1687.279) [-1677.520] (-1676.954) -- 0:03:20 107500 -- (-1690.572) (-1675.236) [-1678.023] (-1676.889) * [-1675.777] (-1674.277) (-1681.119) (-1678.038) -- 0:03:19 108000 -- (-1685.028) [-1677.834] (-1678.633) (-1685.034) * (-1677.920) (-1673.162) (-1674.955) [-1679.529] -- 0:03:18 108500 -- (-1672.920) (-1675.350) (-1684.845) [-1674.941] * [-1678.529] (-1682.255) (-1677.181) (-1681.419) -- 0:03:17 109000 -- (-1677.235) (-1683.622) (-1680.873) [-1675.096] * (-1682.721) (-1673.970) (-1679.371) [-1679.217] -- 0:03:16 109500 -- (-1680.322) (-1689.768) [-1679.368] (-1678.356) * (-1679.592) [-1670.645] (-1678.114) (-1672.933) -- 0:03:23 110000 -- (-1676.834) (-1675.873) (-1675.554) [-1677.733] * (-1681.438) [-1679.399] (-1677.110) (-1680.273) -- 0:03:22 Average standard deviation of split frequencies: 0.014909 110500 -- (-1683.010) [-1678.401] (-1677.204) (-1684.768) * (-1677.600) [-1680.746] (-1674.129) (-1677.642) -- 0:03:21 111000 -- (-1678.753) [-1681.254] (-1679.688) (-1677.034) * (-1678.638) (-1684.606) (-1678.613) [-1673.418] -- 0:03:20 111500 -- (-1676.267) [-1680.888] (-1687.458) (-1678.541) * [-1672.885] (-1685.756) (-1681.985) (-1678.687) -- 0:03:19 112000 -- [-1679.845] (-1678.983) (-1680.277) (-1678.676) * (-1671.501) (-1680.146) (-1676.867) [-1680.730] -- 0:03:18 112500 -- (-1677.681) (-1681.224) (-1674.356) [-1675.770] * (-1682.068) (-1683.589) [-1670.947] (-1677.249) -- 0:03:17 113000 -- (-1676.509) (-1685.422) [-1673.702] (-1674.095) * (-1680.695) (-1684.032) [-1672.043] (-1680.258) -- 0:03:16 113500 -- [-1680.999] (-1687.181) (-1675.491) (-1676.390) * [-1675.756] (-1681.148) (-1673.680) (-1687.294) -- 0:03:15 114000 -- [-1674.909] (-1681.449) (-1674.663) (-1673.076) * (-1678.477) (-1691.298) [-1682.376] (-1683.365) -- 0:03:14 114500 -- (-1679.641) (-1686.489) [-1677.163] (-1672.586) * [-1680.289] (-1687.876) (-1677.275) (-1678.558) -- 0:03:21 115000 -- (-1678.328) [-1678.205] (-1684.489) (-1679.403) * [-1673.593] (-1679.519) (-1675.273) (-1689.707) -- 0:03:20 Average standard deviation of split frequencies: 0.016933 115500 -- (-1680.152) [-1677.099] (-1683.178) (-1678.153) * [-1672.561] (-1682.017) (-1678.084) (-1674.001) -- 0:03:19 116000 -- (-1676.524) [-1679.426] (-1686.594) (-1673.408) * (-1680.977) [-1675.566] (-1678.544) (-1679.885) -- 0:03:18 116500 -- (-1678.227) (-1675.513) (-1678.692) [-1673.389] * (-1685.187) (-1676.246) (-1670.228) [-1672.459] -- 0:03:17 117000 -- (-1687.090) [-1675.930] (-1673.872) (-1676.759) * (-1681.666) (-1673.100) [-1682.030] (-1681.889) -- 0:03:16 117500 -- (-1679.448) (-1677.524) (-1674.989) [-1684.381] * (-1675.650) (-1677.872) (-1688.508) [-1683.987] -- 0:03:15 118000 -- (-1689.330) [-1673.734] (-1672.953) (-1677.732) * (-1677.473) (-1680.408) (-1681.707) [-1681.884] -- 0:03:14 118500 -- [-1680.396] (-1674.895) (-1673.633) (-1671.625) * (-1687.813) (-1683.471) (-1675.778) [-1679.573] -- 0:03:13 119000 -- [-1677.173] (-1684.399) (-1674.708) (-1675.502) * (-1693.369) (-1687.535) [-1675.119] (-1678.487) -- 0:03:19 119500 -- (-1675.346) (-1684.444) (-1677.153) [-1670.995] * [-1674.976] (-1682.145) (-1676.770) (-1679.684) -- 0:03:18 120000 -- (-1692.707) (-1679.052) [-1672.443] (-1674.437) * (-1676.790) (-1679.148) [-1673.470] (-1681.666) -- 0:03:18 Average standard deviation of split frequencies: 0.017580 120500 -- [-1676.538] (-1673.934) (-1678.621) (-1680.437) * (-1688.102) (-1681.872) (-1681.091) [-1678.733] -- 0:03:17 121000 -- [-1687.571] (-1677.832) (-1676.586) (-1675.510) * [-1678.019] (-1685.119) (-1687.046) (-1679.950) -- 0:03:16 121500 -- (-1679.187) (-1672.328) (-1686.449) [-1679.645] * [-1679.345] (-1677.999) (-1686.424) (-1678.608) -- 0:03:15 122000 -- (-1681.084) (-1677.182) [-1673.819] (-1690.883) * (-1678.364) (-1677.171) [-1678.353] (-1671.651) -- 0:03:14 122500 -- (-1681.730) [-1673.785] (-1677.200) (-1675.434) * [-1673.522] (-1676.742) (-1683.992) (-1680.752) -- 0:03:13 123000 -- (-1688.899) (-1674.675) [-1681.274] (-1678.057) * [-1675.580] (-1686.410) (-1683.232) (-1688.251) -- 0:03:12 123500 -- (-1689.374) (-1678.573) [-1676.683] (-1687.330) * (-1686.196) (-1678.097) (-1680.426) [-1679.059] -- 0:03:11 124000 -- (-1680.381) (-1675.430) (-1685.611) [-1682.170] * (-1679.533) [-1682.363] (-1678.416) (-1678.061) -- 0:03:17 124500 -- (-1679.364) (-1680.442) [-1676.074] (-1674.450) * (-1684.016) (-1691.845) (-1681.145) [-1680.044] -- 0:03:16 125000 -- (-1677.503) [-1675.074] (-1679.622) (-1673.370) * (-1678.598) (-1677.985) [-1679.203] (-1680.310) -- 0:03:16 Average standard deviation of split frequencies: 0.015589 125500 -- (-1686.713) (-1673.803) [-1679.069] (-1676.124) * [-1683.128] (-1678.114) (-1678.658) (-1675.998) -- 0:03:15 126000 -- (-1682.734) (-1681.652) [-1675.115] (-1678.427) * (-1679.671) (-1687.599) [-1676.975] (-1685.094) -- 0:03:14 126500 -- (-1677.103) [-1673.633] (-1680.249) (-1680.965) * (-1675.579) (-1682.927) [-1674.372] (-1677.017) -- 0:03:13 127000 -- (-1679.516) (-1680.935) (-1679.288) [-1676.879] * (-1683.318) (-1680.904) [-1679.774] (-1678.333) -- 0:03:12 127500 -- [-1683.391] (-1682.760) (-1680.424) (-1675.046) * (-1680.102) (-1681.450) (-1680.353) [-1675.062] -- 0:03:11 128000 -- (-1675.704) (-1684.014) (-1673.247) [-1674.937] * (-1681.521) [-1686.370] (-1683.904) (-1682.544) -- 0:03:10 128500 -- (-1679.645) [-1675.704] (-1672.834) (-1675.834) * (-1677.094) (-1683.977) (-1682.453) [-1681.254] -- 0:03:09 129000 -- [-1679.561] (-1674.107) (-1676.259) (-1679.948) * [-1687.385] (-1679.344) (-1692.212) (-1682.630) -- 0:03:15 129500 -- (-1674.777) (-1676.597) [-1673.164] (-1679.856) * [-1681.752] (-1675.212) (-1683.157) (-1682.300) -- 0:03:14 130000 -- (-1689.111) (-1673.701) [-1674.129] (-1686.348) * (-1685.294) [-1677.232] (-1680.026) (-1682.235) -- 0:03:14 Average standard deviation of split frequencies: 0.016235 130500 -- (-1678.133) (-1674.606) [-1677.792] (-1679.963) * (-1680.778) (-1675.906) [-1678.018] (-1686.708) -- 0:03:13 131000 -- (-1677.001) [-1672.382] (-1680.720) (-1682.169) * (-1683.553) (-1679.379) [-1679.787] (-1683.430) -- 0:03:12 131500 -- (-1682.841) (-1672.586) (-1679.743) [-1674.740] * (-1671.868) [-1685.324] (-1684.297) (-1683.751) -- 0:03:11 132000 -- (-1677.351) (-1674.100) (-1683.714) [-1671.623] * (-1677.948) (-1674.749) [-1682.240] (-1682.689) -- 0:03:10 132500 -- (-1679.590) (-1677.533) [-1678.106] (-1675.683) * (-1680.431) [-1677.688] (-1678.195) (-1677.041) -- 0:03:09 133000 -- (-1681.809) (-1674.054) (-1688.745) [-1674.324] * [-1672.717] (-1695.327) (-1678.353) (-1680.349) -- 0:03:09 133500 -- (-1676.081) [-1681.656] (-1688.809) (-1683.022) * [-1673.121] (-1685.563) (-1680.294) (-1674.796) -- 0:03:14 134000 -- (-1685.791) [-1672.534] (-1681.026) (-1675.138) * (-1682.310) [-1687.025] (-1685.605) (-1677.636) -- 0:03:13 134500 -- (-1676.812) (-1678.061) (-1686.028) [-1674.096] * (-1673.061) (-1696.614) [-1677.497] (-1680.262) -- 0:03:13 135000 -- (-1679.524) (-1675.435) (-1684.604) [-1675.376] * [-1674.817] (-1685.447) (-1680.811) (-1679.261) -- 0:03:12 Average standard deviation of split frequencies: 0.017331 135500 -- (-1675.090) (-1679.808) [-1677.397] (-1677.695) * [-1676.948] (-1688.051) (-1683.650) (-1682.083) -- 0:03:11 136000 -- (-1679.525) [-1674.260] (-1678.316) (-1690.955) * (-1677.533) [-1676.408] (-1677.529) (-1680.881) -- 0:03:10 136500 -- [-1675.340] (-1674.121) (-1680.343) (-1678.676) * (-1676.140) [-1676.769] (-1677.498) (-1683.828) -- 0:03:09 137000 -- [-1678.958] (-1678.697) (-1678.227) (-1682.806) * (-1678.987) [-1676.279] (-1679.029) (-1682.782) -- 0:03:08 137500 -- (-1684.955) (-1683.663) (-1677.488) [-1675.199] * [-1675.709] (-1674.809) (-1678.876) (-1679.605) -- 0:03:08 138000 -- [-1678.805] (-1682.187) (-1678.602) (-1679.615) * [-1676.241] (-1679.071) (-1675.546) (-1679.245) -- 0:03:07 138500 -- [-1680.957] (-1680.486) (-1674.991) (-1680.622) * (-1681.298) [-1677.307] (-1680.689) (-1691.581) -- 0:03:12 139000 -- (-1675.024) [-1674.768] (-1681.994) (-1676.264) * (-1685.287) (-1674.649) (-1680.261) [-1681.881] -- 0:03:12 139500 -- (-1673.873) (-1677.780) (-1676.598) [-1676.306] * (-1686.098) (-1676.992) [-1677.029] (-1682.990) -- 0:03:11 140000 -- (-1682.722) [-1673.372] (-1685.210) (-1678.882) * (-1678.026) (-1682.337) (-1677.309) [-1682.547] -- 0:03:10 Average standard deviation of split frequencies: 0.014522 140500 -- (-1674.110) (-1683.013) [-1685.817] (-1675.917) * (-1675.156) (-1683.223) [-1676.882] (-1686.266) -- 0:03:09 141000 -- (-1680.858) [-1673.439] (-1676.327) (-1677.660) * (-1681.120) [-1673.517] (-1679.775) (-1675.969) -- 0:03:08 141500 -- (-1678.922) [-1672.115] (-1677.525) (-1678.965) * (-1686.267) (-1677.114) (-1675.485) [-1680.983] -- 0:03:08 142000 -- (-1679.573) [-1677.741] (-1683.825) (-1673.657) * (-1673.825) (-1680.988) (-1673.818) [-1680.327] -- 0:03:07 142500 -- (-1687.783) [-1672.902] (-1686.278) (-1672.252) * (-1671.826) (-1676.744) [-1675.825] (-1682.432) -- 0:03:06 143000 -- (-1681.687) (-1676.864) (-1689.742) [-1676.929] * (-1672.348) [-1675.330] (-1681.960) (-1680.884) -- 0:03:11 143500 -- (-1687.989) (-1675.384) [-1675.970] (-1675.833) * [-1673.372] (-1677.115) (-1685.652) (-1675.179) -- 0:03:10 144000 -- (-1681.015) (-1675.501) (-1675.851) [-1676.947] * (-1671.506) (-1680.437) [-1675.517] (-1675.877) -- 0:03:10 144500 -- (-1678.142) [-1675.729] (-1673.160) (-1675.152) * (-1674.365) [-1675.767] (-1672.864) (-1676.594) -- 0:03:09 145000 -- (-1683.108) (-1674.522) [-1677.815] (-1676.786) * (-1678.095) [-1685.774] (-1674.130) (-1682.140) -- 0:03:08 Average standard deviation of split frequencies: 0.017220 145500 -- (-1689.769) [-1679.790] (-1676.774) (-1681.312) * [-1677.349] (-1682.889) (-1678.810) (-1678.485) -- 0:03:07 146000 -- (-1685.197) (-1674.334) (-1676.646) [-1671.075] * [-1682.720] (-1677.627) (-1676.387) (-1677.445) -- 0:03:07 146500 -- (-1676.372) (-1675.167) (-1680.199) [-1673.609] * (-1679.708) [-1677.302] (-1671.873) (-1672.798) -- 0:03:06 147000 -- (-1690.654) [-1672.015] (-1674.181) (-1677.908) * (-1676.720) (-1674.807) (-1680.397) [-1679.390] -- 0:03:05 147500 -- (-1681.555) (-1678.910) (-1683.302) [-1675.198] * (-1676.782) (-1675.088) (-1674.658) [-1674.384] -- 0:03:04 148000 -- (-1677.967) (-1676.517) [-1682.330] (-1677.788) * [-1686.376] (-1684.181) (-1678.290) (-1678.859) -- 0:03:09 148500 -- (-1681.091) (-1674.345) (-1681.559) [-1683.377] * (-1679.716) (-1682.712) [-1677.072] (-1682.788) -- 0:03:09 149000 -- [-1673.648] (-1680.073) (-1684.286) (-1671.671) * [-1678.619] (-1674.095) (-1688.126) (-1682.185) -- 0:03:08 149500 -- (-1677.498) (-1673.509) (-1678.423) [-1672.662] * (-1686.972) (-1675.498) (-1682.401) [-1684.425] -- 0:03:07 150000 -- (-1673.916) (-1677.830) [-1676.259] (-1686.466) * (-1688.378) [-1674.784] (-1688.593) (-1674.415) -- 0:03:07 Average standard deviation of split frequencies: 0.013558 150500 -- [-1673.667] (-1677.414) (-1676.804) (-1683.687) * (-1678.400) (-1676.902) (-1678.064) [-1684.474] -- 0:03:06 151000 -- (-1672.368) (-1678.869) [-1674.208] (-1686.671) * [-1680.361] (-1673.888) (-1674.050) (-1681.115) -- 0:03:05 151500 -- (-1674.890) [-1680.551] (-1672.046) (-1687.275) * (-1674.225) [-1676.431] (-1679.274) (-1676.952) -- 0:03:04 152000 -- (-1679.375) (-1685.302) (-1687.758) [-1678.986] * (-1679.482) [-1680.641] (-1679.217) (-1679.794) -- 0:03:04 152500 -- (-1679.045) [-1676.408] (-1678.620) (-1683.947) * (-1677.521) [-1687.639] (-1681.322) (-1678.366) -- 0:03:03 153000 -- (-1679.290) [-1683.259] (-1677.282) (-1681.877) * (-1677.484) (-1676.455) [-1676.709] (-1685.071) -- 0:03:08 153500 -- (-1680.327) (-1683.490) (-1679.292) [-1679.196] * (-1676.702) (-1682.310) (-1679.221) [-1676.451] -- 0:03:07 154000 -- (-1681.742) (-1676.102) (-1684.758) [-1681.172] * (-1682.998) (-1674.282) (-1677.552) [-1683.643] -- 0:03:06 154500 -- (-1680.120) (-1676.169) (-1676.892) [-1677.194] * (-1687.182) (-1678.220) (-1681.452) [-1677.232] -- 0:03:06 155000 -- (-1681.964) [-1675.353] (-1676.376) (-1676.103) * (-1672.997) (-1679.473) (-1680.604) [-1679.175] -- 0:03:05 Average standard deviation of split frequencies: 0.012087 155500 -- [-1675.258] (-1678.009) (-1675.494) (-1677.960) * (-1681.958) (-1678.182) [-1675.838] (-1679.697) -- 0:03:04 156000 -- (-1677.168) (-1680.220) (-1673.211) [-1677.461] * (-1679.663) (-1682.088) [-1674.820] (-1673.728) -- 0:03:03 156500 -- (-1676.588) (-1680.547) [-1671.453] (-1677.511) * (-1676.885) (-1681.399) [-1673.344] (-1676.738) -- 0:03:03 157000 -- (-1674.205) [-1674.572] (-1680.949) (-1681.079) * (-1678.211) (-1674.937) [-1672.084] (-1676.550) -- 0:03:02 157500 -- (-1675.665) (-1676.991) (-1681.119) [-1677.431] * [-1678.313] (-1675.244) (-1685.723) (-1673.733) -- 0:03:01 158000 -- (-1680.017) [-1682.297] (-1680.743) (-1689.381) * (-1678.473) [-1677.599] (-1686.534) (-1674.200) -- 0:03:06 158500 -- (-1690.326) (-1677.481) [-1689.879] (-1673.278) * [-1675.679] (-1675.865) (-1690.003) (-1675.285) -- 0:03:05 159000 -- (-1686.356) (-1697.439) (-1684.357) [-1684.099] * (-1679.551) (-1675.794) [-1677.031] (-1684.169) -- 0:03:05 159500 -- (-1685.003) [-1684.231] (-1677.504) (-1676.791) * [-1676.928] (-1672.936) (-1681.243) (-1680.883) -- 0:03:04 160000 -- [-1674.434] (-1700.040) (-1681.765) (-1680.462) * (-1674.622) (-1681.054) [-1681.935] (-1682.571) -- 0:03:03 Average standard deviation of split frequencies: 0.013692 160500 -- (-1675.545) (-1689.200) [-1677.232] (-1684.555) * (-1673.230) [-1674.575] (-1681.001) (-1693.972) -- 0:03:03 161000 -- (-1687.095) (-1677.891) (-1681.084) [-1678.262] * [-1672.544] (-1683.617) (-1678.253) (-1688.160) -- 0:03:02 161500 -- (-1675.278) (-1684.089) [-1679.785] (-1672.694) * (-1674.955) (-1683.283) (-1678.588) [-1673.632] -- 0:03:01 162000 -- (-1681.014) (-1687.764) [-1684.028] (-1676.599) * [-1674.061] (-1676.194) (-1683.155) (-1683.205) -- 0:03:06 162500 -- (-1673.475) [-1678.103] (-1685.717) (-1675.191) * (-1675.913) [-1675.452] (-1689.977) (-1676.253) -- 0:03:05 163000 -- (-1688.420) [-1674.216] (-1672.884) (-1686.099) * [-1677.463] (-1684.829) (-1679.804) (-1689.106) -- 0:03:04 163500 -- (-1673.863) (-1678.682) (-1675.475) [-1686.754] * (-1677.351) [-1677.626] (-1678.012) (-1682.521) -- 0:03:04 164000 -- (-1675.958) [-1672.495] (-1676.138) (-1672.311) * (-1679.551) (-1680.002) [-1677.420] (-1695.062) -- 0:03:03 164500 -- [-1676.406] (-1676.713) (-1681.966) (-1678.876) * (-1681.904) (-1682.765) (-1675.960) [-1683.455] -- 0:03:02 165000 -- (-1672.562) (-1679.952) [-1681.168] (-1678.039) * (-1675.151) [-1679.852] (-1681.300) (-1678.508) -- 0:03:02 Average standard deviation of split frequencies: 0.013252 165500 -- [-1679.115] (-1674.148) (-1678.929) (-1673.270) * (-1673.611) (-1676.422) [-1679.640] (-1674.660) -- 0:03:01 166000 -- (-1674.728) (-1683.251) (-1678.790) [-1681.818] * [-1672.510] (-1680.272) (-1679.996) (-1682.481) -- 0:03:00 166500 -- [-1681.892] (-1679.544) (-1676.673) (-1676.451) * (-1678.154) (-1678.919) (-1678.168) [-1682.687] -- 0:03:05 167000 -- (-1683.078) (-1672.410) (-1680.259) [-1680.144] * (-1678.957) (-1674.580) [-1681.143] (-1687.123) -- 0:03:04 167500 -- (-1678.809) [-1673.916] (-1689.269) (-1680.694) * (-1674.836) [-1673.068] (-1686.142) (-1678.314) -- 0:03:03 168000 -- [-1670.163] (-1677.430) (-1692.952) (-1676.078) * (-1682.734) (-1675.367) [-1677.677] (-1678.337) -- 0:03:03 168500 -- [-1676.670] (-1672.527) (-1684.028) (-1677.337) * (-1678.295) (-1679.326) (-1674.260) [-1676.343] -- 0:03:02 169000 -- (-1680.409) (-1695.272) (-1682.690) [-1675.767] * [-1675.721] (-1676.363) (-1680.826) (-1677.099) -- 0:03:01 169500 -- (-1677.177) (-1679.696) [-1679.273] (-1682.700) * [-1674.361] (-1682.517) (-1675.337) (-1672.651) -- 0:03:01 170000 -- [-1674.450] (-1684.545) (-1679.143) (-1691.237) * (-1683.442) [-1676.561] (-1678.278) (-1683.378) -- 0:03:00 Average standard deviation of split frequencies: 0.012890 170500 -- (-1680.808) (-1682.512) (-1676.655) [-1677.129] * (-1675.307) (-1675.771) (-1678.075) [-1676.675] -- 0:03:00 171000 -- (-1684.437) (-1686.737) (-1670.805) [-1679.589] * (-1676.067) [-1673.804] (-1676.425) (-1680.273) -- 0:02:59 171500 -- [-1674.780] (-1684.552) (-1669.540) (-1678.240) * (-1674.481) [-1671.017] (-1685.422) (-1678.545) -- 0:03:03 172000 -- (-1684.036) (-1680.533) (-1675.125) [-1683.564] * (-1676.506) (-1676.753) (-1681.158) [-1677.190] -- 0:03:02 172500 -- [-1679.594] (-1681.465) (-1678.784) (-1686.873) * (-1680.537) (-1677.814) (-1675.417) [-1672.954] -- 0:03:02 173000 -- (-1681.711) (-1682.365) [-1676.582] (-1677.513) * [-1684.889] (-1685.199) (-1682.656) (-1677.307) -- 0:03:01 173500 -- (-1681.351) [-1680.638] (-1674.907) (-1677.006) * (-1682.738) (-1671.923) (-1690.912) [-1678.888] -- 0:03:01 174000 -- (-1678.157) (-1676.640) [-1678.743] (-1675.735) * (-1676.192) [-1678.424] (-1682.649) (-1676.579) -- 0:03:00 174500 -- (-1691.155) (-1675.350) (-1672.326) [-1671.011] * (-1681.110) [-1675.900] (-1672.832) (-1676.412) -- 0:02:59 175000 -- (-1676.593) [-1671.567] (-1678.931) (-1684.249) * (-1676.270) [-1679.605] (-1676.355) (-1680.156) -- 0:02:59 Average standard deviation of split frequencies: 0.013392 175500 -- (-1680.416) [-1674.596] (-1674.000) (-1687.101) * (-1678.559) (-1679.209) [-1683.450] (-1684.613) -- 0:03:03 176000 -- (-1687.104) [-1674.218] (-1677.157) (-1677.280) * (-1674.122) [-1673.147] (-1684.130) (-1687.615) -- 0:03:02 176500 -- (-1679.968) (-1678.978) (-1680.592) [-1677.835] * (-1677.333) (-1681.501) [-1674.038] (-1678.972) -- 0:03:01 177000 -- (-1681.105) [-1676.117] (-1681.097) (-1681.543) * (-1679.894) (-1680.798) [-1671.662] (-1683.021) -- 0:03:01 177500 -- [-1676.796] (-1674.533) (-1674.924) (-1688.823) * [-1670.051] (-1681.472) (-1676.417) (-1685.534) -- 0:03:00 178000 -- (-1679.198) [-1677.029] (-1676.206) (-1679.981) * [-1674.131] (-1681.372) (-1675.947) (-1683.298) -- 0:03:00 178500 -- (-1688.411) [-1675.789] (-1684.355) (-1674.571) * (-1675.560) (-1682.108) (-1674.118) [-1677.944] -- 0:02:59 179000 -- (-1688.650) [-1673.754] (-1675.616) (-1678.349) * (-1679.012) (-1687.602) (-1676.949) [-1678.898] -- 0:02:58 179500 -- (-1676.779) [-1672.937] (-1677.770) (-1678.265) * [-1676.766] (-1685.668) (-1671.254) (-1680.603) -- 0:02:58 180000 -- (-1678.361) (-1685.866) [-1674.561] (-1678.877) * (-1682.018) (-1680.300) [-1677.076] (-1677.316) -- 0:02:57 Average standard deviation of split frequencies: 0.013046 180500 -- (-1674.924) (-1674.957) (-1672.766) [-1677.364] * (-1678.405) [-1676.980] (-1681.151) (-1684.288) -- 0:03:01 181000 -- [-1675.676] (-1673.374) (-1684.111) (-1685.481) * [-1675.785] (-1681.036) (-1676.570) (-1674.108) -- 0:03:00 181500 -- (-1689.651) (-1673.995) (-1674.684) [-1673.932] * (-1677.938) [-1676.742] (-1686.827) (-1675.810) -- 0:03:00 182000 -- (-1673.814) (-1679.622) [-1675.672] (-1684.486) * (-1689.059) (-1675.971) [-1680.457] (-1685.738) -- 0:02:59 182500 -- (-1678.191) (-1674.325) [-1673.932] (-1676.140) * (-1678.993) [-1669.974] (-1678.261) (-1680.875) -- 0:02:59 183000 -- (-1679.712) [-1677.239] (-1681.321) (-1688.370) * (-1678.572) [-1674.453] (-1682.178) (-1680.273) -- 0:02:58 183500 -- (-1674.470) (-1679.487) (-1686.580) [-1680.900] * (-1675.878) [-1674.700] (-1684.827) (-1674.684) -- 0:02:57 184000 -- [-1676.278] (-1682.192) (-1676.533) (-1675.806) * (-1672.073) [-1677.995] (-1694.693) (-1678.468) -- 0:02:57 184500 -- (-1672.583) (-1685.293) (-1684.827) [-1684.058] * (-1675.784) (-1682.569) [-1678.496] (-1674.814) -- 0:02:56 185000 -- (-1675.215) (-1674.637) [-1672.290] (-1672.987) * (-1689.888) (-1677.119) (-1690.192) [-1676.136] -- 0:03:00 Average standard deviation of split frequencies: 0.014362 185500 -- (-1678.120) (-1678.299) (-1677.400) [-1673.425] * (-1672.498) [-1679.225] (-1675.817) (-1683.153) -- 0:03:00 186000 -- (-1679.451) [-1679.482] (-1673.626) (-1674.835) * (-1673.671) [-1682.080] (-1680.064) (-1677.394) -- 0:02:59 186500 -- (-1684.768) (-1675.293) [-1673.831] (-1680.454) * [-1677.358] (-1683.133) (-1677.800) (-1679.888) -- 0:02:58 187000 -- [-1684.750] (-1674.777) (-1679.065) (-1679.292) * (-1684.775) [-1673.205] (-1679.200) (-1673.311) -- 0:02:58 187500 -- (-1677.727) (-1674.878) [-1690.936] (-1681.591) * (-1686.459) [-1677.739] (-1686.801) (-1676.824) -- 0:02:57 188000 -- (-1678.134) (-1678.754) [-1677.146] (-1682.767) * (-1688.165) (-1687.027) (-1680.856) [-1671.076] -- 0:02:57 188500 -- (-1681.442) (-1678.326) [-1681.707] (-1681.689) * (-1683.078) [-1681.253] (-1682.465) (-1682.256) -- 0:02:56 189000 -- (-1678.580) [-1678.017] (-1675.308) (-1675.866) * (-1679.611) (-1680.336) [-1676.842] (-1675.193) -- 0:02:55 189500 -- (-1676.489) (-1679.884) (-1675.525) [-1671.864] * (-1688.458) (-1679.494) (-1686.886) [-1672.222] -- 0:02:55 190000 -- (-1678.717) (-1675.759) [-1676.319] (-1677.194) * (-1679.322) (-1672.984) [-1681.921] (-1680.073) -- 0:02:59 Average standard deviation of split frequencies: 0.013186 190500 -- (-1689.682) [-1671.216] (-1679.397) (-1678.351) * (-1675.056) [-1670.983] (-1681.988) (-1679.746) -- 0:02:58 191000 -- (-1679.711) [-1675.685] (-1687.454) (-1674.623) * (-1675.907) (-1674.602) [-1671.659] (-1678.979) -- 0:02:57 191500 -- (-1681.791) (-1675.348) [-1677.336] (-1687.552) * (-1675.672) (-1674.885) [-1673.587] (-1680.294) -- 0:02:57 192000 -- (-1688.536) [-1676.812] (-1682.047) (-1675.307) * [-1682.634] (-1671.844) (-1680.627) (-1674.964) -- 0:02:56 192500 -- (-1682.598) (-1677.848) [-1676.734] (-1676.812) * (-1677.220) (-1680.976) (-1681.848) [-1677.170] -- 0:02:56 193000 -- (-1678.982) (-1678.525) [-1673.191] (-1681.940) * [-1679.275] (-1677.044) (-1685.474) (-1675.226) -- 0:02:55 193500 -- (-1673.770) (-1677.426) (-1681.434) [-1679.961] * (-1685.479) (-1683.192) (-1683.013) [-1674.846] -- 0:02:55 194000 -- (-1682.641) (-1683.264) (-1683.478) [-1676.623] * (-1682.031) (-1675.857) (-1682.632) [-1673.592] -- 0:02:58 194500 -- [-1675.499] (-1681.761) (-1683.792) (-1675.103) * (-1673.700) (-1677.025) (-1681.512) [-1673.805] -- 0:02:58 195000 -- [-1675.849] (-1680.067) (-1678.432) (-1687.129) * [-1675.619] (-1680.980) (-1675.920) (-1673.308) -- 0:02:57 Average standard deviation of split frequencies: 0.012827 195500 -- (-1680.012) (-1677.543) (-1679.504) [-1679.863] * (-1688.010) (-1690.157) [-1676.187] (-1675.233) -- 0:02:56 196000 -- [-1676.011] (-1680.616) (-1682.962) (-1682.147) * (-1685.799) (-1678.793) (-1680.098) [-1669.816] -- 0:02:56 196500 -- (-1680.139) (-1686.807) (-1679.093) [-1680.753] * [-1675.636] (-1675.387) (-1697.647) (-1677.194) -- 0:02:55 197000 -- (-1681.664) [-1671.272] (-1676.271) (-1677.756) * (-1679.392) (-1681.511) [-1677.199] (-1682.521) -- 0:02:55 197500 -- (-1682.517) (-1681.248) (-1686.165) [-1675.040] * (-1684.105) (-1680.674) [-1672.787] (-1676.753) -- 0:02:54 198000 -- [-1678.796] (-1672.333) (-1679.448) (-1679.788) * (-1677.773) (-1674.702) [-1674.484] (-1677.130) -- 0:02:54 198500 -- (-1675.606) [-1676.154] (-1687.187) (-1670.806) * [-1675.011] (-1691.004) (-1675.940) (-1679.845) -- 0:02:57 199000 -- [-1675.484] (-1682.429) (-1678.358) (-1676.675) * [-1676.809] (-1674.731) (-1671.961) (-1676.103) -- 0:02:57 199500 -- [-1676.142] (-1681.431) (-1687.435) (-1678.290) * (-1679.702) (-1674.744) [-1675.233] (-1685.530) -- 0:02:56 200000 -- (-1677.827) (-1686.131) (-1683.686) [-1676.723] * [-1679.581] (-1674.014) (-1677.159) (-1682.830) -- 0:02:56 Average standard deviation of split frequencies: 0.010963 200500 -- (-1683.904) (-1677.099) [-1678.355] (-1675.370) * (-1675.691) (-1671.807) [-1675.264] (-1677.998) -- 0:02:55 201000 -- (-1679.156) [-1678.901] (-1680.602) (-1674.836) * [-1676.429] (-1674.598) (-1684.217) (-1687.021) -- 0:02:54 201500 -- (-1675.361) [-1680.723] (-1678.718) (-1676.098) * (-1676.339) [-1682.110] (-1682.265) (-1682.693) -- 0:02:54 202000 -- [-1676.427] (-1677.181) (-1689.047) (-1686.249) * (-1674.531) [-1673.968] (-1685.232) (-1685.486) -- 0:02:53 202500 -- (-1682.245) (-1681.266) [-1682.616] (-1677.123) * [-1674.168] (-1672.005) (-1679.318) (-1678.960) -- 0:02:53 203000 -- (-1673.906) (-1681.686) (-1680.243) [-1678.863] * (-1673.464) (-1688.633) [-1676.864] (-1674.894) -- 0:02:52 203500 -- (-1672.946) (-1673.767) (-1679.536) [-1683.631] * (-1676.073) (-1684.014) [-1674.159] (-1673.405) -- 0:02:56 204000 -- [-1680.458] (-1676.890) (-1680.452) (-1692.416) * [-1677.240] (-1682.551) (-1674.210) (-1680.642) -- 0:02:55 204500 -- [-1678.150] (-1681.268) (-1679.002) (-1676.673) * (-1679.731) (-1682.267) [-1678.721] (-1680.326) -- 0:02:55 205000 -- (-1678.374) (-1679.102) (-1673.682) [-1674.232] * [-1679.946] (-1680.726) (-1675.193) (-1684.240) -- 0:02:54 Average standard deviation of split frequencies: 0.010679 205500 -- (-1682.789) (-1674.432) [-1676.977] (-1673.506) * (-1676.542) (-1685.565) [-1676.988] (-1681.433) -- 0:02:53 206000 -- (-1680.857) (-1682.253) [-1676.322] (-1673.931) * (-1675.468) (-1683.702) [-1680.761] (-1675.993) -- 0:02:53 206500 -- (-1685.794) (-1681.955) (-1679.934) [-1682.456] * (-1686.437) [-1671.612] (-1680.057) (-1688.058) -- 0:02:52 207000 -- (-1678.739) (-1689.234) (-1679.873) [-1686.691] * (-1681.789) [-1683.772] (-1674.030) (-1686.252) -- 0:02:52 207500 -- (-1685.710) (-1679.472) (-1676.275) [-1678.444] * (-1676.538) (-1682.931) [-1676.282] (-1679.241) -- 0:02:51 208000 -- (-1681.454) (-1673.371) [-1673.089] (-1683.462) * (-1680.809) (-1683.268) [-1677.346] (-1678.306) -- 0:02:55 208500 -- (-1676.686) [-1680.793] (-1679.452) (-1679.618) * (-1675.787) [-1679.692] (-1677.417) (-1683.292) -- 0:02:54 209000 -- (-1682.402) [-1673.832] (-1676.711) (-1688.280) * (-1678.848) [-1679.085] (-1669.879) (-1679.687) -- 0:02:54 209500 -- (-1680.362) [-1674.193] (-1680.500) (-1681.303) * (-1682.491) (-1682.532) (-1679.474) [-1676.630] -- 0:02:53 210000 -- (-1676.662) [-1674.119] (-1677.838) (-1683.718) * (-1673.281) (-1678.044) [-1677.342] (-1674.982) -- 0:02:53 Average standard deviation of split frequencies: 0.013426 210500 -- (-1681.609) (-1683.005) [-1680.089] (-1680.540) * (-1684.606) (-1675.825) [-1677.464] (-1679.780) -- 0:02:52 211000 -- (-1676.917) (-1676.611) (-1673.966) [-1676.218] * (-1677.264) [-1678.251] (-1679.293) (-1684.341) -- 0:02:52 211500 -- (-1676.778) (-1678.896) [-1675.623] (-1672.943) * (-1675.612) (-1680.770) [-1677.786] (-1676.950) -- 0:02:51 212000 -- (-1681.906) (-1684.421) [-1681.431] (-1678.303) * [-1673.135] (-1693.425) (-1679.770) (-1679.411) -- 0:02:50 212500 -- (-1676.456) (-1679.457) [-1675.249] (-1682.727) * (-1676.680) (-1677.341) [-1677.589] (-1684.909) -- 0:02:50 213000 -- [-1674.869] (-1680.676) (-1679.006) (-1681.711) * [-1686.046] (-1677.814) (-1686.446) (-1673.366) -- 0:02:53 213500 -- (-1676.587) [-1675.116] (-1674.706) (-1690.098) * (-1685.176) [-1686.173] (-1673.811) (-1672.376) -- 0:02:53 214000 -- [-1677.603] (-1677.087) (-1677.112) (-1677.192) * (-1670.441) [-1677.792] (-1674.128) (-1684.639) -- 0:02:52 214500 -- (-1680.577) [-1675.277] (-1679.897) (-1676.226) * (-1672.992) (-1679.632) (-1672.062) [-1675.747] -- 0:02:52 215000 -- (-1677.769) (-1677.399) (-1681.067) [-1675.598] * (-1679.222) (-1688.916) [-1671.508] (-1680.902) -- 0:02:51 Average standard deviation of split frequencies: 0.011640 215500 -- (-1688.926) (-1678.125) [-1671.263] (-1677.001) * (-1680.736) (-1680.439) (-1677.430) [-1677.921] -- 0:02:51 216000 -- (-1678.162) (-1682.209) (-1682.544) [-1678.203] * (-1679.174) (-1674.100) [-1673.365] (-1679.044) -- 0:02:50 216500 -- [-1677.742] (-1686.747) (-1676.530) (-1678.474) * (-1688.598) (-1684.680) (-1677.375) [-1673.726] -- 0:02:50 217000 -- (-1690.011) [-1677.850] (-1679.831) (-1676.979) * (-1680.658) (-1682.230) [-1675.170] (-1679.740) -- 0:02:49 217500 -- (-1675.989) (-1674.872) (-1679.777) [-1680.135] * (-1679.785) (-1685.942) [-1684.031] (-1678.495) -- 0:02:52 218000 -- (-1678.786) [-1673.302] (-1676.301) (-1673.243) * (-1683.646) [-1677.038] (-1671.929) (-1677.253) -- 0:02:52 218500 -- (-1678.147) [-1674.220] (-1674.770) (-1675.534) * (-1688.750) [-1671.189] (-1678.157) (-1679.520) -- 0:02:51 219000 -- (-1672.360) (-1674.804) (-1675.558) [-1680.607] * [-1676.520] (-1687.153) (-1693.436) (-1686.680) -- 0:02:51 219500 -- (-1672.140) (-1684.544) (-1683.131) [-1677.277] * (-1680.307) [-1673.870] (-1680.107) (-1675.071) -- 0:02:50 220000 -- [-1678.178] (-1687.098) (-1681.777) (-1678.810) * (-1673.437) (-1676.861) [-1675.096] (-1680.378) -- 0:02:50 Average standard deviation of split frequencies: 0.011393 220500 -- [-1674.448] (-1686.964) (-1689.807) (-1681.974) * (-1678.965) (-1676.833) [-1677.280] (-1679.074) -- 0:02:49 221000 -- [-1677.158] (-1676.924) (-1670.134) (-1678.617) * (-1676.464) (-1682.065) [-1675.589] (-1680.029) -- 0:02:49 221500 -- (-1680.849) (-1673.398) [-1675.395] (-1679.808) * (-1678.408) (-1680.645) (-1677.862) [-1677.223] -- 0:02:48 222000 -- (-1674.868) (-1678.172) (-1674.561) [-1680.601] * (-1683.382) (-1685.542) (-1681.628) [-1673.464] -- 0:02:48 222500 -- [-1677.362] (-1674.265) (-1684.643) (-1681.588) * (-1684.484) (-1674.062) [-1676.888] (-1679.517) -- 0:02:51 223000 -- [-1677.431] (-1679.783) (-1687.602) (-1677.577) * [-1682.690] (-1682.055) (-1678.208) (-1693.335) -- 0:02:50 223500 -- [-1674.438] (-1679.976) (-1688.773) (-1676.002) * [-1677.277] (-1680.336) (-1685.901) (-1681.825) -- 0:02:50 224000 -- (-1681.958) [-1675.679] (-1678.179) (-1675.654) * [-1683.040] (-1686.074) (-1683.267) (-1677.557) -- 0:02:49 224500 -- (-1671.127) [-1676.038] (-1679.250) (-1677.636) * (-1677.577) (-1676.617) [-1678.986] (-1677.628) -- 0:02:49 225000 -- (-1679.581) [-1676.920] (-1679.446) (-1675.143) * (-1685.819) (-1690.192) [-1673.435] (-1685.648) -- 0:02:48 Average standard deviation of split frequencies: 0.014601 225500 -- [-1677.696] (-1675.900) (-1681.877) (-1679.225) * (-1684.323) (-1687.759) [-1672.444] (-1673.118) -- 0:02:48 226000 -- (-1675.002) (-1685.459) (-1678.167) [-1683.368] * (-1683.955) (-1695.355) (-1677.658) [-1676.884] -- 0:02:47 226500 -- (-1676.900) [-1678.046] (-1676.094) (-1676.813) * (-1686.811) (-1699.376) [-1669.438] (-1685.504) -- 0:02:47 227000 -- [-1679.186] (-1674.147) (-1678.469) (-1679.319) * (-1688.105) (-1687.328) [-1675.615] (-1679.829) -- 0:02:50 227500 -- (-1681.963) (-1674.587) [-1672.269] (-1677.368) * (-1689.635) (-1697.970) [-1674.238] (-1677.594) -- 0:02:49 228000 -- (-1678.836) [-1674.749] (-1685.419) (-1681.617) * (-1685.823) (-1685.424) [-1675.717] (-1673.720) -- 0:02:49 228500 -- (-1683.052) (-1679.300) (-1678.248) [-1674.974] * (-1693.780) [-1679.867] (-1679.405) (-1676.928) -- 0:02:48 229000 -- (-1688.538) (-1676.884) [-1677.991] (-1681.208) * (-1679.149) [-1682.811] (-1678.343) (-1676.444) -- 0:02:48 229500 -- (-1679.421) (-1679.902) [-1679.247] (-1672.003) * (-1678.731) (-1678.600) [-1679.445] (-1679.329) -- 0:02:47 230000 -- [-1677.802] (-1678.866) (-1679.228) (-1675.095) * (-1676.105) (-1676.040) [-1673.370] (-1681.745) -- 0:02:47 Average standard deviation of split frequencies: 0.012262 230500 -- (-1679.455) [-1682.627] (-1678.396) (-1680.515) * (-1681.055) (-1685.626) [-1673.688] (-1677.487) -- 0:02:46 231000 -- (-1676.280) [-1671.613] (-1680.156) (-1679.469) * (-1682.673) (-1680.805) [-1668.569] (-1672.574) -- 0:02:46 231500 -- [-1672.530] (-1676.082) (-1669.941) (-1675.680) * (-1674.970) [-1679.002] (-1680.479) (-1673.752) -- 0:02:49 232000 -- [-1668.632] (-1677.228) (-1684.906) (-1682.326) * (-1675.303) [-1683.033] (-1680.761) (-1682.423) -- 0:02:48 232500 -- (-1681.042) [-1676.649] (-1677.879) (-1688.019) * (-1676.947) (-1686.091) (-1675.848) [-1676.851] -- 0:02:48 233000 -- [-1673.332] (-1682.655) (-1672.931) (-1674.817) * [-1686.073] (-1680.298) (-1675.075) (-1685.292) -- 0:02:47 233500 -- [-1676.926] (-1683.075) (-1678.424) (-1682.017) * [-1673.654] (-1678.923) (-1677.237) (-1686.579) -- 0:02:47 234000 -- (-1679.530) (-1678.443) (-1702.333) [-1682.656] * [-1671.647] (-1673.490) (-1688.867) (-1682.085) -- 0:02:46 234500 -- (-1681.511) (-1678.456) [-1670.532] (-1673.972) * (-1685.541) (-1673.360) [-1683.495] (-1675.345) -- 0:02:46 235000 -- [-1675.688] (-1672.490) (-1679.119) (-1674.071) * [-1672.987] (-1689.958) (-1677.917) (-1682.029) -- 0:02:46 Average standard deviation of split frequencies: 0.011985 235500 -- (-1676.233) (-1675.269) [-1675.072] (-1673.561) * (-1676.125) (-1676.500) [-1683.034] (-1683.245) -- 0:02:45 236000 -- (-1683.881) [-1676.846] (-1673.892) (-1676.107) * [-1675.787] (-1678.160) (-1678.695) (-1674.673) -- 0:02:45 236500 -- (-1680.510) (-1675.812) [-1675.389] (-1676.090) * (-1671.816) (-1677.660) (-1682.465) [-1679.397] -- 0:02:47 237000 -- (-1692.835) (-1671.038) [-1675.154] (-1678.492) * (-1679.905) [-1680.910] (-1679.443) (-1678.170) -- 0:02:47 237500 -- (-1683.386) [-1673.711] (-1677.031) (-1676.175) * (-1674.567) (-1672.865) (-1678.996) [-1675.433] -- 0:02:46 238000 -- (-1681.550) [-1674.030] (-1681.439) (-1679.530) * (-1676.516) (-1676.094) (-1676.523) [-1675.877] -- 0:02:46 238500 -- (-1679.077) (-1683.279) (-1676.188) [-1672.182] * (-1677.000) (-1679.290) (-1683.298) [-1676.669] -- 0:02:46 239000 -- (-1689.553) (-1677.435) (-1681.207) [-1673.077] * (-1688.479) [-1673.831] (-1679.727) (-1677.201) -- 0:02:45 239500 -- (-1689.488) [-1675.877] (-1675.559) (-1676.444) * [-1679.263] (-1679.670) (-1689.954) (-1677.900) -- 0:02:45 240000 -- (-1682.561) (-1674.257) (-1674.764) [-1674.662] * (-1679.162) (-1677.150) (-1688.636) [-1681.638] -- 0:02:44 Average standard deviation of split frequencies: 0.013058 240500 -- (-1682.905) (-1678.572) (-1681.439) [-1678.011] * (-1675.219) (-1680.931) [-1682.551] (-1674.640) -- 0:02:44 241000 -- [-1677.230] (-1675.342) (-1679.448) (-1679.482) * (-1676.647) (-1676.337) (-1688.401) [-1683.242] -- 0:02:46 241500 -- (-1676.586) (-1681.703) (-1677.172) [-1675.915] * [-1681.822] (-1677.918) (-1681.767) (-1677.431) -- 0:02:46 242000 -- [-1679.145] (-1672.010) (-1674.654) (-1675.062) * (-1680.089) (-1677.071) (-1675.495) [-1677.342] -- 0:02:46 242500 -- (-1676.097) [-1677.175] (-1679.274) (-1671.547) * (-1681.304) [-1673.225] (-1681.362) (-1681.248) -- 0:02:45 243000 -- [-1675.426] (-1681.352) (-1675.426) (-1676.088) * (-1678.716) (-1678.132) (-1676.475) [-1678.772] -- 0:02:45 243500 -- [-1675.424] (-1685.714) (-1691.299) (-1685.007) * (-1683.997) (-1674.731) [-1678.691] (-1678.044) -- 0:02:44 244000 -- [-1678.337] (-1673.360) (-1676.378) (-1677.603) * (-1674.716) [-1678.296] (-1681.723) (-1679.074) -- 0:02:44 244500 -- [-1680.389] (-1684.391) (-1677.932) (-1672.966) * (-1678.607) (-1677.720) [-1676.786] (-1677.115) -- 0:02:43 245000 -- (-1673.506) [-1673.484] (-1678.191) (-1680.729) * (-1680.510) (-1677.468) [-1677.587] (-1681.491) -- 0:02:43 Average standard deviation of split frequencies: 0.014053 245500 -- (-1690.819) (-1675.219) (-1681.615) [-1680.697] * (-1681.182) (-1685.051) (-1678.434) [-1678.621] -- 0:02:42 246000 -- (-1675.637) (-1678.270) [-1678.028] (-1683.994) * [-1679.701] (-1679.694) (-1674.072) (-1679.447) -- 0:02:45 246500 -- (-1682.607) [-1676.942] (-1678.026) (-1677.363) * (-1676.619) (-1684.777) (-1675.890) [-1675.509] -- 0:02:45 247000 -- (-1677.444) [-1685.028] (-1681.534) (-1685.479) * [-1679.974] (-1675.574) (-1677.079) (-1683.970) -- 0:02:44 247500 -- (-1676.344) (-1672.467) (-1674.565) [-1677.189] * (-1678.885) (-1675.079) [-1680.782] (-1676.233) -- 0:02:44 248000 -- (-1678.507) (-1679.785) [-1674.218] (-1689.773) * [-1674.109] (-1676.476) (-1687.392) (-1682.351) -- 0:02:43 248500 -- (-1676.555) [-1674.541] (-1677.847) (-1684.289) * [-1672.651] (-1680.772) (-1678.856) (-1679.183) -- 0:02:43 249000 -- (-1675.573) (-1677.310) (-1679.133) [-1678.001] * (-1679.520) (-1677.845) (-1679.741) [-1679.729] -- 0:02:42 249500 -- [-1674.056] (-1680.557) (-1671.935) (-1674.469) * (-1678.090) (-1675.918) (-1675.202) [-1677.387] -- 0:02:42 250000 -- (-1681.363) [-1676.110] (-1680.062) (-1682.313) * [-1678.376] (-1678.079) (-1676.685) (-1683.425) -- 0:02:42 Average standard deviation of split frequencies: 0.012537 250500 -- (-1681.243) [-1678.865] (-1677.937) (-1675.044) * (-1677.507) (-1680.705) [-1673.281] (-1680.451) -- 0:02:44 251000 -- [-1676.664] (-1686.115) (-1677.074) (-1679.725) * (-1688.629) (-1680.023) [-1674.796] (-1675.467) -- 0:02:44 251500 -- (-1684.130) (-1683.104) [-1684.057] (-1674.408) * (-1678.267) (-1692.606) [-1675.096] (-1679.604) -- 0:02:43 252000 -- (-1677.058) (-1689.732) (-1681.861) [-1680.286] * (-1679.127) (-1677.442) (-1675.567) [-1675.462] -- 0:02:43 252500 -- (-1674.451) [-1681.340] (-1682.531) (-1681.884) * (-1681.004) (-1674.616) (-1675.933) [-1681.577] -- 0:02:42 253000 -- (-1675.189) [-1669.992] (-1679.930) (-1680.614) * (-1675.291) (-1675.447) (-1672.320) [-1680.720] -- 0:02:42 253500 -- [-1673.460] (-1678.966) (-1683.456) (-1681.334) * (-1674.326) [-1677.796] (-1679.004) (-1681.231) -- 0:02:41 254000 -- (-1680.192) (-1678.521) (-1682.093) [-1672.717] * (-1683.371) [-1681.001] (-1684.311) (-1676.681) -- 0:02:41 254500 -- (-1678.535) (-1677.544) (-1682.795) [-1681.663] * (-1679.319) [-1674.736] (-1675.169) (-1694.142) -- 0:02:41 255000 -- (-1680.038) (-1674.040) (-1686.257) [-1681.726] * (-1673.623) (-1674.941) [-1674.731] (-1679.398) -- 0:02:40 Average standard deviation of split frequencies: 0.012276 255500 -- (-1686.451) (-1675.341) [-1686.007] (-1676.326) * (-1677.518) [-1680.288] (-1673.264) (-1681.746) -- 0:02:43 256000 -- (-1679.485) (-1673.731) (-1680.731) [-1676.422] * (-1676.916) (-1675.806) (-1678.809) [-1682.714] -- 0:02:42 256500 -- (-1686.081) (-1679.588) (-1683.188) [-1676.292] * (-1672.779) [-1674.204] (-1680.861) (-1685.051) -- 0:02:42 257000 -- (-1675.760) [-1675.278] (-1676.442) (-1680.580) * [-1672.388] (-1680.279) (-1679.855) (-1679.935) -- 0:02:41 257500 -- (-1680.817) (-1680.061) (-1679.853) [-1677.994] * (-1680.557) (-1679.350) (-1684.315) [-1674.489] -- 0:02:41 258000 -- (-1680.459) (-1684.943) (-1678.168) [-1678.985] * (-1677.816) (-1678.118) [-1684.620] (-1685.155) -- 0:02:41 258500 -- (-1680.256) (-1684.444) (-1677.178) [-1678.095] * (-1683.966) (-1678.308) [-1671.729] (-1683.539) -- 0:02:40 259000 -- (-1676.951) (-1684.115) (-1682.032) [-1676.315] * (-1684.182) (-1676.593) (-1677.607) [-1685.342] -- 0:02:40 259500 -- (-1676.483) (-1683.115) [-1675.291] (-1677.195) * [-1678.475] (-1675.943) (-1677.580) (-1681.163) -- 0:02:39 260000 -- (-1674.278) [-1679.236] (-1675.449) (-1673.982) * (-1675.626) (-1674.503) [-1679.453] (-1673.623) -- 0:02:42 Average standard deviation of split frequencies: 0.010851 260500 -- [-1677.426] (-1682.155) (-1686.634) (-1678.221) * (-1685.030) (-1673.670) (-1689.481) [-1681.137] -- 0:02:41 261000 -- (-1682.945) (-1678.906) (-1680.295) [-1674.599] * (-1679.497) [-1672.264] (-1680.522) (-1674.888) -- 0:02:41 261500 -- [-1682.021] (-1673.065) (-1677.714) (-1685.950) * (-1684.708) [-1672.803] (-1677.717) (-1682.189) -- 0:02:40 262000 -- (-1676.422) (-1680.114) (-1678.611) [-1672.270] * (-1688.085) (-1679.620) (-1682.289) [-1679.742] -- 0:02:40 262500 -- [-1676.692] (-1681.814) (-1677.839) (-1677.514) * (-1676.866) (-1676.360) (-1680.830) [-1685.300] -- 0:02:40 263000 -- (-1678.812) (-1679.001) [-1673.483] (-1675.381) * (-1680.907) [-1677.247] (-1684.343) (-1690.597) -- 0:02:39 263500 -- [-1679.513] (-1677.631) (-1682.855) (-1680.644) * (-1678.597) (-1678.304) [-1678.342] (-1679.693) -- 0:02:39 264000 -- (-1683.122) (-1683.453) [-1684.919] (-1677.700) * [-1677.290] (-1679.562) (-1687.317) (-1676.965) -- 0:02:38 264500 -- [-1678.822] (-1691.156) (-1679.190) (-1672.813) * (-1692.631) (-1675.196) (-1676.442) [-1677.050] -- 0:02:38 265000 -- (-1686.929) (-1677.954) [-1678.260] (-1675.942) * (-1689.436) (-1681.715) (-1676.567) [-1679.688] -- 0:02:40 Average standard deviation of split frequencies: 0.010042 265500 -- (-1680.387) [-1675.889] (-1680.282) (-1682.231) * [-1677.811] (-1682.207) (-1677.535) (-1675.411) -- 0:02:40 266000 -- [-1670.562] (-1672.381) (-1678.756) (-1674.548) * [-1674.419] (-1695.795) (-1675.086) (-1683.732) -- 0:02:40 266500 -- [-1675.672] (-1676.562) (-1678.280) (-1675.338) * (-1677.903) (-1683.044) (-1680.346) [-1684.445] -- 0:02:39 267000 -- [-1675.735] (-1679.942) (-1675.698) (-1682.554) * [-1675.790] (-1688.746) (-1676.095) (-1680.661) -- 0:02:39 267500 -- [-1677.168] (-1679.560) (-1681.600) (-1680.032) * (-1684.221) (-1674.397) (-1677.279) [-1678.919] -- 0:02:38 268000 -- (-1680.093) (-1677.016) [-1681.117] (-1676.938) * (-1680.209) (-1674.721) [-1674.929] (-1673.954) -- 0:02:38 268500 -- [-1674.885] (-1682.141) (-1680.727) (-1680.129) * (-1680.829) (-1676.959) [-1678.054] (-1683.668) -- 0:02:38 269000 -- (-1670.434) [-1687.283] (-1674.803) (-1673.355) * (-1678.118) [-1680.325] (-1685.985) (-1678.787) -- 0:02:37 269500 -- [-1675.202] (-1683.486) (-1681.207) (-1674.300) * [-1672.561] (-1691.967) (-1681.027) (-1677.344) -- 0:02:39 270000 -- (-1680.494) (-1681.359) [-1678.151] (-1686.033) * [-1678.439] (-1682.654) (-1689.766) (-1680.536) -- 0:02:39 Average standard deviation of split frequencies: 0.009579 270500 -- (-1690.331) (-1684.505) [-1675.461] (-1683.931) * (-1682.901) (-1681.365) (-1693.738) [-1678.683] -- 0:02:39 271000 -- [-1678.510] (-1676.678) (-1674.175) (-1686.435) * [-1674.490] (-1678.143) (-1695.529) (-1678.050) -- 0:02:38 271500 -- (-1681.143) (-1684.375) (-1676.078) [-1683.285] * (-1682.589) [-1672.528] (-1691.009) (-1683.991) -- 0:02:38 272000 -- [-1674.640] (-1684.026) (-1675.897) (-1677.079) * [-1678.770] (-1676.303) (-1681.713) (-1676.568) -- 0:02:37 272500 -- (-1680.150) (-1681.419) [-1672.197] (-1678.615) * (-1674.149) (-1674.833) [-1676.912] (-1678.487) -- 0:02:37 273000 -- [-1674.829] (-1677.114) (-1683.381) (-1677.052) * (-1674.145) (-1675.830) (-1684.455) [-1680.088] -- 0:02:37 273500 -- (-1671.490) [-1679.569] (-1676.489) (-1678.907) * (-1672.233) (-1679.484) (-1683.133) [-1671.328] -- 0:02:36 274000 -- [-1678.269] (-1675.574) (-1681.144) (-1682.354) * [-1678.088] (-1675.452) (-1683.423) (-1683.201) -- 0:02:36 274500 -- (-1676.173) (-1689.182) [-1675.521] (-1684.972) * (-1681.874) [-1685.810] (-1679.145) (-1685.189) -- 0:02:38 275000 -- (-1676.621) [-1678.012] (-1682.233) (-1684.520) * (-1685.772) (-1681.140) [-1677.953] (-1682.813) -- 0:02:38 Average standard deviation of split frequencies: 0.009394 275500 -- (-1673.209) (-1677.682) (-1672.741) [-1681.585] * (-1678.139) (-1683.451) (-1683.698) [-1677.867] -- 0:02:37 276000 -- (-1682.833) (-1678.922) [-1675.265] (-1678.523) * [-1677.531] (-1676.481) (-1676.072) (-1682.065) -- 0:02:37 276500 -- (-1674.414) (-1678.480) [-1682.121] (-1679.634) * (-1672.137) (-1679.473) [-1672.406] (-1672.478) -- 0:02:36 277000 -- [-1676.627] (-1681.712) (-1682.352) (-1682.335) * [-1673.822] (-1681.249) (-1687.849) (-1675.394) -- 0:02:36 277500 -- [-1674.768] (-1674.754) (-1680.447) (-1680.822) * (-1683.840) (-1688.850) [-1675.775] (-1679.975) -- 0:02:36 278000 -- (-1686.045) [-1673.427] (-1677.717) (-1673.218) * [-1682.429] (-1675.551) (-1688.896) (-1677.874) -- 0:02:35 278500 -- (-1689.968) (-1682.398) [-1679.214] (-1682.834) * (-1679.702) (-1681.363) (-1680.687) [-1677.997] -- 0:02:35 279000 -- (-1678.880) (-1676.951) [-1674.129] (-1674.848) * (-1681.425) [-1681.943] (-1681.332) (-1681.115) -- 0:02:37 279500 -- [-1678.834] (-1682.058) (-1689.826) (-1677.349) * (-1677.578) [-1675.458] (-1678.366) (-1679.868) -- 0:02:37 280000 -- (-1675.066) [-1672.711] (-1687.283) (-1676.827) * (-1691.783) [-1677.682] (-1669.712) (-1683.196) -- 0:02:36 Average standard deviation of split frequencies: 0.007558 280500 -- [-1672.925] (-1678.999) (-1676.232) (-1682.284) * (-1683.343) (-1675.277) (-1671.868) [-1676.352] -- 0:02:36 281000 -- [-1672.246] (-1682.249) (-1687.287) (-1686.136) * (-1678.047) [-1675.353] (-1675.162) (-1675.398) -- 0:02:36 281500 -- [-1676.398] (-1676.874) (-1678.955) (-1687.326) * [-1675.703] (-1684.947) (-1682.723) (-1682.359) -- 0:02:35 282000 -- [-1675.932] (-1679.582) (-1676.597) (-1680.964) * [-1675.790] (-1682.640) (-1688.524) (-1677.383) -- 0:02:35 282500 -- (-1673.010) (-1692.970) [-1677.847] (-1682.530) * (-1677.450) (-1678.984) (-1677.649) [-1678.126] -- 0:02:34 283000 -- (-1675.457) (-1686.623) (-1679.363) [-1672.825] * [-1680.303] (-1685.980) (-1684.924) (-1678.505) -- 0:02:34 283500 -- (-1678.469) (-1682.845) [-1680.215] (-1680.124) * (-1677.028) (-1680.779) (-1675.341) [-1675.482] -- 0:02:34 284000 -- (-1682.380) (-1682.472) (-1690.234) [-1676.128] * [-1679.191] (-1689.159) (-1686.505) (-1685.203) -- 0:02:36 284500 -- (-1677.843) [-1681.370] (-1678.076) (-1675.899) * (-1680.365) (-1674.984) (-1675.719) [-1687.870] -- 0:02:35 285000 -- (-1673.860) (-1679.443) (-1676.761) [-1679.427] * (-1678.187) (-1684.637) (-1677.375) [-1681.867] -- 0:02:35 Average standard deviation of split frequencies: 0.009615 285500 -- (-1678.943) [-1684.633] (-1673.322) (-1677.153) * (-1686.062) (-1675.924) (-1686.266) [-1674.121] -- 0:02:35 286000 -- [-1680.477] (-1681.928) (-1685.004) (-1678.448) * [-1678.118] (-1674.906) (-1683.944) (-1683.969) -- 0:02:34 286500 -- (-1679.920) [-1672.931] (-1679.810) (-1678.407) * (-1689.814) (-1675.808) [-1681.937] (-1674.547) -- 0:02:34 287000 -- [-1675.843] (-1679.443) (-1676.426) (-1694.033) * (-1678.711) (-1680.013) (-1676.179) [-1682.547] -- 0:02:34 287500 -- [-1676.003] (-1684.013) (-1677.646) (-1677.150) * (-1677.124) (-1676.472) [-1675.360] (-1672.892) -- 0:02:33 288000 -- (-1674.615) (-1676.924) (-1689.335) [-1677.196] * (-1677.699) [-1677.765] (-1677.334) (-1680.920) -- 0:02:33 288500 -- [-1672.808] (-1679.438) (-1691.489) (-1683.991) * [-1671.344] (-1680.200) (-1673.850) (-1675.425) -- 0:02:35 289000 -- [-1677.174] (-1677.636) (-1680.923) (-1687.941) * (-1674.905) (-1683.256) [-1677.074] (-1679.171) -- 0:02:34 289500 -- (-1674.797) (-1681.019) (-1677.323) [-1676.142] * [-1674.983] (-1677.426) (-1681.260) (-1679.530) -- 0:02:34 290000 -- (-1677.743) [-1676.904] (-1677.497) (-1690.747) * (-1677.539) (-1684.869) [-1678.897] (-1678.863) -- 0:02:34 Average standard deviation of split frequencies: 0.008379 290500 -- (-1679.319) (-1679.725) [-1676.784] (-1684.826) * (-1675.754) (-1679.464) [-1675.010] (-1688.319) -- 0:02:33 291000 -- [-1684.393] (-1690.223) (-1680.809) (-1676.867) * [-1674.501] (-1679.729) (-1675.450) (-1677.555) -- 0:02:33 291500 -- (-1680.413) (-1689.409) [-1672.920] (-1676.312) * (-1679.298) (-1683.054) [-1674.600] (-1678.240) -- 0:02:33 292000 -- (-1683.759) (-1682.656) [-1677.596] (-1672.124) * (-1675.462) (-1680.785) (-1679.866) [-1676.413] -- 0:02:32 292500 -- (-1678.697) (-1686.158) [-1676.455] (-1677.031) * (-1680.974) (-1678.337) [-1679.210] (-1677.444) -- 0:02:32 293000 -- (-1675.492) (-1693.835) (-1692.871) [-1673.867] * (-1679.785) (-1676.119) [-1685.731] (-1682.571) -- 0:02:32 293500 -- (-1674.773) (-1678.303) [-1683.783] (-1673.884) * [-1678.231] (-1698.602) (-1680.967) (-1678.756) -- 0:02:34 294000 -- [-1675.634] (-1684.768) (-1681.735) (-1677.347) * (-1683.360) [-1681.816] (-1673.653) (-1676.328) -- 0:02:33 294500 -- (-1672.678) (-1680.866) [-1673.369] (-1676.851) * [-1680.334] (-1675.794) (-1674.237) (-1678.105) -- 0:02:33 295000 -- (-1678.924) (-1686.504) (-1679.079) [-1676.945] * (-1685.522) (-1677.219) [-1673.169] (-1678.182) -- 0:02:32 Average standard deviation of split frequencies: 0.007432 295500 -- (-1676.628) [-1682.016] (-1678.017) (-1677.925) * (-1683.680) (-1681.358) [-1674.566] (-1678.751) -- 0:02:32 296000 -- [-1678.600] (-1674.574) (-1680.989) (-1678.185) * (-1675.467) [-1674.039] (-1679.360) (-1679.375) -- 0:02:32 296500 -- (-1680.812) [-1682.361] (-1678.220) (-1673.558) * (-1677.515) (-1679.399) [-1673.229] (-1679.328) -- 0:02:31 297000 -- (-1680.397) (-1676.885) [-1673.218] (-1681.827) * (-1670.978) (-1685.237) [-1675.806] (-1681.605) -- 0:02:31 297500 -- (-1682.629) (-1671.065) (-1681.510) [-1675.521] * (-1681.843) [-1681.351] (-1675.640) (-1700.114) -- 0:02:31 298000 -- (-1674.837) (-1677.802) [-1669.421] (-1673.452) * (-1674.744) (-1680.352) [-1675.385] (-1681.080) -- 0:02:30 298500 -- (-1675.554) (-1674.330) [-1676.875] (-1672.743) * (-1680.274) (-1672.984) [-1677.858] (-1680.772) -- 0:02:32 299000 -- (-1674.952) (-1677.352) (-1679.801) [-1677.492] * [-1677.906] (-1678.172) (-1682.350) (-1686.603) -- 0:02:32 299500 -- (-1672.181) (-1672.284) [-1675.305] (-1687.332) * (-1679.374) [-1683.179] (-1679.925) (-1685.714) -- 0:02:32 300000 -- [-1678.417] (-1677.133) (-1676.160) (-1675.261) * (-1677.854) [-1677.202] (-1678.327) (-1690.766) -- 0:02:31 Average standard deviation of split frequencies: 0.007317 300500 -- [-1669.306] (-1678.622) (-1674.876) (-1684.764) * (-1674.975) (-1671.393) [-1677.915] (-1700.188) -- 0:02:31 301000 -- (-1676.216) (-1683.877) [-1673.522] (-1674.877) * (-1686.229) (-1688.766) (-1683.473) [-1682.435] -- 0:02:30 301500 -- (-1685.181) (-1675.718) (-1680.296) [-1676.557] * (-1679.805) [-1687.211] (-1680.004) (-1682.000) -- 0:02:30 302000 -- (-1673.265) [-1674.098] (-1674.518) (-1678.508) * (-1675.210) (-1688.367) [-1676.928] (-1675.683) -- 0:02:30 302500 -- [-1675.844] (-1677.606) (-1670.026) (-1679.207) * (-1677.224) [-1678.214] (-1683.686) (-1676.052) -- 0:02:29 303000 -- (-1677.297) (-1676.282) [-1682.540] (-1673.938) * (-1674.689) [-1675.466] (-1678.751) (-1682.602) -- 0:02:31 303500 -- (-1678.741) (-1677.072) [-1677.045] (-1674.820) * [-1675.802] (-1678.626) (-1686.631) (-1681.983) -- 0:02:31 304000 -- (-1676.481) (-1681.096) (-1675.885) [-1678.079] * (-1679.823) [-1678.034] (-1687.743) (-1676.227) -- 0:02:31 304500 -- (-1683.263) (-1677.735) [-1674.946] (-1683.553) * [-1680.344] (-1674.246) (-1679.059) (-1678.537) -- 0:02:30 305000 -- (-1675.457) (-1676.032) (-1678.648) [-1677.325] * (-1676.396) (-1683.200) (-1677.495) [-1678.697] -- 0:02:30 Average standard deviation of split frequencies: 0.005649 305500 -- (-1677.358) (-1679.596) (-1673.675) [-1672.753] * (-1679.529) (-1680.373) (-1675.919) [-1674.375] -- 0:02:30 306000 -- [-1682.482] (-1680.632) (-1681.384) (-1683.243) * [-1680.145] (-1674.866) (-1675.346) (-1679.995) -- 0:02:29 306500 -- (-1679.015) (-1680.812) [-1681.941] (-1678.454) * (-1685.947) (-1678.381) (-1675.941) [-1675.303] -- 0:02:29 307000 -- (-1678.801) (-1683.259) (-1675.635) [-1680.542] * (-1679.378) [-1682.945] (-1676.640) (-1678.269) -- 0:02:28 307500 -- (-1676.272) (-1674.012) [-1677.528] (-1685.837) * (-1679.444) (-1678.248) [-1674.184] (-1685.535) -- 0:02:28 308000 -- (-1685.654) (-1682.537) (-1678.056) [-1679.735] * [-1679.105] (-1677.522) (-1681.490) (-1682.888) -- 0:02:30 308500 -- (-1672.920) (-1688.426) (-1681.583) [-1674.040] * [-1679.867] (-1680.633) (-1677.535) (-1675.978) -- 0:02:30 309000 -- (-1674.472) (-1680.136) [-1677.350] (-1675.653) * (-1676.607) (-1679.513) (-1675.548) [-1672.320] -- 0:02:29 309500 -- (-1677.858) (-1682.725) (-1674.529) [-1677.110] * (-1677.924) (-1683.127) [-1673.869] (-1675.315) -- 0:02:29 310000 -- [-1680.826] (-1678.914) (-1682.380) (-1676.209) * (-1679.621) (-1690.188) (-1679.641) [-1684.640] -- 0:02:29 Average standard deviation of split frequencies: 0.005564 310500 -- (-1676.442) (-1680.810) [-1681.173] (-1679.277) * (-1677.415) (-1680.154) [-1677.656] (-1680.719) -- 0:02:28 311000 -- (-1678.449) [-1679.516] (-1679.727) (-1679.078) * (-1681.769) (-1676.310) (-1683.066) [-1674.345] -- 0:02:28 311500 -- (-1682.199) (-1677.089) [-1675.272] (-1672.004) * (-1679.469) (-1683.806) [-1673.692] (-1676.093) -- 0:02:28 312000 -- (-1676.699) (-1673.540) [-1675.667] (-1673.518) * (-1681.301) (-1676.711) [-1673.692] (-1681.023) -- 0:02:27 312500 -- (-1685.737) (-1672.875) (-1674.757) [-1677.336] * (-1674.728) (-1675.838) [-1669.356] (-1679.827) -- 0:02:29 313000 -- (-1676.191) (-1676.005) [-1676.475] (-1677.079) * (-1682.822) (-1676.962) [-1676.037] (-1684.637) -- 0:02:29 313500 -- (-1677.164) [-1675.125] (-1681.354) (-1681.180) * (-1683.647) [-1672.600] (-1673.037) (-1677.398) -- 0:02:28 314000 -- (-1672.044) (-1677.022) [-1674.527] (-1678.587) * (-1679.564) [-1676.221] (-1684.470) (-1675.408) -- 0:02:28 314500 -- (-1673.570) (-1695.762) [-1674.170] (-1676.657) * (-1685.059) (-1676.129) [-1680.163] (-1676.431) -- 0:02:28 315000 -- (-1675.639) [-1679.643] (-1690.115) (-1677.024) * (-1682.553) (-1678.362) [-1678.443] (-1676.780) -- 0:02:27 Average standard deviation of split frequencies: 0.006962 315500 -- (-1689.194) (-1684.172) [-1681.616] (-1679.809) * (-1676.927) (-1686.880) (-1682.052) [-1681.407] -- 0:02:27 316000 -- (-1680.567) (-1686.731) [-1677.200] (-1685.547) * (-1675.459) [-1682.649] (-1674.073) (-1682.854) -- 0:02:27 316500 -- (-1688.633) (-1678.268) (-1679.473) [-1679.409] * (-1677.329) (-1687.737) [-1671.094] (-1681.548) -- 0:02:26 317000 -- (-1686.357) (-1680.184) [-1679.887] (-1675.427) * (-1676.119) [-1678.621] (-1676.627) (-1679.671) -- 0:02:26 317500 -- (-1678.250) (-1683.720) (-1679.621) [-1677.730] * (-1681.562) (-1680.685) [-1680.654] (-1678.510) -- 0:02:28 318000 -- (-1675.438) (-1680.315) (-1676.465) [-1672.169] * (-1678.737) [-1672.295] (-1687.973) (-1681.766) -- 0:02:27 318500 -- (-1681.404) [-1677.434] (-1680.291) (-1676.702) * (-1678.878) (-1683.406) [-1678.142] (-1678.373) -- 0:02:27 319000 -- (-1679.530) [-1676.530] (-1676.728) (-1672.166) * [-1684.508] (-1679.224) (-1679.561) (-1694.548) -- 0:02:27 319500 -- [-1680.669] (-1685.710) (-1675.191) (-1679.160) * (-1687.133) [-1676.819] (-1677.913) (-1685.875) -- 0:02:26 320000 -- [-1680.533] (-1675.508) (-1681.336) (-1676.249) * (-1686.012) [-1681.577] (-1681.099) (-1683.824) -- 0:02:26 Average standard deviation of split frequencies: 0.006370 320500 -- (-1674.904) [-1675.037] (-1674.876) (-1678.758) * [-1675.449] (-1682.420) (-1677.220) (-1676.354) -- 0:02:26 321000 -- [-1681.924] (-1679.928) (-1677.638) (-1681.778) * (-1681.145) [-1681.736] (-1678.359) (-1684.463) -- 0:02:25 321500 -- (-1681.414) [-1675.385] (-1682.952) (-1680.481) * [-1677.431] (-1675.217) (-1681.226) (-1681.696) -- 0:02:25 322000 -- (-1685.895) (-1685.027) (-1683.421) [-1676.195] * (-1678.039) (-1676.673) (-1683.298) [-1676.144] -- 0:02:25 322500 -- (-1685.860) (-1680.724) (-1678.831) [-1677.646] * (-1678.449) (-1681.353) [-1682.463] (-1677.617) -- 0:02:27 323000 -- (-1675.599) [-1679.278] (-1679.234) (-1686.636) * (-1680.867) [-1674.031] (-1683.453) (-1676.463) -- 0:02:26 323500 -- (-1676.146) [-1674.458] (-1683.395) (-1682.967) * [-1676.276] (-1674.904) (-1681.011) (-1674.778) -- 0:02:26 324000 -- [-1677.300] (-1677.511) (-1677.971) (-1677.976) * (-1672.934) [-1680.958] (-1688.462) (-1683.508) -- 0:02:26 324500 -- [-1674.161] (-1677.073) (-1674.127) (-1683.476) * (-1680.308) (-1681.037) [-1676.119] (-1677.720) -- 0:02:25 325000 -- [-1683.193] (-1679.385) (-1679.766) (-1682.192) * (-1679.043) (-1680.794) [-1674.661] (-1676.099) -- 0:02:25 Average standard deviation of split frequencies: 0.003615 325500 -- (-1679.634) (-1675.216) [-1680.953] (-1679.233) * (-1679.170) (-1675.544) [-1678.247] (-1672.669) -- 0:02:25 326000 -- [-1676.365] (-1678.663) (-1686.689) (-1673.234) * (-1680.819) [-1675.640] (-1676.706) (-1678.365) -- 0:02:24 326500 -- (-1673.241) [-1671.360] (-1682.827) (-1672.649) * (-1683.545) (-1682.713) (-1683.326) [-1676.104] -- 0:02:24 327000 -- (-1682.357) (-1682.239) (-1676.870) [-1678.466] * (-1679.276) (-1681.437) [-1675.371] (-1679.080) -- 0:02:26 327500 -- (-1672.482) [-1677.783] (-1675.865) (-1685.563) * (-1676.533) [-1679.033] (-1679.681) (-1675.569) -- 0:02:25 328000 -- (-1681.855) [-1676.577] (-1672.119) (-1680.727) * (-1680.338) (-1675.442) (-1677.008) [-1677.556] -- 0:02:25 328500 -- (-1678.456) (-1684.303) [-1677.939] (-1674.779) * (-1673.534) [-1674.229] (-1677.846) (-1675.532) -- 0:02:25 329000 -- [-1679.141] (-1691.757) (-1682.524) (-1678.119) * (-1680.994) (-1681.804) (-1681.087) [-1677.327] -- 0:02:24 329500 -- (-1683.845) (-1684.397) (-1679.180) [-1670.699] * (-1679.757) (-1675.531) (-1676.930) [-1676.500] -- 0:02:24 330000 -- (-1686.473) (-1681.813) (-1676.138) [-1673.879] * (-1679.740) (-1682.067) [-1681.048] (-1674.870) -- 0:02:24 Average standard deviation of split frequencies: 0.004039 330500 -- (-1678.857) (-1685.743) (-1675.854) [-1678.764] * [-1671.052] (-1678.336) (-1678.497) (-1683.356) -- 0:02:23 331000 -- (-1675.299) (-1681.356) (-1680.344) [-1670.058] * (-1671.913) (-1679.502) [-1674.909] (-1681.414) -- 0:02:23 331500 -- (-1673.176) (-1681.770) [-1675.507] (-1669.561) * (-1676.261) [-1671.821] (-1676.604) (-1686.598) -- 0:02:25 332000 -- (-1674.154) [-1676.181] (-1674.973) (-1676.367) * [-1675.461] (-1672.265) (-1675.050) (-1679.878) -- 0:02:24 332500 -- [-1675.544] (-1676.956) (-1678.172) (-1673.308) * (-1674.460) (-1677.258) (-1676.404) [-1675.063] -- 0:02:24 333000 -- (-1679.603) [-1675.171] (-1681.474) (-1679.071) * (-1675.286) [-1674.432] (-1681.764) (-1673.495) -- 0:02:24 333500 -- (-1686.778) (-1680.092) (-1689.653) [-1675.532] * (-1671.782) (-1672.923) [-1685.135] (-1679.020) -- 0:02:23 334000 -- (-1672.848) (-1677.592) [-1676.022] (-1684.208) * [-1672.158] (-1674.762) (-1684.740) (-1677.800) -- 0:02:23 334500 -- (-1678.850) (-1677.877) (-1689.046) [-1678.900] * [-1679.457] (-1678.309) (-1684.702) (-1672.182) -- 0:02:23 335000 -- [-1673.875] (-1684.108) (-1692.256) (-1681.213) * (-1677.372) (-1684.249) [-1684.610] (-1675.673) -- 0:02:22 Average standard deviation of split frequencies: 0.004443 335500 -- (-1681.406) (-1680.984) [-1684.820] (-1682.190) * [-1678.805] (-1681.006) (-1685.576) (-1681.617) -- 0:02:22 336000 -- (-1680.727) [-1670.393] (-1680.545) (-1684.849) * (-1684.376) (-1681.554) (-1678.873) [-1673.403] -- 0:02:22 336500 -- (-1677.220) (-1678.561) [-1682.753] (-1680.035) * (-1678.478) (-1679.361) [-1676.164] (-1692.270) -- 0:02:23 337000 -- [-1671.535] (-1675.606) (-1678.396) (-1674.275) * (-1688.056) [-1684.497] (-1680.565) (-1679.812) -- 0:02:23 337500 -- (-1688.596) (-1679.549) [-1674.718] (-1673.334) * (-1683.219) (-1680.774) (-1679.128) [-1674.216] -- 0:02:23 338000 -- (-1674.099) (-1674.173) [-1682.822] (-1684.469) * (-1682.107) [-1670.018] (-1676.709) (-1680.294) -- 0:02:22 338500 -- [-1674.042] (-1674.786) (-1678.588) (-1692.078) * (-1675.958) (-1680.978) [-1676.067] (-1683.371) -- 0:02:22 339000 -- (-1682.592) (-1684.572) [-1676.506] (-1674.831) * (-1678.409) (-1673.430) [-1671.427] (-1683.381) -- 0:02:22 339500 -- [-1682.355] (-1677.233) (-1677.017) (-1674.008) * [-1681.601] (-1676.275) (-1671.105) (-1683.138) -- 0:02:22 340000 -- [-1677.217] (-1683.999) (-1693.012) (-1688.350) * [-1679.801] (-1676.690) (-1683.288) (-1679.937) -- 0:02:21 Average standard deviation of split frequencies: 0.005304 340500 -- [-1674.438] (-1674.725) (-1676.558) (-1675.505) * (-1675.840) (-1677.127) (-1682.742) [-1686.171] -- 0:02:21 341000 -- (-1675.999) (-1681.151) [-1680.224] (-1686.688) * (-1690.190) [-1685.807] (-1677.644) (-1681.596) -- 0:02:23 341500 -- [-1672.807] (-1673.338) (-1677.612) (-1676.717) * (-1682.325) (-1679.845) (-1680.508) [-1679.477] -- 0:02:22 342000 -- (-1672.380) (-1682.246) [-1674.752] (-1677.089) * (-1681.641) [-1673.336] (-1687.166) (-1678.620) -- 0:02:22 342500 -- (-1680.768) (-1680.227) [-1676.405] (-1682.176) * (-1684.534) (-1676.429) [-1674.252] (-1678.078) -- 0:02:22 343000 -- [-1685.083] (-1679.225) (-1676.049) (-1697.418) * (-1680.175) (-1682.589) [-1677.735] (-1673.955) -- 0:02:21 343500 -- [-1675.444] (-1678.209) (-1680.693) (-1682.012) * (-1671.810) (-1683.186) (-1683.689) [-1679.159] -- 0:02:21 344000 -- (-1676.613) (-1676.815) (-1681.566) [-1678.024] * [-1672.136] (-1681.665) (-1676.494) (-1679.432) -- 0:02:21 344500 -- (-1691.314) (-1672.721) (-1672.779) [-1685.144] * (-1677.197) [-1673.404] (-1680.939) (-1682.543) -- 0:02:20 345000 -- (-1675.084) (-1684.073) [-1675.874] (-1682.836) * (-1679.272) (-1675.351) [-1671.760] (-1687.886) -- 0:02:20 Average standard deviation of split frequencies: 0.004314 345500 -- [-1678.378] (-1678.405) (-1678.097) (-1686.144) * (-1679.034) (-1675.247) (-1677.710) [-1682.949] -- 0:02:22 346000 -- (-1675.383) (-1679.542) (-1671.743) [-1675.512] * (-1686.517) [-1677.960] (-1673.631) (-1681.140) -- 0:02:21 346500 -- (-1675.036) (-1680.529) [-1676.514] (-1680.450) * [-1678.243] (-1681.208) (-1677.478) (-1676.057) -- 0:02:21 347000 -- (-1681.808) (-1687.084) [-1675.340] (-1679.712) * (-1684.055) [-1678.260] (-1678.291) (-1677.491) -- 0:02:21 347500 -- [-1679.089] (-1679.677) (-1675.619) (-1682.155) * (-1681.242) (-1680.816) [-1681.085] (-1677.655) -- 0:02:20 348000 -- (-1675.992) (-1687.120) [-1680.207] (-1679.666) * (-1680.175) (-1681.479) [-1685.163] (-1691.593) -- 0:02:20 348500 -- (-1672.431) (-1683.400) (-1680.397) [-1673.959] * (-1676.597) (-1680.953) (-1679.693) [-1681.129] -- 0:02:20 349000 -- (-1675.306) (-1682.581) (-1680.611) [-1672.996] * (-1677.029) (-1675.586) [-1679.667] (-1683.272) -- 0:02:19 349500 -- (-1673.283) (-1685.399) (-1677.120) [-1675.014] * (-1682.728) [-1674.953] (-1679.877) (-1680.666) -- 0:02:19 350000 -- (-1680.573) [-1677.983] (-1680.048) (-1679.543) * (-1675.913) [-1678.003] (-1682.365) (-1671.188) -- 0:02:21 Average standard deviation of split frequencies: 0.002689 350500 -- (-1681.194) (-1678.715) [-1669.843] (-1677.415) * (-1682.015) [-1676.051] (-1682.030) (-1671.608) -- 0:02:20 351000 -- (-1679.175) [-1675.079] (-1671.863) (-1674.144) * (-1676.644) [-1677.192] (-1681.649) (-1672.300) -- 0:02:20 351500 -- (-1682.017) [-1676.683] (-1677.320) (-1680.250) * (-1680.565) (-1685.447) (-1677.657) [-1676.879] -- 0:02:20 352000 -- [-1674.641] (-1676.012) (-1681.408) (-1680.969) * (-1673.176) (-1678.171) [-1676.945] (-1675.339) -- 0:02:19 352500 -- (-1682.284) [-1686.985] (-1676.557) (-1682.449) * [-1679.424] (-1677.844) (-1679.295) (-1677.039) -- 0:02:19 353000 -- (-1682.281) (-1676.057) [-1678.342] (-1679.506) * (-1678.310) (-1678.680) [-1682.620] (-1682.800) -- 0:02:19 353500 -- [-1673.836] (-1682.700) (-1681.285) (-1676.345) * (-1678.774) (-1676.946) (-1678.344) [-1679.385] -- 0:02:18 354000 -- (-1687.558) (-1677.093) [-1672.853] (-1690.086) * (-1679.669) [-1673.024] (-1681.607) (-1677.320) -- 0:02:18 354500 -- (-1689.197) (-1672.555) [-1677.792] (-1679.585) * (-1673.517) (-1682.804) [-1676.597] (-1692.724) -- 0:02:20 355000 -- (-1683.813) (-1680.877) (-1677.902) [-1674.220] * (-1673.808) (-1674.078) (-1679.616) [-1676.667] -- 0:02:19 Average standard deviation of split frequencies: 0.001766 355500 -- [-1678.998] (-1675.563) (-1675.691) (-1676.806) * (-1673.877) [-1677.016] (-1687.016) (-1679.256) -- 0:02:19 356000 -- (-1678.531) (-1675.169) (-1673.826) [-1679.219] * (-1669.055) (-1681.909) (-1685.342) [-1682.004] -- 0:02:19 356500 -- (-1680.080) (-1678.937) (-1677.548) [-1681.228] * (-1671.381) [-1677.945] (-1684.936) (-1677.775) -- 0:02:18 357000 -- (-1688.639) [-1678.641] (-1677.421) (-1691.121) * [-1672.707] (-1679.764) (-1692.955) (-1676.872) -- 0:02:18 357500 -- (-1684.142) [-1677.879] (-1677.520) (-1680.206) * (-1684.449) [-1684.910] (-1684.726) (-1674.970) -- 0:02:18 358000 -- (-1677.846) (-1688.154) (-1675.599) [-1678.677] * (-1676.370) [-1681.227] (-1679.322) (-1688.445) -- 0:02:18 358500 -- (-1688.960) [-1677.284] (-1676.808) (-1685.670) * [-1677.554] (-1676.552) (-1676.634) (-1677.610) -- 0:02:17 359000 -- (-1679.030) (-1681.384) (-1677.156) [-1676.500] * [-1676.312] (-1681.568) (-1694.570) (-1673.108) -- 0:02:19 359500 -- (-1678.582) (-1680.678) (-1675.204) [-1677.273] * (-1678.423) [-1681.684] (-1679.404) (-1685.002) -- 0:02:18 360000 -- (-1686.051) (-1682.422) (-1679.291) [-1679.206] * (-1681.836) (-1684.240) [-1673.691] (-1678.880) -- 0:02:18 Average standard deviation of split frequencies: 0.003485 360500 -- (-1692.997) [-1682.608] (-1672.350) (-1673.325) * [-1671.461] (-1679.842) (-1678.478) (-1677.425) -- 0:02:18 361000 -- (-1689.368) [-1696.212] (-1694.315) (-1675.873) * (-1684.749) (-1686.004) [-1674.573] (-1681.854) -- 0:02:18 361500 -- [-1688.318] (-1684.888) (-1693.858) (-1681.978) * (-1679.493) [-1676.235] (-1678.711) (-1677.416) -- 0:02:17 362000 -- (-1686.822) (-1684.711) (-1675.091) [-1674.304] * (-1678.004) (-1674.835) [-1675.289] (-1679.682) -- 0:02:17 362500 -- (-1678.617) (-1685.120) [-1672.237] (-1678.372) * (-1679.023) [-1679.884] (-1675.025) (-1675.613) -- 0:02:17 363000 -- (-1684.857) (-1680.454) (-1681.173) [-1681.614] * (-1676.409) (-1674.774) (-1679.889) [-1672.190] -- 0:02:16 363500 -- (-1688.345) [-1678.919] (-1683.527) (-1679.032) * (-1676.702) (-1676.695) (-1685.064) [-1676.401] -- 0:02:16 364000 -- (-1678.275) (-1681.030) (-1680.486) [-1684.065] * (-1682.324) (-1678.121) [-1684.353] (-1684.676) -- 0:02:18 364500 -- (-1684.841) (-1675.736) (-1681.251) [-1678.294] * (-1676.947) (-1683.515) (-1675.815) [-1672.367] -- 0:02:17 365000 -- (-1685.310) (-1677.220) [-1681.833] (-1681.014) * (-1680.505) (-1679.919) (-1689.938) [-1678.666] -- 0:02:17 Average standard deviation of split frequencies: 0.003864 365500 -- (-1693.333) (-1678.451) [-1672.190] (-1681.533) * (-1674.999) (-1675.511) [-1674.058] (-1686.418) -- 0:02:17 366000 -- (-1686.741) (-1677.536) (-1674.874) [-1684.726] * (-1678.512) [-1674.184] (-1678.908) (-1674.018) -- 0:02:16 366500 -- (-1677.323) (-1680.554) (-1679.053) [-1683.935] * (-1680.700) (-1675.874) [-1680.887] (-1687.180) -- 0:02:16 367000 -- [-1681.852] (-1686.424) (-1676.860) (-1679.764) * (-1676.982) [-1674.817] (-1681.531) (-1679.558) -- 0:02:16 367500 -- [-1678.254] (-1681.230) (-1681.046) (-1678.791) * (-1683.428) [-1679.266] (-1679.930) (-1678.152) -- 0:02:15 368000 -- (-1680.380) (-1678.591) (-1673.466) [-1677.048] * (-1676.463) (-1677.068) [-1675.284] (-1678.649) -- 0:02:15 368500 -- (-1692.958) (-1682.931) [-1678.517] (-1683.828) * (-1681.661) (-1681.532) (-1682.627) [-1674.511] -- 0:02:15 369000 -- (-1686.432) [-1671.989] (-1681.765) (-1673.489) * [-1676.335] (-1675.927) (-1677.584) (-1685.337) -- 0:02:16 369500 -- (-1683.351) [-1672.815] (-1683.647) (-1684.161) * (-1683.506) [-1676.139] (-1676.280) (-1683.568) -- 0:02:16 370000 -- [-1679.712] (-1682.718) (-1679.295) (-1674.713) * (-1680.745) (-1678.336) [-1674.608] (-1676.309) -- 0:02:16 Average standard deviation of split frequencies: 0.004239 370500 -- (-1693.333) (-1677.527) [-1678.821] (-1684.573) * [-1675.659] (-1673.581) (-1680.916) (-1679.555) -- 0:02:15 371000 -- (-1682.155) (-1677.060) [-1680.245] (-1683.783) * (-1676.245) (-1671.926) [-1675.603] (-1682.591) -- 0:02:15 371500 -- (-1680.891) [-1678.124] (-1676.379) (-1677.009) * [-1672.384] (-1681.844) (-1679.759) (-1672.842) -- 0:02:15 372000 -- (-1681.328) (-1677.000) (-1675.636) [-1678.250] * (-1676.911) (-1678.202) (-1683.833) [-1682.777] -- 0:02:15 372500 -- (-1677.147) (-1678.960) [-1679.157] (-1679.693) * (-1683.126) (-1676.029) [-1676.478] (-1679.408) -- 0:02:14 373000 -- (-1680.760) [-1680.577] (-1685.023) (-1685.421) * (-1679.817) [-1675.872] (-1678.586) (-1684.463) -- 0:02:14 373500 -- (-1680.123) (-1675.530) [-1674.129] (-1676.370) * [-1675.418] (-1676.448) (-1678.746) (-1685.832) -- 0:02:15 374000 -- [-1675.424] (-1685.675) (-1679.429) (-1677.423) * (-1678.108) (-1680.514) [-1673.953] (-1683.956) -- 0:02:15 374500 -- (-1679.464) (-1684.427) [-1671.440] (-1682.830) * (-1684.324) (-1681.547) (-1681.064) [-1673.120] -- 0:02:15 375000 -- (-1683.567) (-1676.379) [-1674.276] (-1684.171) * (-1696.564) [-1679.556] (-1680.516) (-1679.976) -- 0:02:15 Average standard deviation of split frequencies: 0.003761 375500 -- (-1681.103) (-1675.128) [-1673.743] (-1677.231) * (-1689.075) (-1678.633) [-1674.824] (-1678.052) -- 0:02:14 376000 -- (-1677.281) [-1675.700] (-1678.458) (-1676.135) * (-1684.215) [-1681.457] (-1682.695) (-1690.276) -- 0:02:14 376500 -- [-1686.962] (-1682.155) (-1681.115) (-1676.973) * (-1679.046) (-1685.390) [-1678.038] (-1677.605) -- 0:02:14 377000 -- (-1677.116) (-1680.369) (-1687.756) [-1678.941] * (-1676.980) (-1683.259) (-1694.509) [-1677.232] -- 0:02:13 377500 -- [-1680.938] (-1673.717) (-1685.351) (-1677.204) * (-1678.314) (-1677.662) (-1679.258) [-1676.739] -- 0:02:13 378000 -- [-1679.015] (-1681.128) (-1685.929) (-1679.797) * [-1677.410] (-1679.203) (-1676.707) (-1678.031) -- 0:02:14 378500 -- [-1673.318] (-1676.248) (-1678.670) (-1678.110) * (-1677.080) (-1677.519) [-1675.202] (-1678.408) -- 0:02:14 379000 -- (-1671.781) (-1687.515) [-1682.616] (-1676.059) * (-1678.658) [-1675.336] (-1680.355) (-1678.337) -- 0:02:14 379500 -- (-1683.627) [-1674.765] (-1677.507) (-1679.173) * (-1679.871) (-1683.733) (-1671.826) [-1674.726] -- 0:02:14 380000 -- [-1675.593] (-1674.415) (-1674.530) (-1689.603) * (-1684.153) (-1678.607) [-1674.729] (-1679.903) -- 0:02:13 Average standard deviation of split frequencies: 0.002477 380500 -- (-1677.673) [-1670.925] (-1675.937) (-1682.943) * (-1690.878) (-1676.494) [-1677.800] (-1679.881) -- 0:02:13 381000 -- (-1682.358) (-1684.246) [-1679.216] (-1693.213) * (-1680.802) (-1679.292) [-1681.690] (-1679.352) -- 0:02:13 381500 -- [-1674.895] (-1679.145) (-1679.431) (-1679.379) * (-1682.314) (-1678.243) (-1676.467) [-1675.445] -- 0:02:12 382000 -- [-1674.753] (-1675.953) (-1679.182) (-1677.189) * (-1676.123) [-1677.856] (-1677.812) (-1677.501) -- 0:02:12 382500 -- (-1685.268) (-1674.112) [-1672.171] (-1683.204) * (-1680.416) [-1677.184] (-1683.538) (-1674.425) -- 0:02:12 383000 -- [-1678.149] (-1677.449) (-1679.876) (-1684.408) * [-1677.718] (-1677.406) (-1676.722) (-1680.093) -- 0:02:13 383500 -- (-1680.566) (-1678.806) (-1678.944) [-1676.634] * [-1677.397] (-1675.423) (-1687.767) (-1682.336) -- 0:02:13 384000 -- (-1678.415) (-1675.934) [-1669.265] (-1683.044) * (-1675.151) [-1677.650] (-1677.569) (-1683.729) -- 0:02:13 384500 -- (-1673.500) [-1677.670] (-1675.500) (-1679.422) * (-1679.374) [-1674.614] (-1683.990) (-1674.862) -- 0:02:12 385000 -- [-1674.963] (-1683.306) (-1677.331) (-1677.351) * [-1676.328] (-1682.280) (-1679.085) (-1683.989) -- 0:02:12 Average standard deviation of split frequencies: 0.002443 385500 -- [-1676.163] (-1679.954) (-1675.994) (-1687.892) * (-1676.265) [-1674.189] (-1676.653) (-1670.792) -- 0:02:12 386000 -- [-1671.050] (-1679.607) (-1676.967) (-1689.337) * [-1683.962] (-1675.189) (-1678.829) (-1683.586) -- 0:02:12 386500 -- (-1674.410) (-1681.173) [-1679.874] (-1682.479) * (-1674.129) [-1676.580] (-1680.771) (-1680.771) -- 0:02:11 387000 -- (-1676.724) (-1678.390) (-1690.930) [-1672.077] * [-1676.771] (-1676.316) (-1675.352) (-1683.117) -- 0:02:11 387500 -- [-1682.369] (-1677.752) (-1688.488) (-1677.303) * (-1676.728) [-1672.538] (-1678.057) (-1679.363) -- 0:02:12 388000 -- (-1678.128) (-1685.698) (-1682.668) [-1677.403] * (-1673.724) [-1674.369] (-1675.851) (-1682.258) -- 0:02:12 388500 -- (-1679.405) [-1673.691] (-1680.773) (-1680.504) * (-1677.011) (-1680.807) [-1682.234] (-1681.070) -- 0:02:12 389000 -- (-1676.480) (-1680.621) (-1678.635) [-1677.227] * (-1685.120) (-1681.550) [-1675.785] (-1687.889) -- 0:02:11 389500 -- (-1676.301) [-1676.298] (-1675.285) (-1678.065) * (-1674.343) [-1675.928] (-1690.335) (-1681.817) -- 0:02:11 390000 -- (-1677.185) (-1683.913) [-1677.720] (-1678.523) * (-1680.425) (-1676.608) (-1681.733) [-1676.919] -- 0:02:11 Average standard deviation of split frequencies: 0.002413 390500 -- (-1680.393) (-1676.681) [-1675.286] (-1675.786) * (-1682.898) [-1676.877] (-1681.441) (-1685.848) -- 0:02:11 391000 -- (-1682.601) (-1677.970) [-1675.710] (-1673.922) * (-1678.832) [-1679.637] (-1678.794) (-1677.813) -- 0:02:10 391500 -- (-1677.217) (-1677.908) [-1677.514] (-1678.269) * (-1674.432) [-1678.336] (-1677.862) (-1674.212) -- 0:02:10 392000 -- (-1676.862) (-1676.230) [-1674.314] (-1679.788) * (-1680.140) (-1683.393) [-1671.623] (-1680.266) -- 0:02:10 392500 -- [-1674.738] (-1680.840) (-1680.110) (-1686.482) * (-1686.729) (-1686.290) (-1672.943) [-1676.623] -- 0:02:11 393000 -- [-1673.543] (-1683.721) (-1684.329) (-1684.159) * [-1680.394] (-1684.595) (-1676.966) (-1686.201) -- 0:02:11 393500 -- (-1675.666) [-1677.955] (-1674.179) (-1679.368) * (-1677.033) (-1682.030) [-1676.241] (-1678.427) -- 0:02:11 394000 -- (-1684.706) (-1677.332) (-1675.939) [-1681.756] * (-1683.755) (-1675.577) [-1675.549] (-1676.931) -- 0:02:10 394500 -- (-1678.755) (-1677.840) (-1679.442) [-1676.944] * (-1682.536) [-1671.650] (-1677.270) (-1680.859) -- 0:02:10 395000 -- (-1671.705) (-1680.189) [-1679.055] (-1677.071) * (-1683.566) (-1681.664) [-1670.625] (-1676.674) -- 0:02:10 Average standard deviation of split frequencies: 0.001984 395500 -- (-1673.199) (-1681.085) [-1681.182] (-1681.775) * [-1673.946] (-1677.044) (-1686.445) (-1674.728) -- 0:02:09 396000 -- [-1678.643] (-1679.803) (-1684.779) (-1676.880) * (-1679.224) (-1679.311) (-1686.775) [-1672.887] -- 0:02:09 396500 -- (-1679.888) [-1678.826] (-1681.703) (-1686.315) * (-1683.128) (-1678.901) (-1690.162) [-1670.833] -- 0:02:09 397000 -- (-1676.289) [-1672.733] (-1684.252) (-1680.424) * (-1690.208) (-1684.654) (-1676.645) [-1675.654] -- 0:02:09 397500 -- [-1670.308] (-1678.284) (-1676.185) (-1679.954) * (-1678.546) (-1678.039) (-1674.221) [-1676.141] -- 0:02:10 398000 -- (-1674.459) [-1675.578] (-1673.726) (-1682.277) * [-1678.854] (-1689.454) (-1675.648) (-1674.513) -- 0:02:10 398500 -- (-1681.090) (-1694.881) (-1675.663) [-1682.569] * (-1685.064) (-1675.297) (-1679.547) [-1672.857] -- 0:02:09 399000 -- (-1677.595) (-1680.186) (-1683.371) [-1677.956] * (-1676.595) [-1679.626] (-1675.355) (-1679.946) -- 0:02:09 399500 -- (-1679.588) (-1678.635) (-1673.900) [-1673.533] * (-1682.767) [-1677.342] (-1676.138) (-1671.648) -- 0:02:09 400000 -- (-1680.655) [-1679.216] (-1675.184) (-1679.427) * (-1679.181) (-1673.277) (-1687.443) [-1676.419] -- 0:02:09 Average standard deviation of split frequencies: 0.003530 400500 -- [-1674.436] (-1680.173) (-1678.768) (-1684.726) * [-1673.740] (-1676.444) (-1687.217) (-1679.949) -- 0:02:08 401000 -- (-1678.822) (-1679.955) (-1676.033) [-1678.245] * [-1677.476] (-1669.138) (-1681.016) (-1683.598) -- 0:02:08 401500 -- (-1678.148) [-1676.937] (-1675.049) (-1679.426) * (-1681.267) [-1675.878] (-1692.340) (-1678.715) -- 0:02:08 402000 -- (-1682.849) (-1675.955) [-1673.423] (-1680.419) * (-1676.212) (-1687.554) [-1673.520] (-1682.312) -- 0:02:09 402500 -- (-1680.110) [-1676.673] (-1672.766) (-1682.266) * (-1676.132) (-1685.753) [-1675.575] (-1678.319) -- 0:02:09 403000 -- (-1672.705) (-1680.199) (-1676.227) [-1677.918] * [-1678.673] (-1677.779) (-1681.194) (-1675.570) -- 0:02:08 403500 -- (-1676.649) (-1682.161) [-1678.079] (-1679.367) * (-1683.658) (-1678.660) (-1674.674) [-1678.255] -- 0:02:08 404000 -- (-1673.878) [-1673.606] (-1673.855) (-1683.772) * (-1683.620) (-1683.243) (-1680.796) [-1679.775] -- 0:02:08 404500 -- [-1671.062] (-1670.395) (-1682.658) (-1683.895) * (-1680.618) [-1684.875] (-1682.558) (-1674.446) -- 0:02:08 405000 -- (-1680.784) (-1675.028) [-1677.664] (-1689.065) * (-1677.671) [-1674.465] (-1678.709) (-1683.620) -- 0:02:07 Average standard deviation of split frequencies: 0.002322 405500 -- (-1679.973) (-1674.791) (-1687.163) [-1682.061] * (-1681.063) (-1682.641) (-1683.600) [-1686.046] -- 0:02:07 406000 -- (-1680.683) (-1676.701) (-1674.507) [-1676.922] * [-1677.261] (-1691.444) (-1688.265) (-1679.952) -- 0:02:07 406500 -- (-1678.745) (-1676.616) (-1676.120) [-1676.046] * (-1676.444) (-1686.620) (-1676.225) [-1678.346] -- 0:02:07 407000 -- (-1680.014) [-1677.081] (-1675.725) (-1686.180) * (-1677.934) (-1678.893) (-1678.305) [-1678.790] -- 0:02:08 407500 -- (-1682.371) [-1681.463] (-1676.534) (-1678.137) * (-1673.029) (-1676.044) (-1685.008) [-1674.168] -- 0:02:07 408000 -- (-1678.702) [-1672.923] (-1680.688) (-1675.303) * (-1670.807) (-1678.192) [-1678.528] (-1672.000) -- 0:02:07 408500 -- (-1685.335) (-1680.420) (-1683.601) [-1675.829] * [-1673.520] (-1678.910) (-1678.115) (-1669.445) -- 0:02:07 409000 -- (-1681.879) [-1685.571] (-1682.661) (-1678.848) * [-1681.059] (-1679.964) (-1679.866) (-1676.386) -- 0:02:07 409500 -- [-1674.756] (-1682.535) (-1676.085) (-1680.564) * [-1681.548] (-1679.148) (-1676.960) (-1693.699) -- 0:02:06 410000 -- (-1680.417) (-1679.057) (-1675.662) [-1672.858] * (-1680.270) [-1677.509] (-1675.709) (-1679.431) -- 0:02:06 Average standard deviation of split frequencies: 0.003061 410500 -- (-1678.652) [-1684.393] (-1676.449) (-1683.227) * (-1684.862) [-1675.246] (-1676.173) (-1681.091) -- 0:02:06 411000 -- (-1682.029) (-1681.574) (-1679.223) [-1675.438] * (-1683.432) (-1679.196) [-1677.489] (-1680.124) -- 0:02:06 411500 -- (-1678.826) [-1676.814] (-1672.290) (-1674.676) * (-1672.837) [-1677.053] (-1682.940) (-1672.455) -- 0:02:07 412000 -- (-1681.460) [-1675.015] (-1674.807) (-1674.184) * (-1675.488) [-1680.474] (-1683.133) (-1681.341) -- 0:02:07 412500 -- (-1675.465) (-1675.390) (-1676.653) [-1676.485] * (-1687.768) (-1674.110) [-1676.468] (-1685.138) -- 0:02:06 413000 -- (-1676.226) [-1676.754] (-1676.679) (-1677.653) * (-1680.516) (-1678.666) [-1677.112] (-1682.811) -- 0:02:06 413500 -- (-1682.128) (-1681.760) [-1685.997] (-1679.789) * (-1679.427) (-1686.071) [-1673.357] (-1674.862) -- 0:02:06 414000 -- (-1681.204) (-1675.100) (-1683.266) [-1680.362] * [-1672.844] (-1677.589) (-1680.660) (-1676.161) -- 0:02:05 414500 -- (-1679.191) [-1678.217] (-1677.641) (-1674.858) * (-1680.561) (-1682.669) (-1680.802) [-1678.833] -- 0:02:05 415000 -- (-1676.023) (-1682.514) (-1675.804) [-1679.831] * (-1675.226) [-1673.913] (-1681.036) (-1682.496) -- 0:02:05 Average standard deviation of split frequencies: 0.002644 415500 -- (-1683.106) (-1680.486) (-1675.200) [-1677.369] * (-1682.993) (-1677.337) (-1685.189) [-1672.888] -- 0:02:05 416000 -- (-1676.189) [-1684.807] (-1680.210) (-1679.763) * [-1676.972] (-1683.474) (-1681.172) (-1675.505) -- 0:02:04 416500 -- (-1673.477) (-1679.578) [-1674.781] (-1685.104) * (-1684.486) (-1673.940) (-1679.133) [-1679.513] -- 0:02:06 417000 -- (-1677.316) (-1680.794) (-1674.445) [-1680.473] * [-1683.535] (-1675.048) (-1683.237) (-1677.453) -- 0:02:05 417500 -- (-1676.283) [-1680.700] (-1686.692) (-1672.844) * (-1675.123) (-1683.456) [-1678.509] (-1675.876) -- 0:02:05 418000 -- (-1678.646) (-1673.193) [-1681.609] (-1677.602) * [-1681.867] (-1678.130) (-1677.502) (-1685.386) -- 0:02:05 418500 -- (-1676.605) (-1677.369) (-1682.101) [-1678.345] * (-1677.353) [-1677.955] (-1673.703) (-1682.669) -- 0:02:05 419000 -- (-1678.078) (-1675.825) [-1677.937] (-1688.145) * (-1682.484) (-1675.690) [-1672.136] (-1675.344) -- 0:02:04 419500 -- [-1673.905] (-1685.170) (-1672.637) (-1677.873) * [-1678.022] (-1683.882) (-1685.772) (-1676.123) -- 0:02:04 420000 -- (-1680.976) (-1674.782) [-1673.026] (-1680.912) * (-1682.504) [-1677.697] (-1688.194) (-1680.818) -- 0:02:04 Average standard deviation of split frequencies: 0.002615 420500 -- (-1674.164) (-1670.790) [-1686.874] (-1678.894) * (-1678.327) [-1674.518] (-1676.387) (-1674.976) -- 0:02:04 421000 -- [-1680.724] (-1680.319) (-1675.397) (-1684.397) * [-1675.506] (-1680.392) (-1685.253) (-1682.788) -- 0:02:05 421500 -- (-1678.996) (-1678.642) [-1672.936] (-1678.422) * (-1675.613) (-1684.590) [-1678.820] (-1680.519) -- 0:02:04 422000 -- (-1679.500) (-1683.408) [-1680.867] (-1691.676) * (-1674.001) (-1672.347) (-1684.570) [-1677.625] -- 0:02:04 422500 -- (-1681.481) [-1680.970] (-1677.987) (-1690.213) * (-1676.466) (-1673.060) (-1683.027) [-1675.525] -- 0:02:04 423000 -- [-1684.933] (-1680.841) (-1678.425) (-1688.357) * [-1672.186] (-1674.009) (-1675.267) (-1675.470) -- 0:02:04 423500 -- (-1674.128) (-1682.778) [-1682.413] (-1679.897) * (-1681.420) (-1687.494) (-1677.167) [-1679.182] -- 0:02:03 424000 -- (-1677.667) (-1673.472) [-1681.474] (-1683.859) * (-1684.367) (-1674.356) (-1688.757) [-1676.746] -- 0:02:03 424500 -- [-1673.212] (-1674.239) (-1684.270) (-1692.513) * (-1682.932) [-1677.210] (-1678.189) (-1678.451) -- 0:02:03 425000 -- (-1680.341) [-1683.142] (-1676.731) (-1684.636) * (-1677.404) [-1676.430] (-1679.661) (-1677.841) -- 0:02:03 Average standard deviation of split frequencies: 0.001107 425500 -- (-1679.149) (-1677.967) [-1680.010] (-1681.036) * (-1679.893) [-1672.798] (-1674.729) (-1673.884) -- 0:02:02 426000 -- (-1685.630) (-1676.996) [-1678.910] (-1679.154) * [-1678.378] (-1683.339) (-1676.836) (-1677.745) -- 0:02:03 426500 -- (-1683.113) (-1676.097) (-1691.627) [-1682.468] * (-1685.921) (-1687.802) (-1673.237) [-1674.561] -- 0:02:03 427000 -- (-1683.686) [-1676.618] (-1684.280) (-1686.704) * (-1683.800) (-1678.081) [-1676.821] (-1679.696) -- 0:02:03 427500 -- [-1675.590] (-1672.787) (-1683.835) (-1682.794) * (-1673.368) (-1678.418) [-1680.425] (-1680.439) -- 0:02:03 428000 -- [-1681.996] (-1675.039) (-1689.329) (-1679.470) * (-1682.216) (-1684.005) [-1680.614] (-1677.562) -- 0:02:02 428500 -- (-1683.766) (-1683.378) [-1675.967] (-1676.919) * (-1677.145) [-1674.958] (-1676.038) (-1677.515) -- 0:02:02 429000 -- (-1686.097) (-1685.220) [-1670.361] (-1676.691) * (-1677.900) [-1676.492] (-1676.117) (-1678.313) -- 0:02:02 429500 -- (-1676.908) (-1689.111) [-1675.574] (-1686.759) * (-1678.987) [-1681.215] (-1679.429) (-1677.332) -- 0:02:02 430000 -- [-1682.110] (-1676.357) (-1676.655) (-1679.909) * (-1671.980) (-1681.422) (-1678.384) [-1679.895] -- 0:02:01 Average standard deviation of split frequencies: 0.002189 430500 -- (-1688.333) (-1688.833) (-1677.964) [-1675.195] * (-1676.792) (-1684.248) (-1671.648) [-1674.076] -- 0:02:01 431000 -- (-1682.458) [-1676.936] (-1687.791) (-1681.309) * (-1684.579) [-1680.609] (-1683.301) (-1673.617) -- 0:02:02 431500 -- (-1682.028) [-1674.086] (-1681.814) (-1686.204) * (-1676.088) (-1681.629) (-1677.010) [-1685.322] -- 0:02:02 432000 -- (-1678.015) [-1680.839] (-1675.871) (-1686.909) * [-1680.693] (-1685.215) (-1683.433) (-1677.908) -- 0:02:02 432500 -- (-1673.487) [-1674.448] (-1677.196) (-1680.543) * (-1676.975) (-1682.392) [-1677.360] (-1677.730) -- 0:02:02 433000 -- (-1677.463) (-1682.735) [-1673.060] (-1692.366) * (-1680.247) (-1682.861) (-1674.866) [-1672.207] -- 0:02:01 433500 -- [-1674.474] (-1688.043) (-1680.010) (-1679.969) * (-1685.399) [-1673.371] (-1680.585) (-1677.752) -- 0:02:01 434000 -- (-1684.586) (-1677.688) (-1691.354) [-1683.969] * (-1685.161) (-1679.995) [-1671.817] (-1680.500) -- 0:02:01 434500 -- (-1680.220) [-1681.914] (-1675.310) (-1692.546) * (-1682.034) (-1679.601) [-1672.997] (-1674.929) -- 0:02:01 435000 -- (-1673.179) (-1676.074) [-1679.052] (-1680.876) * (-1680.498) (-1680.150) [-1673.632] (-1680.656) -- 0:02:00 Average standard deviation of split frequencies: 0.002162 435500 -- (-1687.513) (-1680.394) (-1677.193) [-1676.706] * [-1689.151] (-1683.854) (-1678.521) (-1678.611) -- 0:02:01 436000 -- [-1676.141] (-1676.370) (-1683.579) (-1673.750) * (-1673.465) (-1673.332) [-1677.667] (-1671.707) -- 0:02:01 436500 -- (-1683.758) (-1677.108) (-1674.884) [-1673.707] * (-1676.831) [-1675.153] (-1677.403) (-1678.410) -- 0:02:01 437000 -- (-1679.531) [-1681.406] (-1672.809) (-1680.890) * (-1672.801) (-1684.357) [-1687.001] (-1676.185) -- 0:02:01 437500 -- (-1679.959) (-1686.163) [-1674.831] (-1674.665) * (-1686.484) [-1679.804] (-1675.706) (-1680.190) -- 0:02:00 438000 -- (-1678.089) (-1678.996) (-1690.288) [-1679.095] * (-1684.057) (-1681.452) (-1674.746) [-1677.528] -- 0:02:00 438500 -- (-1682.218) [-1674.102] (-1679.620) (-1672.373) * (-1687.826) (-1680.070) (-1669.477) [-1676.309] -- 0:02:00 439000 -- [-1681.689] (-1675.910) (-1677.681) (-1677.942) * (-1675.160) (-1685.811) (-1674.382) [-1681.422] -- 0:02:00 439500 -- (-1678.436) (-1678.658) [-1683.381] (-1678.145) * (-1674.541) [-1677.233] (-1681.778) (-1678.994) -- 0:01:59 440000 -- (-1683.171) (-1680.790) [-1680.894] (-1678.752) * (-1686.425) (-1681.520) [-1675.183] (-1681.920) -- 0:02:00 Average standard deviation of split frequencies: 0.002853 440500 -- [-1669.439] (-1679.262) (-1683.576) (-1681.016) * (-1679.542) (-1679.731) (-1677.213) [-1678.354] -- 0:02:00 441000 -- (-1681.509) [-1682.108] (-1686.839) (-1678.810) * (-1679.779) (-1685.941) [-1676.686] (-1678.254) -- 0:02:00 441500 -- (-1679.940) (-1677.326) (-1688.029) [-1674.193] * [-1680.429] (-1683.243) (-1671.044) (-1684.509) -- 0:02:00 442000 -- (-1677.150) (-1671.276) [-1670.771] (-1689.670) * (-1689.065) (-1682.826) (-1676.483) [-1681.379] -- 0:01:59 442500 -- [-1672.758] (-1669.584) (-1675.734) (-1687.152) * (-1678.045) (-1680.811) [-1675.716] (-1678.986) -- 0:01:59 443000 -- [-1675.256] (-1674.936) (-1679.783) (-1678.357) * [-1672.407] (-1681.368) (-1681.214) (-1678.495) -- 0:01:59 443500 -- (-1683.580) (-1681.332) (-1675.066) [-1680.751] * (-1677.365) (-1680.700) (-1678.978) [-1675.295] -- 0:01:59 444000 -- (-1681.546) (-1677.470) [-1671.048] (-1677.069) * (-1678.643) (-1677.714) [-1675.456] (-1682.262) -- 0:01:58 444500 -- (-1683.232) [-1674.881] (-1672.586) (-1679.017) * [-1676.911] (-1685.152) (-1684.951) (-1671.647) -- 0:01:58 445000 -- (-1675.245) (-1676.095) [-1679.375] (-1685.929) * (-1683.606) [-1679.572] (-1669.394) (-1677.352) -- 0:01:59 Average standard deviation of split frequencies: 0.003523 445500 -- [-1678.211] (-1678.105) (-1676.054) (-1685.592) * (-1675.667) (-1679.886) (-1677.810) [-1676.724] -- 0:01:59 446000 -- (-1682.614) (-1676.675) [-1674.942] (-1681.585) * (-1684.512) (-1677.328) [-1673.515] (-1681.048) -- 0:01:59 446500 -- (-1674.667) [-1677.026] (-1677.522) (-1677.845) * (-1677.303) (-1681.122) [-1675.330] (-1679.675) -- 0:01:59 447000 -- [-1676.464] (-1671.805) (-1679.963) (-1678.064) * (-1685.883) [-1681.856] (-1677.744) (-1679.362) -- 0:01:58 447500 -- (-1679.186) [-1676.954] (-1684.521) (-1674.936) * (-1685.557) (-1690.744) [-1673.129] (-1681.131) -- 0:01:58 448000 -- (-1685.209) [-1680.118] (-1683.950) (-1670.455) * (-1679.624) [-1686.496] (-1673.840) (-1684.394) -- 0:01:58 448500 -- (-1683.024) (-1673.888) (-1679.121) [-1680.705] * (-1681.843) [-1677.157] (-1673.946) (-1676.808) -- 0:01:58 449000 -- (-1680.840) [-1677.760] (-1686.356) (-1680.597) * (-1673.387) (-1686.375) [-1677.922] (-1677.569) -- 0:01:57 449500 -- (-1681.103) [-1676.838] (-1676.315) (-1685.181) * (-1676.602) [-1678.871] (-1681.365) (-1674.874) -- 0:01:57 450000 -- (-1675.505) (-1677.688) [-1682.577] (-1675.223) * (-1681.962) (-1679.039) [-1682.656] (-1674.179) -- 0:01:58 Average standard deviation of split frequencies: 0.002441 450500 -- (-1682.574) [-1675.176] (-1670.463) (-1677.591) * (-1675.334) (-1682.711) [-1682.660] (-1682.026) -- 0:01:58 451000 -- [-1680.197] (-1676.379) (-1686.272) (-1679.332) * [-1679.342] (-1681.690) (-1684.637) (-1685.992) -- 0:01:58 451500 -- (-1679.794) (-1677.417) (-1681.783) [-1677.982] * (-1679.791) (-1679.030) (-1681.381) [-1679.988] -- 0:01:57 452000 -- (-1681.134) [-1680.288] (-1689.372) (-1680.097) * [-1676.613] (-1681.517) (-1683.359) (-1679.691) -- 0:01:57 452500 -- (-1684.807) (-1675.863) [-1668.726] (-1679.872) * (-1683.845) (-1675.909) (-1684.245) [-1670.905] -- 0:01:57 453000 -- (-1689.523) (-1680.791) (-1671.384) [-1677.687] * (-1681.131) [-1681.667] (-1677.447) (-1676.822) -- 0:01:57 453500 -- (-1675.169) (-1674.484) [-1678.325] (-1684.601) * (-1676.848) (-1674.443) [-1679.228] (-1679.643) -- 0:01:56 454000 -- (-1686.049) [-1675.876] (-1684.028) (-1672.402) * [-1679.157] (-1673.485) (-1682.103) (-1677.872) -- 0:01:56 454500 -- (-1675.162) [-1676.862] (-1679.596) (-1677.858) * (-1680.556) [-1673.202] (-1686.583) (-1684.545) -- 0:01:57 455000 -- (-1673.128) (-1672.297) (-1679.579) [-1683.411] * (-1679.191) (-1677.594) (-1687.085) [-1673.445] -- 0:01:57 Average standard deviation of split frequencies: 0.001551 455500 -- (-1680.482) (-1676.111) (-1679.950) [-1676.415] * [-1674.979] (-1675.376) (-1690.166) (-1674.301) -- 0:01:57 456000 -- (-1675.765) [-1674.499] (-1674.669) (-1687.030) * (-1682.710) (-1683.037) [-1678.141] (-1682.892) -- 0:01:56 456500 -- (-1674.463) (-1675.074) (-1684.933) [-1672.621] * (-1689.053) (-1677.530) [-1681.389] (-1676.055) -- 0:01:56 457000 -- (-1678.860) (-1675.643) (-1676.783) [-1678.072] * (-1694.561) (-1680.499) [-1680.058] (-1677.530) -- 0:01:56 457500 -- (-1679.288) (-1678.000) [-1676.839] (-1676.570) * (-1683.594) (-1680.170) [-1676.731] (-1674.005) -- 0:01:56 458000 -- (-1679.141) (-1687.470) (-1676.332) [-1679.058] * (-1683.199) (-1678.655) [-1680.111] (-1676.616) -- 0:01:55 458500 -- (-1679.823) (-1674.015) (-1682.632) [-1676.219] * (-1680.389) (-1677.350) [-1676.402] (-1679.372) -- 0:01:55 459000 -- (-1679.682) [-1677.953] (-1690.116) (-1678.360) * (-1681.176) (-1676.191) [-1675.302] (-1678.026) -- 0:01:55 459500 -- [-1682.820] (-1683.169) (-1685.564) (-1672.752) * (-1676.782) [-1674.225] (-1685.674) (-1676.901) -- 0:01:56 460000 -- [-1679.339] (-1680.739) (-1683.997) (-1677.044) * (-1676.415) (-1672.646) [-1677.512] (-1677.803) -- 0:01:56 Average standard deviation of split frequencies: 0.002558 460500 -- [-1676.528] (-1679.618) (-1677.570) (-1679.601) * [-1675.659] (-1686.012) (-1680.520) (-1678.870) -- 0:01:55 461000 -- (-1673.767) [-1677.660] (-1679.092) (-1676.049) * [-1680.280] (-1685.829) (-1681.393) (-1684.097) -- 0:01:55 461500 -- (-1675.034) (-1690.046) [-1684.131] (-1684.063) * (-1681.698) (-1679.511) (-1682.782) [-1676.624] -- 0:01:55 462000 -- [-1671.979] (-1696.218) (-1681.013) (-1678.082) * (-1672.344) (-1685.899) (-1685.235) [-1681.066] -- 0:01:55 462500 -- (-1679.221) (-1675.717) (-1672.614) [-1680.869] * (-1672.774) (-1674.017) [-1678.338] (-1677.285) -- 0:01:55 463000 -- (-1688.088) (-1689.096) [-1678.677] (-1686.784) * (-1675.192) (-1683.591) [-1681.133] (-1681.783) -- 0:01:54 463500 -- [-1680.349] (-1680.831) (-1676.050) (-1684.363) * [-1672.320] (-1680.358) (-1682.623) (-1676.960) -- 0:01:54 464000 -- (-1675.516) [-1677.086] (-1677.127) (-1672.343) * (-1685.002) [-1675.949] (-1688.553) (-1672.361) -- 0:01:55 464500 -- [-1680.188] (-1676.316) (-1678.328) (-1676.147) * (-1679.321) (-1680.698) (-1681.662) [-1672.339] -- 0:01:55 465000 -- (-1672.730) (-1675.665) [-1678.938] (-1683.947) * (-1677.664) (-1678.731) (-1684.709) [-1678.755] -- 0:01:55 Average standard deviation of split frequencies: 0.002529 465500 -- (-1679.746) [-1680.015] (-1676.185) (-1687.957) * (-1677.826) (-1678.337) (-1686.788) [-1675.237] -- 0:01:54 466000 -- (-1679.122) (-1678.548) (-1674.965) [-1673.879] * (-1688.179) (-1676.891) [-1677.283] (-1678.906) -- 0:01:54 466500 -- (-1683.150) (-1679.560) (-1683.420) [-1676.120] * (-1690.202) [-1675.797] (-1679.274) (-1673.228) -- 0:01:54 467000 -- (-1677.663) (-1672.533) [-1675.523] (-1678.597) * (-1683.954) [-1676.141] (-1679.946) (-1680.516) -- 0:01:54 467500 -- (-1674.692) (-1674.265) (-1679.599) [-1675.262] * (-1679.003) (-1677.655) [-1679.524] (-1678.431) -- 0:01:53 468000 -- (-1681.157) (-1676.317) (-1679.318) [-1674.222] * (-1670.796) [-1680.803] (-1681.267) (-1679.966) -- 0:01:53 468500 -- (-1690.518) (-1681.985) [-1676.557] (-1671.417) * (-1679.638) [-1679.573] (-1677.154) (-1676.510) -- 0:01:53 469000 -- (-1679.273) (-1675.913) (-1679.550) [-1674.130] * (-1678.754) (-1674.727) [-1673.853] (-1686.205) -- 0:01:54 469500 -- (-1673.805) (-1678.449) [-1688.276] (-1679.985) * (-1690.819) (-1672.994) (-1674.618) [-1683.247] -- 0:01:54 470000 -- [-1673.847] (-1684.972) (-1682.382) (-1682.388) * (-1679.610) (-1673.896) [-1673.895] (-1683.162) -- 0:01:53 Average standard deviation of split frequencies: 0.003839 470500 -- [-1674.128] (-1677.148) (-1675.636) (-1680.196) * (-1682.896) (-1673.503) (-1691.811) [-1680.499] -- 0:01:53 471000 -- (-1678.693) [-1678.577] (-1679.709) (-1682.318) * (-1680.444) [-1672.405] (-1678.754) (-1673.618) -- 0:01:53 471500 -- (-1678.579) (-1677.917) [-1683.473] (-1678.781) * (-1673.718) [-1681.493] (-1678.276) (-1684.053) -- 0:01:53 472000 -- (-1675.812) (-1679.936) (-1677.929) [-1682.577] * (-1675.517) [-1682.215] (-1680.341) (-1688.597) -- 0:01:52 472500 -- (-1674.321) (-1682.958) [-1676.212] (-1675.218) * (-1680.405) (-1676.937) (-1682.557) [-1680.659] -- 0:01:52 473000 -- (-1681.291) (-1674.518) [-1680.178] (-1677.989) * (-1682.782) (-1672.841) [-1675.201] (-1678.514) -- 0:01:52 473500 -- (-1677.032) (-1678.778) (-1687.044) [-1681.425] * (-1680.681) (-1674.686) [-1675.311] (-1676.664) -- 0:01:53 474000 -- (-1682.954) (-1680.932) (-1678.919) [-1679.452] * (-1692.930) (-1678.834) (-1678.499) [-1677.471] -- 0:01:53 474500 -- (-1677.506) (-1675.241) (-1679.740) [-1676.166] * (-1685.318) (-1678.582) [-1678.614] (-1682.795) -- 0:01:52 475000 -- [-1676.087] (-1679.394) (-1684.163) (-1678.163) * [-1675.183] (-1679.527) (-1681.319) (-1678.747) -- 0:01:52 Average standard deviation of split frequencies: 0.003466 475500 -- (-1678.900) (-1672.411) [-1673.571] (-1674.199) * (-1683.885) (-1678.272) [-1677.014] (-1679.633) -- 0:01:52 476000 -- (-1681.126) (-1684.464) (-1675.393) [-1676.736] * (-1675.638) [-1675.286] (-1684.586) (-1678.276) -- 0:01:52 476500 -- (-1680.369) (-1682.084) [-1676.356] (-1671.927) * (-1676.670) (-1687.582) (-1691.395) [-1686.990] -- 0:01:52 477000 -- (-1679.950) (-1675.233) (-1673.855) [-1678.981] * [-1679.171] (-1681.884) (-1685.833) (-1680.344) -- 0:01:51 477500 -- (-1687.816) (-1686.320) (-1680.780) [-1681.627] * (-1680.706) [-1677.329] (-1681.118) (-1681.823) -- 0:01:51 478000 -- (-1682.124) [-1677.469] (-1676.518) (-1682.164) * (-1681.907) (-1682.421) (-1672.972) [-1680.569] -- 0:01:51 478500 -- [-1678.189] (-1680.764) (-1678.924) (-1678.792) * (-1689.116) (-1679.913) [-1673.342] (-1675.261) -- 0:01:52 479000 -- (-1679.366) (-1680.139) (-1677.791) [-1678.297] * (-1683.726) (-1680.200) (-1681.542) [-1676.312] -- 0:01:52 479500 -- (-1677.427) [-1674.323] (-1678.836) (-1679.571) * (-1679.596) (-1674.473) (-1679.243) [-1678.098] -- 0:01:51 480000 -- (-1683.519) [-1677.766] (-1679.965) (-1682.213) * (-1679.591) [-1677.956] (-1680.679) (-1680.361) -- 0:01:51 Average standard deviation of split frequencies: 0.003759 480500 -- (-1681.472) (-1678.096) (-1683.060) [-1677.825] * (-1687.191) (-1677.235) [-1674.090] (-1677.612) -- 0:01:51 481000 -- (-1682.341) [-1670.772] (-1678.186) (-1674.458) * (-1683.806) (-1682.075) [-1681.161] (-1684.258) -- 0:01:51 481500 -- (-1678.354) (-1675.305) [-1686.592] (-1683.927) * (-1687.753) (-1679.223) (-1680.733) [-1674.426] -- 0:01:50 482000 -- [-1682.615] (-1677.384) (-1682.295) (-1689.500) * (-1686.393) (-1676.897) [-1682.125] (-1682.451) -- 0:01:50 482500 -- [-1678.590] (-1674.355) (-1678.316) (-1679.793) * (-1683.398) (-1679.612) [-1676.051] (-1689.681) -- 0:01:50 483000 -- [-1670.549] (-1674.278) (-1680.075) (-1682.965) * (-1672.831) (-1678.025) (-1680.391) [-1684.804] -- 0:01:51 483500 -- (-1674.363) (-1674.978) [-1679.525] (-1678.243) * (-1679.545) [-1677.748] (-1684.384) (-1676.372) -- 0:01:51 484000 -- [-1677.405] (-1677.970) (-1673.246) (-1686.937) * [-1676.681] (-1678.560) (-1675.654) (-1678.432) -- 0:01:50 484500 -- (-1678.946) (-1678.108) [-1678.441] (-1679.321) * (-1679.036) [-1676.323] (-1675.371) (-1677.000) -- 0:01:50 485000 -- (-1678.746) [-1674.256] (-1675.581) (-1680.603) * (-1680.199) [-1681.920] (-1678.927) (-1674.749) -- 0:01:50 Average standard deviation of split frequencies: 0.004688 485500 -- (-1682.810) [-1679.401] (-1675.706) (-1682.065) * [-1679.195] (-1676.586) (-1695.875) (-1679.701) -- 0:01:50 486000 -- (-1677.246) [-1686.141] (-1671.430) (-1678.806) * [-1677.663] (-1680.310) (-1685.772) (-1676.834) -- 0:01:49 486500 -- (-1678.716) (-1692.157) [-1678.638] (-1677.324) * (-1680.272) (-1672.381) [-1677.854] (-1674.660) -- 0:01:49 487000 -- (-1673.165) (-1679.375) (-1679.342) [-1677.381] * [-1678.490] (-1672.589) (-1692.831) (-1682.687) -- 0:01:49 487500 -- (-1679.558) (-1681.618) (-1674.061) [-1680.118] * [-1675.663] (-1682.128) (-1675.286) (-1694.402) -- 0:01:49 488000 -- (-1683.154) (-1676.662) (-1680.363) [-1676.501] * (-1680.334) (-1681.164) [-1683.057] (-1675.234) -- 0:01:50 488500 -- (-1680.577) (-1677.609) [-1672.569] (-1678.159) * (-1676.835) [-1676.674] (-1677.532) (-1680.777) -- 0:01:49 489000 -- (-1690.274) (-1674.385) [-1675.362] (-1678.912) * (-1673.811) (-1679.316) (-1680.259) [-1678.406] -- 0:01:49 489500 -- (-1677.989) (-1678.873) (-1677.991) [-1674.164] * (-1673.879) [-1676.490] (-1678.376) (-1679.230) -- 0:01:49 490000 -- [-1679.668] (-1679.467) (-1682.287) (-1679.284) * (-1679.173) (-1677.512) [-1674.796] (-1673.884) -- 0:01:49 Average standard deviation of split frequencies: 0.005604 490500 -- (-1675.495) (-1680.192) (-1672.287) [-1676.470] * (-1675.568) (-1681.774) (-1683.146) [-1678.917] -- 0:01:49 491000 -- (-1678.685) (-1682.718) (-1676.769) [-1678.775] * [-1685.033] (-1682.507) (-1678.262) (-1675.866) -- 0:01:48 491500 -- (-1676.222) (-1678.003) [-1676.064] (-1677.425) * (-1672.777) (-1679.618) [-1675.893] (-1675.450) -- 0:01:48 492000 -- (-1678.825) (-1674.830) [-1677.457] (-1681.188) * [-1677.708] (-1687.424) (-1683.366) (-1679.946) -- 0:01:48 492500 -- (-1686.957) (-1679.399) [-1673.249] (-1682.836) * [-1681.319] (-1673.104) (-1682.361) (-1679.307) -- 0:01:49 493000 -- (-1687.610) (-1676.669) [-1675.641] (-1686.345) * (-1680.169) (-1684.975) (-1677.777) [-1678.172] -- 0:01:49 493500 -- (-1688.858) [-1673.351] (-1679.688) (-1679.704) * (-1672.050) (-1680.181) [-1686.201] (-1678.119) -- 0:01:48 494000 -- (-1677.739) [-1676.959] (-1677.612) (-1681.353) * (-1682.093) (-1686.447) [-1679.243] (-1677.116) -- 0:01:48 494500 -- (-1676.422) (-1682.385) [-1674.736] (-1672.398) * (-1685.805) [-1678.233] (-1680.400) (-1685.853) -- 0:01:48 495000 -- (-1684.705) [-1674.243] (-1684.209) (-1679.847) * (-1676.027) (-1685.231) (-1684.374) [-1678.779] -- 0:01:48 Average standard deviation of split frequencies: 0.004594 495500 -- (-1686.791) [-1674.533] (-1676.802) (-1685.269) * [-1681.553] (-1673.604) (-1684.130) (-1682.602) -- 0:01:47 496000 -- (-1675.431) [-1672.615] (-1679.515) (-1678.670) * (-1679.333) (-1675.181) [-1679.866] (-1681.831) -- 0:01:47 496500 -- (-1679.749) (-1678.635) (-1678.039) [-1682.407] * [-1673.768] (-1681.356) (-1676.864) (-1684.241) -- 0:01:47 497000 -- [-1676.278] (-1682.734) (-1684.377) (-1686.965) * (-1675.235) (-1677.801) [-1672.992] (-1690.369) -- 0:01:47 497500 -- (-1677.883) (-1677.620) (-1678.786) [-1674.340] * (-1678.618) (-1675.696) (-1678.137) [-1689.971] -- 0:01:48 498000 -- [-1679.664] (-1677.760) (-1689.480) (-1678.066) * (-1678.948) (-1681.769) (-1673.184) [-1684.060] -- 0:01:47 498500 -- (-1681.016) [-1680.053] (-1688.283) (-1686.410) * (-1677.394) (-1682.564) (-1677.665) [-1673.293] -- 0:01:47 499000 -- [-1675.781] (-1680.412) (-1679.383) (-1675.473) * (-1679.472) [-1675.075] (-1679.050) (-1681.951) -- 0:01:47 499500 -- (-1690.254) [-1677.058] (-1675.956) (-1686.019) * (-1682.877) (-1672.398) (-1690.826) [-1683.751] -- 0:01:47 500000 -- (-1678.083) [-1677.764] (-1678.239) (-1681.490) * [-1672.611] (-1679.988) (-1680.624) (-1679.133) -- 0:01:47 Average standard deviation of split frequencies: 0.005806 500500 -- (-1675.324) (-1672.305) [-1672.256] (-1681.575) * (-1674.978) (-1683.751) [-1682.786] (-1674.579) -- 0:01:46 501000 -- (-1677.139) (-1670.997) [-1679.853] (-1680.265) * (-1678.251) (-1674.963) (-1684.573) [-1681.606] -- 0:01:46 501500 -- (-1673.538) [-1682.388] (-1680.581) (-1678.623) * [-1672.628] (-1679.264) (-1687.088) (-1690.119) -- 0:01:46 502000 -- [-1685.634] (-1669.484) (-1682.660) (-1678.484) * [-1676.012] (-1681.695) (-1680.582) (-1685.984) -- 0:01:47 502500 -- (-1683.863) [-1675.225] (-1684.382) (-1677.526) * (-1687.140) [-1678.277] (-1681.143) (-1677.991) -- 0:01:46 503000 -- (-1685.407) (-1674.879) [-1677.121] (-1681.534) * (-1688.000) [-1677.035] (-1680.507) (-1680.369) -- 0:01:46 503500 -- [-1673.006] (-1680.037) (-1686.445) (-1681.770) * (-1683.765) (-1684.699) [-1671.637] (-1680.019) -- 0:01:46 504000 -- (-1677.245) [-1683.221] (-1690.927) (-1677.004) * (-1678.067) (-1678.833) (-1675.663) [-1675.064] -- 0:01:46 504500 -- [-1680.222] (-1679.203) (-1679.034) (-1687.335) * (-1677.308) (-1679.761) (-1679.863) [-1683.093] -- 0:01:46 505000 -- (-1680.597) (-1678.015) (-1677.337) [-1675.386] * (-1677.008) (-1684.583) [-1673.478] (-1676.746) -- 0:01:45 Average standard deviation of split frequencies: 0.007298 505500 -- (-1684.024) (-1683.207) [-1675.935] (-1684.989) * (-1678.548) (-1680.073) (-1681.112) [-1672.156] -- 0:01:45 506000 -- (-1676.600) (-1686.671) (-1676.536) [-1682.626] * [-1673.749] (-1683.229) (-1678.493) (-1680.945) -- 0:01:45 506500 -- [-1680.608] (-1674.346) (-1679.552) (-1682.679) * (-1687.198) [-1680.928] (-1680.190) (-1683.243) -- 0:01:45 507000 -- (-1682.318) (-1676.938) (-1672.842) [-1670.910] * (-1674.625) [-1678.021] (-1684.560) (-1676.344) -- 0:01:45 507500 -- (-1682.197) [-1671.528] (-1694.566) (-1675.737) * [-1678.379] (-1676.572) (-1681.582) (-1683.817) -- 0:01:45 508000 -- (-1680.298) (-1680.166) (-1675.402) [-1673.524] * [-1678.326] (-1678.437) (-1685.320) (-1678.793) -- 0:01:45 508500 -- (-1682.965) (-1681.661) [-1670.268] (-1675.093) * (-1672.626) [-1682.830] (-1679.791) (-1675.220) -- 0:01:45 509000 -- (-1689.931) (-1686.822) (-1687.327) [-1674.031] * [-1675.772] (-1689.167) (-1680.206) (-1679.128) -- 0:01:45 509500 -- (-1676.810) (-1689.499) [-1673.296] (-1673.769) * [-1673.613] (-1674.322) (-1680.220) (-1686.951) -- 0:01:44 510000 -- (-1684.752) (-1677.065) [-1677.868] (-1678.867) * (-1680.021) [-1680.889] (-1680.514) (-1676.855) -- 0:01:44 Average standard deviation of split frequencies: 0.008154 510500 -- [-1686.765] (-1686.352) (-1682.717) (-1682.314) * (-1674.009) (-1681.785) [-1685.984] (-1676.155) -- 0:01:44 511000 -- (-1678.182) (-1673.654) [-1676.241] (-1681.159) * [-1676.747] (-1686.622) (-1680.320) (-1684.179) -- 0:01:44 511500 -- [-1674.476] (-1681.423) (-1685.338) (-1682.131) * (-1681.981) (-1674.695) [-1675.506] (-1685.178) -- 0:01:45 512000 -- [-1675.012] (-1676.754) (-1679.882) (-1685.354) * (-1680.027) (-1679.149) (-1681.177) [-1678.327] -- 0:01:44 512500 -- [-1672.687] (-1675.918) (-1673.048) (-1682.862) * (-1686.826) [-1674.206] (-1677.976) (-1676.358) -- 0:01:44 513000 -- [-1673.470] (-1677.246) (-1682.808) (-1679.595) * (-1683.686) (-1674.868) (-1674.947) [-1673.942] -- 0:01:44 513500 -- (-1688.346) (-1678.584) [-1678.771] (-1686.235) * (-1685.904) (-1678.289) [-1682.211] (-1678.501) -- 0:01:44 514000 -- [-1678.626] (-1678.293) (-1679.212) (-1682.152) * [-1678.884] (-1680.146) (-1676.696) (-1678.041) -- 0:01:44 514500 -- (-1678.974) (-1675.432) (-1674.754) [-1682.443] * (-1676.393) (-1683.994) [-1674.678] (-1687.150) -- 0:01:43 515000 -- (-1676.299) (-1677.244) (-1683.531) [-1678.591] * [-1670.707] (-1673.343) (-1678.640) (-1681.704) -- 0:01:43 Average standard deviation of split frequencies: 0.007156 515500 -- (-1677.834) (-1675.891) (-1674.672) [-1670.197] * (-1675.204) (-1681.853) [-1672.826] (-1678.225) -- 0:01:43 516000 -- [-1673.444] (-1678.102) (-1677.196) (-1683.146) * (-1670.474) (-1687.194) [-1675.060] (-1677.107) -- 0:01:43 516500 -- (-1676.381) (-1682.635) (-1678.905) [-1674.392] * (-1675.655) (-1682.057) [-1670.387] (-1688.611) -- 0:01:43 517000 -- (-1675.763) (-1686.882) [-1677.123] (-1685.541) * (-1678.622) (-1691.928) [-1670.923] (-1679.578) -- 0:01:43 517500 -- (-1677.464) (-1678.034) [-1674.947] (-1675.692) * [-1673.199] (-1680.302) (-1676.301) (-1674.915) -- 0:01:43 518000 -- (-1674.964) [-1679.586] (-1673.218) (-1681.013) * (-1676.012) (-1682.666) [-1676.822] (-1682.683) -- 0:01:43 518500 -- (-1674.812) [-1674.580] (-1681.913) (-1680.445) * [-1672.141] (-1673.581) (-1680.630) (-1677.255) -- 0:01:43 519000 -- (-1678.430) (-1687.060) (-1686.025) [-1676.779] * [-1679.394] (-1677.957) (-1682.989) (-1684.145) -- 0:01:42 519500 -- (-1686.373) (-1683.428) [-1683.596] (-1682.914) * (-1676.878) [-1674.943] (-1683.428) (-1675.728) -- 0:01:42 520000 -- [-1671.443] (-1679.962) (-1682.052) (-1681.839) * (-1684.694) (-1675.265) [-1676.305] (-1678.325) -- 0:01:42 Average standard deviation of split frequencies: 0.006790 520500 -- (-1682.284) (-1685.445) [-1668.948] (-1675.845) * [-1676.858] (-1681.223) (-1677.895) (-1676.347) -- 0:01:42 521000 -- [-1676.802] (-1681.540) (-1677.168) (-1677.112) * (-1678.672) (-1678.152) [-1681.772] (-1678.882) -- 0:01:42 521500 -- [-1674.546] (-1673.535) (-1674.494) (-1688.248) * [-1680.556] (-1682.411) (-1681.201) (-1673.546) -- 0:01:42 522000 -- (-1677.121) (-1677.754) [-1678.738] (-1690.821) * [-1679.764] (-1684.523) (-1678.856) (-1674.766) -- 0:01:42 522500 -- (-1681.525) [-1673.518] (-1682.424) (-1680.046) * (-1675.472) (-1681.336) (-1678.260) [-1673.890] -- 0:01:42 523000 -- (-1680.112) (-1679.823) [-1676.564] (-1681.840) * [-1674.831] (-1674.311) (-1677.917) (-1681.673) -- 0:01:42 523500 -- [-1678.514] (-1680.883) (-1684.380) (-1686.271) * [-1681.114] (-1674.014) (-1682.505) (-1679.675) -- 0:01:41 524000 -- (-1679.742) (-1679.911) (-1675.148) [-1681.074] * (-1686.421) (-1687.044) (-1682.071) [-1676.905] -- 0:01:41 524500 -- [-1679.086] (-1680.778) (-1679.607) (-1683.304) * (-1675.097) [-1675.341] (-1691.998) (-1685.367) -- 0:01:41 525000 -- [-1683.428] (-1683.037) (-1680.790) (-1684.050) * (-1674.875) (-1682.641) (-1679.408) [-1679.434] -- 0:01:41 Average standard deviation of split frequencies: 0.007319 525500 -- (-1680.874) (-1674.486) (-1678.883) [-1682.138] * (-1681.049) (-1682.490) (-1678.538) [-1672.000] -- 0:01:41 526000 -- (-1675.345) [-1675.790] (-1685.517) (-1680.234) * [-1677.841] (-1680.965) (-1680.454) (-1673.972) -- 0:01:41 526500 -- [-1680.364] (-1682.520) (-1687.225) (-1681.885) * (-1686.008) [-1679.491] (-1682.781) (-1678.632) -- 0:01:41 527000 -- (-1673.727) [-1679.703] (-1681.954) (-1684.303) * (-1678.314) (-1670.368) (-1684.179) [-1673.965] -- 0:01:41 527500 -- (-1683.596) (-1684.724) (-1681.650) [-1680.144] * [-1677.655] (-1680.930) (-1681.779) (-1678.701) -- 0:01:41 528000 -- (-1679.804) (-1690.207) (-1683.539) [-1679.679] * [-1679.438] (-1683.396) (-1679.242) (-1679.325) -- 0:01:41 528500 -- (-1683.287) (-1691.815) (-1675.243) [-1675.871] * (-1688.095) (-1685.657) (-1672.502) [-1671.543] -- 0:01:40 529000 -- (-1680.543) [-1674.864] (-1679.914) (-1679.912) * (-1681.394) [-1671.111] (-1684.564) (-1681.363) -- 0:01:40 529500 -- (-1697.540) (-1678.736) (-1684.911) [-1677.901] * (-1688.072) [-1671.796] (-1678.808) (-1678.726) -- 0:01:40 530000 -- (-1690.318) (-1681.313) [-1681.288] (-1682.508) * (-1685.783) [-1676.402] (-1675.942) (-1685.286) -- 0:01:40 Average standard deviation of split frequencies: 0.006810 530500 -- (-1688.418) [-1679.075] (-1676.425) (-1677.738) * [-1678.375] (-1674.912) (-1675.250) (-1678.277) -- 0:01:40 531000 -- (-1692.399) (-1678.894) (-1676.229) [-1672.462] * (-1679.645) (-1676.597) (-1672.493) [-1679.276] -- 0:01:40 531500 -- (-1690.454) (-1678.409) [-1674.203] (-1679.892) * [-1679.881] (-1674.464) (-1678.159) (-1685.561) -- 0:01:40 532000 -- [-1685.399] (-1677.022) (-1680.074) (-1675.920) * (-1681.143) (-1679.149) [-1678.770] (-1680.225) -- 0:01:40 532500 -- (-1684.250) [-1678.350] (-1681.808) (-1675.921) * (-1682.467) (-1683.343) (-1685.262) [-1683.904] -- 0:01:40 533000 -- (-1685.036) (-1686.514) (-1680.396) [-1673.037] * (-1678.049) (-1679.809) (-1671.589) [-1683.007] -- 0:01:39 533500 -- (-1681.135) [-1686.857] (-1682.770) (-1674.170) * (-1686.979) [-1679.539] (-1683.454) (-1683.309) -- 0:01:39 534000 -- (-1678.524) [-1683.579] (-1678.863) (-1678.873) * (-1687.729) [-1675.446] (-1675.164) (-1677.853) -- 0:01:39 534500 -- (-1680.013) [-1678.365] (-1684.174) (-1678.847) * [-1675.901] (-1681.027) (-1689.789) (-1678.317) -- 0:01:39 535000 -- [-1679.983] (-1685.645) (-1680.210) (-1675.570) * (-1671.804) (-1680.445) [-1671.657] (-1683.035) -- 0:01:39 Average standard deviation of split frequencies: 0.007622 535500 -- (-1678.101) (-1680.305) [-1674.859] (-1677.251) * [-1675.724] (-1685.449) (-1680.058) (-1678.737) -- 0:01:39 536000 -- (-1676.109) (-1689.635) (-1678.493) [-1676.624] * [-1678.261] (-1679.388) (-1674.626) (-1677.896) -- 0:01:39 536500 -- (-1678.301) (-1679.827) (-1683.849) [-1677.379] * (-1681.322) (-1685.645) (-1679.930) [-1673.757] -- 0:01:39 537000 -- [-1673.827] (-1683.009) (-1685.206) (-1678.138) * (-1675.554) [-1675.108] (-1674.697) (-1683.059) -- 0:01:39 537500 -- [-1673.993] (-1683.842) (-1684.647) (-1680.779) * (-1676.264) [-1676.899] (-1681.244) (-1679.523) -- 0:01:38 538000 -- [-1678.429] (-1673.303) (-1678.211) (-1672.213) * [-1682.947] (-1692.547) (-1678.364) (-1682.376) -- 0:01:38 538500 -- (-1681.895) (-1689.152) (-1675.711) [-1682.693] * (-1678.443) (-1679.036) (-1684.322) [-1672.985] -- 0:01:38 539000 -- (-1678.080) [-1672.587] (-1680.894) (-1679.902) * [-1678.325] (-1685.823) (-1683.442) (-1674.922) -- 0:01:38 539500 -- (-1670.132) (-1677.809) [-1675.597] (-1675.679) * (-1673.877) (-1688.002) (-1677.569) [-1683.130] -- 0:01:38 540000 -- (-1679.935) (-1679.827) [-1678.836] (-1678.273) * [-1672.588] (-1683.864) (-1684.726) (-1675.248) -- 0:01:37 Average standard deviation of split frequencies: 0.008138 540500 -- [-1674.198] (-1679.595) (-1680.088) (-1676.560) * (-1681.708) (-1673.877) (-1679.544) [-1672.711] -- 0:01:38 541000 -- (-1682.754) [-1672.995] (-1686.267) (-1677.260) * (-1678.589) [-1674.831] (-1686.730) (-1686.894) -- 0:01:38 541500 -- (-1679.352) [-1677.082] (-1683.216) (-1674.166) * (-1678.843) (-1673.430) (-1689.448) [-1680.800] -- 0:01:38 542000 -- (-1679.801) [-1676.967] (-1678.610) (-1682.279) * [-1681.362] (-1683.710) (-1676.894) (-1682.441) -- 0:01:38 542500 -- (-1682.503) (-1676.919) (-1682.779) [-1684.335] * (-1681.404) (-1684.169) [-1679.851] (-1676.036) -- 0:01:37 543000 -- [-1677.769] (-1688.258) (-1693.862) (-1682.835) * (-1682.410) (-1685.993) (-1688.617) [-1681.207] -- 0:01:37 543500 -- (-1677.140) (-1677.411) [-1676.293] (-1679.773) * (-1680.079) [-1678.324] (-1679.916) (-1677.086) -- 0:01:37 544000 -- (-1678.415) (-1677.093) (-1679.229) [-1681.729] * (-1679.397) [-1680.159] (-1684.623) (-1678.163) -- 0:01:37 544500 -- (-1678.339) (-1677.569) (-1677.487) [-1675.235] * (-1674.740) (-1685.500) (-1683.327) [-1673.739] -- 0:01:37 545000 -- [-1680.077] (-1687.907) (-1678.220) (-1678.532) * (-1674.991) (-1677.492) [-1677.803] (-1681.917) -- 0:01:37 Average standard deviation of split frequencies: 0.007195 545500 -- (-1681.889) [-1679.726] (-1682.403) (-1680.047) * (-1675.762) [-1678.879] (-1673.865) (-1680.450) -- 0:01:37 546000 -- (-1676.239) [-1678.589] (-1673.701) (-1683.687) * [-1678.814] (-1678.600) (-1674.082) (-1684.331) -- 0:01:37 546500 -- (-1671.785) (-1679.722) (-1683.971) [-1684.854] * [-1679.248] (-1680.690) (-1680.679) (-1681.887) -- 0:01:37 547000 -- (-1686.940) (-1675.158) [-1675.967] (-1683.009) * (-1674.673) [-1678.035] (-1683.917) (-1679.582) -- 0:01:36 547500 -- [-1680.049] (-1684.473) (-1678.611) (-1675.511) * (-1676.879) (-1674.587) [-1674.214] (-1680.493) -- 0:01:36 548000 -- (-1683.019) (-1678.712) [-1678.553] (-1674.865) * [-1675.571] (-1673.319) (-1670.691) (-1677.207) -- 0:01:36 548500 -- (-1677.745) (-1679.097) (-1682.516) [-1674.492] * [-1674.430] (-1672.691) (-1674.530) (-1687.167) -- 0:01:36 549000 -- (-1683.364) [-1672.737] (-1672.071) (-1679.077) * (-1678.921) (-1688.139) [-1678.908] (-1682.305) -- 0:01:36 549500 -- (-1678.581) (-1678.950) (-1675.015) [-1673.551] * [-1673.325] (-1679.243) (-1676.805) (-1673.030) -- 0:01:36 550000 -- (-1678.028) [-1677.171] (-1673.918) (-1681.994) * [-1677.756] (-1675.107) (-1677.636) (-1684.638) -- 0:01:36 Average standard deviation of split frequencies: 0.007419 550500 -- (-1673.325) (-1671.855) (-1682.491) [-1673.519] * [-1679.463] (-1683.301) (-1678.499) (-1681.320) -- 0:01:36 551000 -- (-1671.266) [-1674.357] (-1674.628) (-1672.972) * (-1685.241) (-1674.567) (-1677.890) [-1685.286] -- 0:01:36 551500 -- (-1681.802) (-1682.329) (-1684.051) [-1683.634] * (-1682.466) (-1676.836) (-1677.366) [-1668.335] -- 0:01:35 552000 -- (-1676.004) (-1673.414) [-1680.583] (-1680.949) * (-1682.543) [-1676.595] (-1681.152) (-1677.193) -- 0:01:35 552500 -- [-1674.039] (-1678.676) (-1675.976) (-1679.527) * (-1683.747) (-1675.508) (-1679.582) [-1672.580] -- 0:01:35 553000 -- [-1676.250] (-1678.903) (-1685.332) (-1674.726) * [-1678.949] (-1685.276) (-1680.772) (-1675.944) -- 0:01:35 553500 -- (-1679.514) [-1677.480] (-1676.529) (-1680.490) * (-1680.810) (-1685.067) (-1680.805) [-1671.707] -- 0:01:35 554000 -- (-1673.122) (-1683.056) (-1680.822) [-1673.775] * (-1674.802) (-1683.337) (-1681.851) [-1674.126] -- 0:01:34 554500 -- (-1678.064) (-1680.621) [-1678.701] (-1682.644) * [-1675.813] (-1679.910) (-1674.425) (-1679.000) -- 0:01:35 555000 -- (-1684.375) (-1677.043) [-1677.271] (-1680.229) * (-1682.853) (-1689.953) [-1675.712] (-1681.311) -- 0:01:35 Average standard deviation of split frequencies: 0.006359 555500 -- [-1675.705] (-1679.250) (-1672.246) (-1681.921) * (-1678.598) (-1683.842) (-1681.634) [-1675.658] -- 0:01:35 556000 -- (-1679.940) [-1678.661] (-1675.905) (-1684.464) * (-1675.086) [-1681.098] (-1679.881) (-1673.736) -- 0:01:35 556500 -- [-1675.503] (-1684.252) (-1673.739) (-1675.557) * (-1680.975) (-1678.571) [-1676.402] (-1676.236) -- 0:01:34 557000 -- [-1677.960] (-1671.688) (-1683.081) (-1677.932) * (-1681.433) (-1670.274) (-1674.578) [-1682.122] -- 0:01:34 557500 -- (-1683.275) (-1674.600) [-1675.271] (-1680.840) * (-1677.027) (-1685.972) (-1675.174) [-1684.514] -- 0:01:34 558000 -- [-1672.445] (-1680.071) (-1675.751) (-1678.445) * (-1678.035) [-1680.672] (-1680.569) (-1680.919) -- 0:01:34 558500 -- (-1680.073) (-1677.326) [-1678.879] (-1685.084) * (-1673.248) (-1677.154) [-1674.002] (-1677.509) -- 0:01:34 559000 -- (-1682.180) (-1677.033) (-1672.555) [-1676.134] * (-1680.939) (-1686.450) [-1676.304] (-1676.851) -- 0:01:33 559500 -- (-1678.967) (-1673.384) [-1672.890] (-1684.384) * (-1675.052) [-1680.362] (-1672.538) (-1675.933) -- 0:01:34 560000 -- (-1692.566) (-1678.936) (-1690.142) [-1676.449] * (-1678.367) (-1685.480) (-1679.203) [-1672.568] -- 0:01:34 Average standard deviation of split frequencies: 0.006586 560500 -- [-1675.887] (-1677.116) (-1684.583) (-1678.045) * (-1675.546) (-1681.453) (-1676.236) [-1678.868] -- 0:01:34 561000 -- (-1682.668) [-1674.316] (-1675.933) (-1676.455) * (-1682.913) (-1687.634) (-1674.508) [-1673.799] -- 0:01:33 561500 -- (-1687.207) (-1673.175) (-1679.660) [-1676.172] * [-1675.386] (-1680.780) (-1685.797) (-1688.861) -- 0:01:33 562000 -- (-1686.783) (-1674.282) [-1680.150] (-1675.738) * (-1679.605) (-1672.986) [-1683.865] (-1683.626) -- 0:01:33 562500 -- (-1694.905) [-1673.683] (-1678.184) (-1677.793) * [-1682.103] (-1676.195) (-1680.986) (-1686.646) -- 0:01:33 563000 -- [-1684.413] (-1676.782) (-1682.660) (-1689.489) * (-1677.043) (-1687.728) (-1678.987) [-1678.197] -- 0:01:33 563500 -- (-1688.467) (-1677.719) (-1675.952) [-1676.459] * (-1679.432) (-1679.559) (-1676.588) [-1675.846] -- 0:01:32 564000 -- (-1679.291) (-1687.828) [-1679.424] (-1675.920) * (-1686.014) (-1676.678) (-1681.900) [-1676.417] -- 0:01:33 564500 -- (-1688.680) (-1674.307) (-1676.554) [-1685.226] * (-1680.276) (-1684.440) (-1689.934) [-1676.155] -- 0:01:33 565000 -- [-1678.609] (-1679.003) (-1674.306) (-1682.538) * (-1685.267) [-1684.541] (-1684.289) (-1688.627) -- 0:01:33 Average standard deviation of split frequencies: 0.005969 565500 -- (-1678.703) (-1683.195) (-1687.449) [-1680.089] * (-1675.244) (-1684.289) (-1672.598) [-1676.518] -- 0:01:32 566000 -- [-1680.842] (-1675.059) (-1686.510) (-1677.287) * [-1678.916] (-1684.424) (-1680.626) (-1676.518) -- 0:01:32 566500 -- [-1670.796] (-1683.007) (-1684.849) (-1678.663) * (-1681.743) [-1676.476] (-1675.990) (-1678.609) -- 0:01:32 567000 -- (-1678.636) [-1675.589] (-1686.003) (-1679.694) * [-1675.353] (-1675.954) (-1679.986) (-1675.511) -- 0:01:32 567500 -- (-1680.139) (-1676.342) [-1679.702] (-1680.882) * [-1678.539] (-1677.998) (-1678.340) (-1672.640) -- 0:01:32 568000 -- [-1674.635] (-1683.159) (-1683.203) (-1685.829) * (-1677.148) [-1671.076] (-1678.537) (-1677.861) -- 0:01:32 568500 -- [-1673.078] (-1671.522) (-1678.969) (-1680.339) * [-1676.396] (-1678.239) (-1678.073) (-1686.982) -- 0:01:31 569000 -- (-1674.060) [-1675.751] (-1691.368) (-1679.193) * (-1681.326) (-1675.389) [-1679.985] (-1672.628) -- 0:01:32 569500 -- (-1680.251) (-1679.523) (-1677.315) [-1672.877] * (-1674.789) [-1677.004] (-1676.207) (-1680.487) -- 0:01:32 570000 -- (-1683.078) (-1686.226) [-1674.517] (-1684.456) * (-1687.367) [-1683.729] (-1680.908) (-1674.521) -- 0:01:32 Average standard deviation of split frequencies: 0.006746 570500 -- [-1683.139] (-1685.334) (-1675.109) (-1678.205) * (-1681.760) (-1678.381) (-1679.713) [-1674.860] -- 0:01:31 571000 -- (-1671.252) (-1688.968) (-1676.500) [-1671.703] * (-1681.698) (-1681.403) (-1685.951) [-1672.375] -- 0:01:31 571500 -- (-1679.028) (-1680.416) (-1678.643) [-1674.495] * (-1682.832) (-1678.159) (-1679.613) [-1685.927] -- 0:01:31 572000 -- [-1674.212] (-1679.897) (-1686.489) (-1678.340) * (-1679.404) (-1675.299) [-1674.469] (-1678.121) -- 0:01:31 572500 -- [-1676.970] (-1680.259) (-1681.484) (-1682.502) * (-1672.015) (-1681.508) (-1679.184) [-1684.136] -- 0:01:31 573000 -- [-1676.569] (-1678.246) (-1677.559) (-1687.317) * (-1680.565) (-1680.175) [-1679.811] (-1681.167) -- 0:01:30 573500 -- (-1678.806) (-1680.489) [-1675.969] (-1682.163) * [-1682.382] (-1674.470) (-1671.650) (-1681.125) -- 0:01:31 574000 -- [-1674.295] (-1679.053) (-1676.959) (-1676.888) * (-1678.543) (-1675.607) [-1671.505] (-1681.571) -- 0:01:31 574500 -- (-1681.218) [-1679.168] (-1683.855) (-1677.801) * (-1682.261) [-1676.540] (-1674.227) (-1681.293) -- 0:01:31 575000 -- (-1677.947) (-1688.610) [-1676.622] (-1673.840) * [-1676.869] (-1677.628) (-1681.761) (-1684.268) -- 0:01:30 Average standard deviation of split frequencies: 0.007775 575500 -- (-1677.464) [-1675.040] (-1681.124) (-1671.790) * (-1673.758) [-1679.613] (-1677.459) (-1679.939) -- 0:01:30 576000 -- (-1680.772) [-1675.498] (-1678.440) (-1675.967) * (-1682.449) (-1685.195) (-1678.222) [-1683.158] -- 0:01:30 576500 -- (-1682.976) [-1679.728] (-1686.734) (-1677.956) * (-1674.972) (-1678.403) (-1671.976) [-1675.125] -- 0:01:30 577000 -- (-1684.310) (-1675.558) (-1680.431) [-1677.803] * [-1685.102] (-1675.999) (-1676.026) (-1674.191) -- 0:01:30 577500 -- (-1682.881) [-1673.582] (-1684.519) (-1680.145) * (-1676.143) [-1684.096] (-1675.741) (-1671.679) -- 0:01:29 578000 -- (-1688.398) [-1681.607] (-1681.059) (-1684.606) * (-1679.741) [-1677.579] (-1686.016) (-1682.734) -- 0:01:29 578500 -- (-1684.984) (-1681.171) (-1672.368) [-1675.807] * [-1682.106] (-1678.842) (-1679.453) (-1675.694) -- 0:01:30 579000 -- (-1681.451) [-1675.908] (-1681.334) (-1682.893) * [-1674.556] (-1676.968) (-1677.206) (-1675.432) -- 0:01:30 579500 -- [-1675.518] (-1675.257) (-1676.436) (-1686.912) * (-1689.808) (-1682.275) (-1680.303) [-1677.898] -- 0:01:29 580000 -- (-1678.542) (-1682.544) [-1674.237] (-1680.464) * (-1676.337) (-1678.051) (-1680.314) [-1678.343] -- 0:01:29 Average standard deviation of split frequencies: 0.009065 580500 -- (-1682.412) (-1677.291) (-1682.409) [-1676.785] * (-1677.538) [-1673.144] (-1681.884) (-1675.560) -- 0:01:29 581000 -- (-1688.596) (-1675.670) [-1672.614] (-1682.924) * (-1681.643) (-1676.240) [-1672.688] (-1677.780) -- 0:01:29 581500 -- (-1678.817) [-1677.910] (-1675.314) (-1677.045) * (-1678.532) [-1678.383] (-1678.989) (-1677.257) -- 0:01:29 582000 -- (-1678.256) (-1679.721) (-1677.771) [-1674.197] * (-1677.856) [-1676.942] (-1676.872) (-1675.877) -- 0:01:29 582500 -- [-1672.425] (-1674.296) (-1682.524) (-1676.553) * (-1678.645) (-1684.746) (-1680.199) [-1680.719] -- 0:01:28 583000 -- (-1687.126) (-1678.841) (-1676.710) [-1675.796] * [-1679.593] (-1679.242) (-1677.439) (-1676.675) -- 0:01:29 583500 -- [-1680.768] (-1682.301) (-1685.544) (-1684.548) * (-1680.111) [-1677.641] (-1680.723) (-1687.594) -- 0:01:29 584000 -- [-1679.513] (-1682.694) (-1674.945) (-1681.971) * (-1675.882) [-1677.489] (-1678.347) (-1672.636) -- 0:01:29 584500 -- (-1692.136) (-1684.199) [-1680.404] (-1678.950) * (-1677.003) (-1675.378) [-1677.719] (-1674.710) -- 0:01:28 585000 -- (-1687.462) (-1680.387) [-1676.434] (-1678.526) * (-1679.582) [-1675.935] (-1680.331) (-1670.907) -- 0:01:28 Average standard deviation of split frequencies: 0.007642 585500 -- (-1679.011) [-1676.627] (-1678.078) (-1678.257) * (-1680.155) (-1682.979) [-1671.086] (-1677.817) -- 0:01:28 586000 -- (-1685.944) (-1672.260) (-1685.481) [-1678.221] * (-1678.799) [-1678.723] (-1684.919) (-1672.650) -- 0:01:28 586500 -- (-1681.109) [-1680.020] (-1682.500) (-1676.487) * (-1673.953) [-1680.431] (-1671.246) (-1676.422) -- 0:01:28 587000 -- (-1677.578) (-1674.715) [-1679.924] (-1677.834) * (-1687.788) [-1675.936] (-1676.484) (-1675.534) -- 0:01:27 587500 -- [-1672.291] (-1682.743) (-1680.038) (-1685.661) * (-1687.420) (-1677.953) (-1678.892) [-1673.577] -- 0:01:27 588000 -- [-1686.659] (-1680.363) (-1680.640) (-1680.685) * [-1683.407] (-1684.744) (-1681.592) (-1681.080) -- 0:01:28 588500 -- (-1679.203) (-1692.616) [-1672.994] (-1681.463) * (-1681.917) [-1683.748] (-1684.660) (-1672.809) -- 0:01:28 589000 -- (-1682.710) (-1682.738) [-1680.309] (-1677.947) * [-1677.058] (-1675.924) (-1683.496) (-1673.701) -- 0:01:27 589500 -- (-1680.008) (-1676.078) [-1683.096] (-1677.364) * [-1676.268] (-1676.035) (-1681.719) (-1683.734) -- 0:01:27 590000 -- (-1676.162) [-1676.856] (-1675.456) (-1677.251) * (-1684.238) (-1674.967) [-1676.552] (-1679.413) -- 0:01:27 Average standard deviation of split frequencies: 0.007050 590500 -- (-1681.293) (-1682.732) (-1682.644) [-1679.445] * (-1683.060) (-1678.982) [-1676.985] (-1679.998) -- 0:01:27 591000 -- (-1680.247) (-1683.527) [-1681.380] (-1674.450) * [-1677.508] (-1670.571) (-1683.355) (-1685.392) -- 0:01:27 591500 -- (-1677.198) (-1684.325) [-1675.572] (-1681.026) * [-1672.232] (-1678.217) (-1681.094) (-1685.083) -- 0:01:27 592000 -- (-1685.991) [-1674.069] (-1684.791) (-1694.034) * (-1680.213) (-1682.028) [-1684.249] (-1675.253) -- 0:01:26 592500 -- (-1681.182) (-1673.351) [-1675.982] (-1693.961) * (-1684.359) [-1681.712] (-1679.376) (-1681.982) -- 0:01:27 593000 -- [-1683.215] (-1679.359) (-1673.901) (-1686.972) * [-1676.946] (-1682.000) (-1681.100) (-1682.093) -- 0:01:27 593500 -- (-1678.813) (-1677.699) [-1674.663] (-1676.228) * (-1684.686) [-1684.166] (-1671.648) (-1680.686) -- 0:01:26 594000 -- (-1684.002) (-1680.016) [-1676.621] (-1681.007) * (-1676.712) [-1673.896] (-1679.549) (-1682.730) -- 0:01:26 594500 -- (-1681.513) (-1681.218) (-1682.013) [-1674.709] * (-1675.988) (-1683.313) [-1673.347] (-1685.177) -- 0:01:26 595000 -- [-1674.753] (-1683.537) (-1677.207) (-1673.639) * (-1677.774) (-1685.361) (-1677.973) [-1683.850] -- 0:01:26 Average standard deviation of split frequencies: 0.007514 595500 -- (-1684.157) [-1675.016] (-1686.748) (-1673.823) * (-1671.525) [-1676.961] (-1678.285) (-1681.302) -- 0:01:26 596000 -- (-1685.769) [-1678.711] (-1684.461) (-1678.026) * (-1673.923) (-1678.528) [-1672.586] (-1687.497) -- 0:01:26 596500 -- (-1681.933) [-1677.369] (-1679.133) (-1684.643) * [-1676.632] (-1681.384) (-1681.262) (-1682.473) -- 0:01:25 597000 -- (-1683.150) (-1672.083) (-1675.064) [-1677.668] * (-1673.642) [-1679.219] (-1677.663) (-1681.491) -- 0:01:25 597500 -- (-1683.079) (-1681.122) (-1671.025) [-1678.242] * (-1682.180) (-1682.474) (-1677.915) [-1677.139] -- 0:01:26 598000 -- (-1679.780) [-1674.275] (-1676.995) (-1676.471) * (-1679.134) (-1673.812) [-1677.440] (-1673.406) -- 0:01:26 598500 -- (-1682.809) (-1679.880) [-1671.335] (-1676.038) * [-1683.290] (-1678.955) (-1683.115) (-1688.897) -- 0:01:25 599000 -- [-1684.110] (-1675.749) (-1680.791) (-1672.091) * [-1671.761] (-1673.372) (-1690.177) (-1681.287) -- 0:01:25 599500 -- (-1674.610) (-1683.937) [-1673.050] (-1683.806) * (-1682.283) (-1682.525) [-1676.653] (-1672.351) -- 0:01:25 600000 -- [-1677.368] (-1678.000) (-1683.288) (-1682.139) * (-1680.682) [-1675.201] (-1673.340) (-1683.209) -- 0:01:25 Average standard deviation of split frequencies: 0.008240 600500 -- (-1684.078) (-1681.381) [-1677.778] (-1677.411) * [-1670.342] (-1682.563) (-1677.578) (-1680.604) -- 0:01:25 601000 -- [-1677.053] (-1674.497) (-1682.491) (-1682.617) * (-1672.956) [-1686.843] (-1678.542) (-1694.825) -- 0:01:24 601500 -- (-1685.012) [-1687.421] (-1685.063) (-1682.381) * [-1687.059] (-1698.929) (-1673.630) (-1675.917) -- 0:01:24 602000 -- (-1677.106) (-1677.313) (-1675.465) [-1672.366] * [-1680.893] (-1682.937) (-1680.599) (-1677.081) -- 0:01:24 602500 -- (-1678.258) (-1683.248) [-1677.493] (-1678.306) * (-1689.632) (-1688.001) (-1675.575) [-1678.796] -- 0:01:25 603000 -- (-1675.169) (-1679.480) [-1673.037] (-1682.161) * (-1680.347) (-1684.910) (-1678.423) [-1681.319] -- 0:01:24 603500 -- (-1679.578) (-1687.969) [-1675.423] (-1678.497) * (-1681.278) (-1687.497) (-1683.223) [-1686.260] -- 0:01:24 604000 -- (-1680.282) [-1678.122] (-1684.165) (-1679.144) * (-1682.153) (-1680.205) [-1677.782] (-1676.153) -- 0:01:24 604500 -- [-1679.140] (-1677.958) (-1674.431) (-1679.682) * (-1682.163) (-1678.456) [-1674.504] (-1678.862) -- 0:01:24 605000 -- (-1685.887) (-1673.535) [-1673.613] (-1678.223) * (-1681.734) [-1677.213] (-1683.143) (-1680.830) -- 0:01:24 Average standard deviation of split frequencies: 0.007649 605500 -- (-1678.467) (-1673.082) [-1677.535] (-1679.052) * (-1679.620) (-1676.488) [-1673.889] (-1674.071) -- 0:01:24 606000 -- [-1684.321] (-1684.257) (-1685.968) (-1677.041) * (-1686.047) (-1680.856) (-1675.502) [-1684.490] -- 0:01:23 606500 -- (-1683.608) [-1674.177] (-1676.498) (-1675.513) * [-1676.672] (-1678.293) (-1688.349) (-1675.183) -- 0:01:23 607000 -- (-1690.558) (-1676.721) [-1673.816] (-1676.822) * [-1674.868] (-1673.794) (-1696.128) (-1681.591) -- 0:01:24 607500 -- (-1684.617) [-1676.011] (-1674.939) (-1686.769) * (-1674.138) [-1671.944] (-1681.940) (-1676.468) -- 0:01:23 608000 -- (-1674.878) (-1677.663) (-1672.481) [-1679.094] * (-1677.198) [-1676.888] (-1679.363) (-1679.803) -- 0:01:23 608500 -- (-1684.198) [-1673.148] (-1680.738) (-1686.647) * (-1673.556) (-1674.942) [-1677.960] (-1677.610) -- 0:01:23 609000 -- (-1681.010) (-1669.125) (-1681.591) [-1676.803] * [-1670.882] (-1683.341) (-1681.627) (-1680.805) -- 0:01:23 609500 -- (-1678.719) [-1680.162] (-1677.237) (-1687.886) * (-1682.052) (-1682.458) (-1685.321) [-1686.521] -- 0:01:23 610000 -- (-1682.973) [-1672.870] (-1672.079) (-1673.371) * (-1679.358) [-1674.610] (-1681.477) (-1679.564) -- 0:01:23 Average standard deviation of split frequencies: 0.006562 610500 -- (-1682.525) (-1669.350) [-1676.150] (-1683.112) * [-1682.611] (-1675.254) (-1678.265) (-1687.204) -- 0:01:22 611000 -- (-1678.657) (-1676.288) [-1677.074] (-1686.123) * (-1681.695) (-1677.921) [-1679.882] (-1678.124) -- 0:01:22 611500 -- (-1678.792) [-1673.791] (-1682.201) (-1675.305) * (-1674.717) (-1681.803) [-1674.886] (-1676.609) -- 0:01:22 612000 -- (-1678.439) [-1681.112] (-1678.829) (-1682.631) * (-1681.865) (-1675.100) (-1684.815) [-1675.205] -- 0:01:23 612500 -- [-1674.846] (-1682.086) (-1681.961) (-1677.325) * (-1674.445) [-1674.873] (-1676.909) (-1679.652) -- 0:01:22 613000 -- (-1671.631) (-1680.098) (-1681.348) [-1677.547] * [-1682.620] (-1673.779) (-1675.009) (-1677.377) -- 0:01:22 613500 -- [-1679.836] (-1685.629) (-1683.241) (-1678.557) * (-1676.232) [-1673.870] (-1676.287) (-1679.270) -- 0:01:22 614000 -- [-1673.538] (-1679.941) (-1681.073) (-1686.158) * (-1684.183) (-1677.169) (-1679.872) [-1679.198] -- 0:01:22 614500 -- (-1683.026) (-1683.082) (-1682.827) [-1678.002] * (-1679.832) (-1681.211) [-1680.963] (-1689.099) -- 0:01:22 615000 -- (-1686.216) (-1683.409) (-1676.020) [-1679.271] * (-1687.405) (-1677.804) (-1673.136) [-1671.353] -- 0:01:22 Average standard deviation of split frequencies: 0.006505 615500 -- (-1687.293) (-1678.756) [-1676.181] (-1674.038) * (-1690.817) (-1676.547) [-1676.294] (-1680.053) -- 0:01:21 616000 -- [-1674.603] (-1681.037) (-1683.053) (-1676.200) * (-1690.559) (-1677.007) (-1682.361) [-1678.817] -- 0:01:21 616500 -- (-1676.150) (-1678.041) [-1677.566] (-1671.805) * (-1681.711) [-1675.592] (-1678.949) (-1678.216) -- 0:01:22 617000 -- [-1682.881] (-1683.311) (-1683.616) (-1677.801) * [-1675.813] (-1682.259) (-1676.029) (-1682.796) -- 0:01:21 617500 -- [-1685.176] (-1682.942) (-1676.545) (-1679.329) * (-1685.114) (-1676.722) (-1679.981) [-1676.404] -- 0:01:21 618000 -- (-1677.438) (-1680.412) [-1674.032] (-1681.001) * (-1678.897) (-1680.139) (-1674.188) [-1679.667] -- 0:01:21 618500 -- (-1685.592) (-1678.059) (-1675.637) [-1673.082] * (-1679.661) (-1674.466) (-1683.197) [-1677.396] -- 0:01:21 619000 -- (-1678.201) [-1679.493] (-1681.628) (-1684.456) * (-1672.478) (-1680.956) (-1676.588) [-1680.118] -- 0:01:21 619500 -- (-1682.634) (-1679.374) (-1678.146) [-1673.303] * (-1681.819) (-1686.381) (-1676.763) [-1679.013] -- 0:01:21 620000 -- (-1681.222) (-1675.778) (-1680.310) [-1680.875] * [-1677.598] (-1688.990) (-1677.939) (-1674.376) -- 0:01:20 Average standard deviation of split frequencies: 0.004937 620500 -- (-1679.412) [-1675.090] (-1678.383) (-1684.615) * (-1683.598) [-1680.406] (-1687.104) (-1680.894) -- 0:01:20 621000 -- (-1685.700) (-1680.774) [-1677.785] (-1682.100) * (-1682.867) (-1693.478) (-1682.956) [-1676.151] -- 0:01:20 621500 -- (-1683.063) (-1679.681) (-1671.753) [-1670.789] * (-1675.930) (-1671.090) [-1677.572] (-1678.631) -- 0:01:20 622000 -- (-1676.128) (-1680.884) (-1673.872) [-1673.207] * (-1680.962) (-1680.316) (-1679.900) [-1682.738] -- 0:01:20 622500 -- (-1681.670) [-1679.725] (-1676.778) (-1680.001) * (-1690.757) (-1675.765) [-1677.498] (-1677.224) -- 0:01:20 623000 -- (-1678.795) [-1678.589] (-1676.943) (-1680.081) * (-1676.311) (-1674.443) (-1680.026) [-1677.448] -- 0:01:20 623500 -- (-1681.501) (-1681.024) [-1671.864] (-1678.672) * [-1673.309] (-1679.522) (-1676.902) (-1679.772) -- 0:01:20 624000 -- (-1685.745) [-1676.980] (-1678.657) (-1682.997) * (-1676.030) (-1680.815) [-1672.646] (-1674.696) -- 0:01:20 624500 -- [-1682.242] (-1672.583) (-1681.096) (-1686.922) * (-1678.910) (-1677.704) [-1680.795] (-1676.418) -- 0:01:19 625000 -- (-1675.657) (-1672.667) [-1682.028] (-1682.009) * (-1680.876) (-1677.360) [-1680.561] (-1676.037) -- 0:01:19 Average standard deviation of split frequencies: 0.004644 625500 -- [-1685.868] (-1682.197) (-1676.016) (-1672.477) * [-1677.518] (-1682.443) (-1681.610) (-1674.745) -- 0:01:19 626000 -- (-1676.733) [-1679.780] (-1677.857) (-1672.694) * [-1674.124] (-1675.997) (-1679.561) (-1675.771) -- 0:01:20 626500 -- (-1676.389) [-1677.336] (-1680.235) (-1673.886) * (-1674.804) (-1677.060) [-1677.711] (-1677.966) -- 0:01:19 627000 -- (-1672.611) [-1678.908] (-1685.516) (-1673.759) * (-1674.308) [-1685.786] (-1682.615) (-1686.074) -- 0:01:19 627500 -- [-1679.375] (-1683.609) (-1683.607) (-1674.997) * (-1682.681) [-1673.057] (-1677.118) (-1688.522) -- 0:01:19 628000 -- (-1676.817) (-1682.753) [-1675.454] (-1679.439) * (-1673.235) (-1674.015) (-1674.008) [-1679.590] -- 0:01:19 628500 -- [-1677.370] (-1685.472) (-1680.686) (-1681.973) * (-1678.553) (-1679.787) [-1672.709] (-1684.606) -- 0:01:19 629000 -- [-1674.357] (-1673.936) (-1687.932) (-1680.294) * (-1688.688) (-1675.284) [-1676.432] (-1688.015) -- 0:01:19 629500 -- [-1674.345] (-1687.395) (-1687.690) (-1681.013) * (-1680.897) (-1678.929) (-1685.768) [-1679.270] -- 0:01:18 630000 -- [-1673.453] (-1684.367) (-1684.302) (-1680.367) * (-1684.720) (-1678.874) [-1674.830] (-1686.946) -- 0:01:18 Average standard deviation of split frequencies: 0.004609 630500 -- (-1685.175) (-1678.377) (-1679.045) [-1673.156] * (-1681.202) (-1686.003) [-1672.124] (-1688.240) -- 0:01:18 631000 -- [-1678.779] (-1683.556) (-1681.293) (-1676.341) * (-1682.182) [-1675.482] (-1672.359) (-1684.133) -- 0:01:18 631500 -- [-1672.705] (-1677.958) (-1678.326) (-1687.732) * (-1687.881) (-1684.927) [-1677.923] (-1680.133) -- 0:01:18 632000 -- [-1676.187] (-1682.179) (-1680.637) (-1675.346) * (-1694.945) [-1678.706] (-1691.545) (-1684.115) -- 0:01:18 632500 -- (-1675.018) (-1684.180) (-1680.249) [-1680.092] * (-1681.238) (-1680.034) (-1679.058) [-1674.435] -- 0:01:18 633000 -- [-1678.447] (-1682.360) (-1685.670) (-1676.358) * (-1682.877) (-1676.125) [-1674.074] (-1674.933) -- 0:01:18 633500 -- [-1678.737] (-1683.416) (-1670.658) (-1679.595) * (-1677.925) (-1681.086) (-1690.455) [-1674.412] -- 0:01:18 634000 -- [-1677.804] (-1677.748) (-1673.826) (-1671.452) * (-1687.395) (-1679.245) (-1678.154) [-1671.037] -- 0:01:17 634500 -- (-1684.998) (-1678.155) [-1676.725] (-1692.204) * (-1682.434) [-1674.216] (-1688.034) (-1680.366) -- 0:01:17 635000 -- (-1674.095) [-1679.662] (-1680.930) (-1681.538) * (-1673.894) (-1680.229) [-1676.760] (-1676.142) -- 0:01:17 Average standard deviation of split frequencies: 0.004324 635500 -- [-1681.950] (-1685.253) (-1676.951) (-1679.617) * (-1676.402) (-1674.166) (-1685.965) [-1678.640] -- 0:01:18 636000 -- [-1676.119] (-1677.672) (-1675.872) (-1678.229) * [-1679.272] (-1679.524) (-1680.605) (-1681.860) -- 0:01:17 636500 -- (-1676.168) (-1686.434) (-1680.183) [-1676.776] * (-1680.195) [-1679.161] (-1690.412) (-1688.018) -- 0:01:17 637000 -- (-1683.276) (-1676.331) [-1675.204] (-1678.528) * [-1679.109] (-1677.701) (-1680.551) (-1688.312) -- 0:01:17 637500 -- [-1679.582] (-1684.052) (-1682.914) (-1682.768) * (-1687.827) (-1684.103) (-1681.350) [-1671.514] -- 0:01:17 638000 -- (-1681.035) [-1679.918] (-1677.644) (-1687.065) * (-1684.587) (-1684.635) [-1675.797] (-1676.286) -- 0:01:17 638500 -- (-1686.370) (-1678.433) (-1688.779) [-1669.471] * (-1684.152) (-1679.285) (-1679.116) [-1678.156] -- 0:01:16 639000 -- (-1686.021) (-1682.043) (-1678.015) [-1668.955] * [-1678.235] (-1680.783) (-1673.544) (-1675.542) -- 0:01:16 639500 -- [-1678.591] (-1677.322) (-1679.541) (-1680.055) * (-1685.785) (-1679.035) (-1674.038) [-1678.220] -- 0:01:16 640000 -- [-1676.613] (-1673.180) (-1676.330) (-1680.239) * (-1676.738) (-1684.398) (-1678.715) [-1676.238] -- 0:01:16 Average standard deviation of split frequencies: 0.004292 640500 -- (-1677.543) [-1678.213] (-1682.880) (-1675.461) * (-1673.933) [-1681.425] (-1682.036) (-1674.394) -- 0:01:16 641000 -- (-1673.670) (-1677.813) [-1674.029] (-1686.643) * [-1672.100] (-1676.334) (-1687.186) (-1677.400) -- 0:01:16 641500 -- (-1679.696) [-1676.833] (-1679.481) (-1692.229) * (-1679.392) (-1676.677) (-1688.144) [-1670.160] -- 0:01:16 642000 -- (-1684.642) (-1681.018) [-1677.531] (-1676.793) * [-1676.113] (-1683.672) (-1688.035) (-1678.598) -- 0:01:16 642500 -- (-1674.634) (-1677.103) (-1677.315) [-1674.730] * [-1675.888] (-1678.791) (-1687.779) (-1672.809) -- 0:01:16 643000 -- (-1670.950) (-1676.801) (-1682.260) [-1679.253] * [-1675.142] (-1681.545) (-1679.736) (-1681.749) -- 0:01:16 643500 -- (-1677.832) (-1675.515) (-1685.128) [-1678.143] * (-1680.704) (-1678.025) [-1677.743] (-1680.432) -- 0:01:15 644000 -- (-1681.244) [-1680.463] (-1680.260) (-1688.126) * [-1679.696] (-1680.813) (-1683.121) (-1675.167) -- 0:01:15 644500 -- (-1678.306) (-1690.124) (-1692.361) [-1676.848] * (-1686.353) (-1685.847) (-1681.754) [-1674.975] -- 0:01:15 645000 -- (-1673.025) (-1679.329) (-1681.066) [-1677.128] * (-1682.074) (-1679.607) [-1678.747] (-1672.621) -- 0:01:15 Average standard deviation of split frequencies: 0.004500 645500 -- (-1680.713) (-1674.894) (-1678.715) [-1674.827] * (-1686.258) (-1681.090) (-1675.008) [-1671.101] -- 0:01:15 646000 -- [-1681.063] (-1680.750) (-1685.081) (-1675.904) * [-1677.681] (-1684.451) (-1681.620) (-1681.990) -- 0:01:15 646500 -- (-1696.497) [-1684.016] (-1680.190) (-1680.115) * (-1680.230) [-1677.024] (-1679.976) (-1679.392) -- 0:01:15 647000 -- (-1675.334) (-1678.214) [-1674.128] (-1669.486) * (-1677.374) [-1678.762] (-1678.882) (-1674.337) -- 0:01:15 647500 -- (-1685.389) [-1689.150] (-1676.444) (-1685.414) * (-1674.683) (-1678.616) (-1681.338) [-1672.602] -- 0:01:15 648000 -- (-1678.260) (-1676.373) (-1684.859) [-1680.094] * (-1684.195) (-1682.396) (-1677.919) [-1675.882] -- 0:01:14 648500 -- (-1679.858) [-1677.307] (-1682.464) (-1683.004) * (-1678.677) (-1674.435) [-1670.749] (-1686.533) -- 0:01:14 649000 -- (-1679.689) (-1677.613) (-1687.920) [-1674.787] * (-1675.293) [-1674.979] (-1679.447) (-1681.503) -- 0:01:14 649500 -- (-1683.398) [-1673.340] (-1675.359) (-1673.999) * (-1688.554) (-1679.405) (-1686.263) [-1677.510] -- 0:01:14 650000 -- (-1680.834) (-1676.964) (-1673.888) [-1676.129] * (-1682.451) (-1691.920) [-1678.225] (-1673.002) -- 0:01:14 Average standard deviation of split frequencies: 0.004951 650500 -- (-1684.749) (-1681.445) (-1678.151) [-1672.982] * (-1693.390) [-1679.372] (-1679.331) (-1689.316) -- 0:01:14 651000 -- (-1678.697) (-1683.632) [-1676.844] (-1674.477) * (-1674.705) [-1673.443] (-1684.980) (-1669.490) -- 0:01:14 651500 -- (-1689.629) [-1673.635] (-1676.932) (-1683.563) * (-1676.967) [-1674.524] (-1680.845) (-1676.565) -- 0:01:14 652000 -- (-1683.437) (-1677.391) [-1676.398] (-1676.532) * (-1684.529) (-1675.903) (-1677.515) [-1671.526] -- 0:01:14 652500 -- (-1679.973) (-1679.647) [-1677.658] (-1669.797) * [-1675.202] (-1681.088) (-1679.893) (-1680.015) -- 0:01:14 653000 -- (-1675.276) (-1681.387) [-1676.455] (-1672.027) * [-1671.182] (-1677.191) (-1682.269) (-1681.095) -- 0:01:13 653500 -- (-1675.663) (-1671.185) (-1678.938) [-1676.956] * (-1684.334) (-1681.169) [-1675.594] (-1672.556) -- 0:01:13 654000 -- [-1676.559] (-1674.775) (-1684.804) (-1678.888) * (-1683.651) (-1680.568) [-1674.563] (-1675.470) -- 0:01:13 654500 -- (-1680.190) (-1679.084) [-1683.890] (-1677.523) * (-1679.541) (-1677.502) [-1672.228] (-1683.319) -- 0:01:13 655000 -- [-1680.700] (-1679.029) (-1681.401) (-1675.130) * (-1677.388) (-1678.184) [-1675.977] (-1678.770) -- 0:01:13 Average standard deviation of split frequencies: 0.005629 655500 -- (-1689.809) (-1675.324) (-1679.932) [-1676.339] * (-1676.579) [-1682.188] (-1685.352) (-1671.761) -- 0:01:13 656000 -- (-1676.729) (-1683.200) (-1678.196) [-1675.031] * [-1686.404] (-1677.727) (-1679.901) (-1680.681) -- 0:01:13 656500 -- (-1682.416) (-1686.662) [-1683.148] (-1680.867) * (-1680.512) [-1682.922] (-1692.687) (-1681.909) -- 0:01:13 657000 -- (-1682.416) [-1682.561] (-1679.839) (-1678.121) * [-1674.334] (-1682.084) (-1676.964) (-1689.641) -- 0:01:13 657500 -- [-1671.277] (-1675.407) (-1681.632) (-1683.894) * [-1678.718] (-1681.039) (-1687.835) (-1680.632) -- 0:01:12 658000 -- [-1673.787] (-1672.587) (-1682.019) (-1680.442) * (-1681.875) [-1678.568] (-1686.824) (-1684.291) -- 0:01:12 658500 -- [-1676.139] (-1684.536) (-1678.782) (-1674.879) * (-1680.522) [-1677.714] (-1680.542) (-1684.070) -- 0:01:12 659000 -- (-1680.888) (-1684.449) (-1686.505) [-1675.235] * (-1681.010) (-1675.669) [-1678.058] (-1674.907) -- 0:01:12 659500 -- [-1678.652] (-1685.137) (-1682.453) (-1680.132) * (-1688.383) (-1671.916) (-1675.865) [-1672.160] -- 0:01:12 660000 -- [-1675.348] (-1685.946) (-1680.193) (-1688.620) * (-1681.311) (-1678.683) (-1673.068) [-1673.586] -- 0:01:12 Average standard deviation of split frequencies: 0.006065 660500 -- (-1676.049) (-1687.813) (-1684.486) [-1689.115] * (-1695.593) [-1678.706] (-1679.946) (-1676.242) -- 0:01:12 661000 -- [-1677.586] (-1687.875) (-1681.241) (-1680.486) * (-1685.615) (-1677.645) [-1672.944] (-1682.093) -- 0:01:12 661500 -- (-1682.132) (-1690.713) (-1678.324) [-1683.345] * (-1679.689) (-1684.686) [-1676.781] (-1679.610) -- 0:01:12 662000 -- (-1680.603) [-1677.742] (-1680.043) (-1675.610) * (-1682.525) (-1680.636) [-1676.477] (-1678.626) -- 0:01:11 662500 -- (-1695.759) [-1678.835] (-1680.406) (-1685.073) * (-1685.846) (-1681.699) (-1681.153) [-1673.955] -- 0:01:11 663000 -- (-1689.426) (-1687.728) [-1676.720] (-1679.844) * (-1678.816) (-1682.125) [-1678.823] (-1685.367) -- 0:01:11 663500 -- (-1688.859) (-1678.823) (-1676.713) [-1674.968] * (-1681.155) (-1676.269) (-1681.717) [-1682.433] -- 0:01:11 664000 -- (-1685.227) (-1681.048) (-1680.389) [-1672.905] * (-1677.625) [-1677.703] (-1675.641) (-1677.535) -- 0:01:11 664500 -- (-1680.219) [-1680.793] (-1670.645) (-1695.236) * (-1682.436) [-1678.094] (-1676.991) (-1680.181) -- 0:01:11 665000 -- (-1677.177) (-1681.326) (-1679.347) [-1680.954] * (-1680.264) [-1674.412] (-1683.171) (-1678.916) -- 0:01:11 Average standard deviation of split frequencies: 0.006016 665500 -- [-1674.369] (-1680.288) (-1675.459) (-1689.422) * (-1690.980) [-1673.245] (-1684.505) (-1674.965) -- 0:01:11 666000 -- (-1678.661) (-1671.359) (-1679.733) [-1678.286] * [-1682.277] (-1684.974) (-1683.478) (-1678.207) -- 0:01:11 666500 -- (-1676.110) [-1681.549] (-1678.859) (-1681.031) * (-1680.662) [-1681.649] (-1680.543) (-1688.792) -- 0:01:11 667000 -- (-1688.492) [-1676.242] (-1680.121) (-1676.733) * [-1674.221] (-1679.757) (-1684.384) (-1677.141) -- 0:01:10 667500 -- (-1680.573) (-1680.281) (-1682.615) [-1678.701] * (-1677.460) (-1677.728) [-1676.624] (-1676.680) -- 0:01:10 668000 -- (-1678.593) (-1677.185) [-1673.810] (-1675.186) * (-1682.649) (-1680.874) [-1673.598] (-1674.268) -- 0:01:10 668500 -- (-1685.408) [-1676.334] (-1674.803) (-1686.856) * (-1677.901) (-1685.267) [-1675.815] (-1678.420) -- 0:01:10 669000 -- (-1690.706) [-1675.178] (-1675.945) (-1680.338) * (-1685.088) (-1676.924) [-1669.860] (-1678.569) -- 0:01:10 669500 -- [-1681.100] (-1676.153) (-1685.004) (-1682.813) * (-1685.461) (-1681.797) (-1677.433) [-1672.138] -- 0:01:10 670000 -- (-1681.194) (-1673.146) (-1675.302) [-1688.421] * (-1679.236) [-1673.381] (-1682.449) (-1676.146) -- 0:01:10 Average standard deviation of split frequencies: 0.006677 670500 -- (-1680.785) [-1675.924] (-1683.320) (-1678.576) * (-1677.586) (-1678.917) [-1688.418] (-1677.799) -- 0:01:10 671000 -- (-1682.746) (-1680.175) (-1681.296) [-1672.736] * (-1691.552) (-1679.237) (-1680.149) [-1675.393] -- 0:01:10 671500 -- (-1676.482) (-1672.352) [-1678.641] (-1680.722) * [-1677.434] (-1678.731) (-1686.732) (-1680.096) -- 0:01:09 672000 -- (-1680.313) (-1680.661) (-1679.664) [-1681.032] * (-1676.209) (-1682.962) (-1674.806) [-1672.062] -- 0:01:09 672500 -- [-1687.430] (-1678.377) (-1685.524) (-1677.896) * (-1679.158) (-1676.928) (-1688.258) [-1675.353] -- 0:01:09 673000 -- (-1682.117) (-1681.350) (-1673.371) [-1676.195] * (-1674.043) (-1679.908) [-1679.993] (-1680.393) -- 0:01:09 673500 -- [-1678.880] (-1681.637) (-1696.342) (-1679.578) * (-1680.079) (-1681.190) [-1675.555] (-1675.493) -- 0:01:09 674000 -- (-1678.839) (-1677.453) (-1686.535) [-1677.382] * [-1676.951] (-1684.195) (-1688.366) (-1680.083) -- 0:01:09 674500 -- (-1681.993) [-1674.639] (-1681.379) (-1680.525) * [-1677.218] (-1682.638) (-1678.716) (-1675.487) -- 0:01:09 675000 -- (-1690.386) [-1678.951] (-1677.952) (-1681.079) * (-1672.610) (-1687.230) (-1679.329) [-1681.145] -- 0:01:09 Average standard deviation of split frequencies: 0.006625 675500 -- (-1678.035) (-1673.612) [-1676.867] (-1674.115) * [-1675.235] (-1688.303) (-1681.274) (-1681.565) -- 0:01:09 676000 -- (-1679.850) [-1676.011] (-1675.682) (-1678.650) * (-1679.076) (-1693.522) [-1675.026] (-1676.362) -- 0:01:09 676500 -- [-1676.331] (-1674.654) (-1671.483) (-1681.648) * (-1676.079) (-1679.796) [-1673.106] (-1675.975) -- 0:01:08 677000 -- (-1688.212) (-1686.342) (-1677.329) [-1677.845] * [-1673.322] (-1674.435) (-1679.356) (-1678.772) -- 0:01:08 677500 -- (-1676.148) (-1676.294) (-1673.065) [-1679.760] * (-1683.849) [-1673.749] (-1684.609) (-1682.164) -- 0:01:08 678000 -- (-1678.185) (-1673.281) (-1676.203) [-1673.736] * [-1682.458] (-1679.757) (-1689.831) (-1686.864) -- 0:01:08 678500 -- [-1673.275] (-1676.831) (-1682.276) (-1682.030) * (-1673.322) (-1681.922) [-1674.370] (-1678.285) -- 0:01:08 679000 -- (-1676.641) [-1676.201] (-1674.530) (-1674.872) * (-1686.314) (-1676.443) [-1669.804] (-1679.697) -- 0:01:08 679500 -- (-1676.386) [-1680.727] (-1681.659) (-1675.932) * [-1685.193] (-1674.256) (-1675.759) (-1682.032) -- 0:01:08 680000 -- [-1679.701] (-1678.190) (-1677.704) (-1676.242) * [-1672.320] (-1683.556) (-1680.641) (-1675.603) -- 0:01:08 Average standard deviation of split frequencies: 0.005887 680500 -- (-1676.957) (-1675.456) [-1680.498] (-1692.778) * (-1673.972) (-1672.392) (-1674.445) [-1672.740] -- 0:01:08 681000 -- (-1679.100) [-1674.474] (-1675.614) (-1673.318) * (-1680.837) [-1678.201] (-1676.631) (-1678.212) -- 0:01:07 681500 -- (-1678.506) [-1674.877] (-1674.517) (-1677.280) * [-1672.606] (-1674.275) (-1678.113) (-1685.370) -- 0:01:07 682000 -- (-1679.483) (-1677.913) [-1674.047] (-1675.002) * [-1679.972] (-1677.583) (-1678.250) (-1672.754) -- 0:01:07 682500 -- (-1683.733) (-1684.202) (-1678.643) [-1676.377] * (-1682.324) (-1672.345) (-1679.343) [-1673.179] -- 0:01:07 683000 -- [-1678.764] (-1683.686) (-1676.480) (-1677.335) * (-1685.648) (-1681.507) [-1676.530] (-1675.022) -- 0:01:07 683500 -- (-1682.431) (-1688.102) [-1675.648] (-1679.835) * [-1674.040] (-1670.585) (-1677.106) (-1680.765) -- 0:01:07 684000 -- (-1682.625) (-1685.336) [-1675.154] (-1679.014) * (-1675.855) (-1675.760) (-1685.831) [-1671.852] -- 0:01:07 684500 -- (-1683.083) (-1679.272) (-1677.146) [-1677.467] * (-1677.948) [-1680.440] (-1671.155) (-1676.622) -- 0:01:07 685000 -- (-1688.031) (-1683.331) (-1673.773) [-1677.020] * [-1675.688] (-1680.322) (-1676.382) (-1676.825) -- 0:01:07 Average standard deviation of split frequencies: 0.006528 685500 -- (-1686.131) (-1675.978) (-1671.548) [-1676.033] * (-1674.315) (-1675.984) (-1684.989) [-1677.244] -- 0:01:06 686000 -- (-1676.266) (-1681.215) [-1679.836] (-1682.622) * [-1680.247] (-1676.743) (-1684.405) (-1678.118) -- 0:01:06 686500 -- (-1697.807) (-1684.592) (-1681.337) [-1676.401] * (-1678.595) [-1675.814] (-1684.773) (-1682.399) -- 0:01:06 687000 -- [-1682.571] (-1682.458) (-1681.372) (-1685.119) * [-1681.145] (-1679.110) (-1686.822) (-1674.622) -- 0:01:06 687500 -- (-1680.777) [-1676.553] (-1683.762) (-1682.509) * (-1681.909) [-1674.654] (-1674.114) (-1682.181) -- 0:01:06 688000 -- [-1680.751] (-1680.020) (-1675.085) (-1683.830) * (-1685.694) [-1671.614] (-1684.963) (-1682.267) -- 0:01:06 688500 -- [-1670.073] (-1675.100) (-1679.719) (-1676.862) * (-1678.194) (-1681.920) [-1672.237] (-1686.138) -- 0:01:06 689000 -- [-1676.420] (-1682.243) (-1681.499) (-1679.147) * (-1680.590) (-1680.132) (-1687.032) [-1682.829] -- 0:01:06 689500 -- (-1676.706) (-1678.732) (-1679.343) [-1673.188] * [-1676.211] (-1689.015) (-1682.652) (-1670.963) -- 0:01:06 690000 -- [-1674.937] (-1682.090) (-1680.522) (-1679.726) * (-1676.692) (-1684.295) (-1694.006) [-1675.795] -- 0:01:06 Average standard deviation of split frequencies: 0.006712 690500 -- (-1682.732) [-1673.604] (-1676.400) (-1675.476) * (-1677.033) [-1678.141] (-1675.614) (-1684.772) -- 0:01:05 691000 -- [-1672.904] (-1681.816) (-1682.083) (-1675.435) * (-1678.798) (-1681.706) [-1673.520] (-1687.054) -- 0:01:05 691500 -- (-1675.766) (-1679.357) [-1676.466] (-1680.763) * (-1678.839) [-1675.012] (-1676.253) (-1676.100) -- 0:01:05 692000 -- (-1680.034) (-1671.708) [-1676.274] (-1675.402) * (-1679.484) (-1676.996) [-1675.522] (-1672.300) -- 0:01:05 692500 -- (-1681.050) (-1672.675) (-1676.581) [-1678.985] * (-1683.561) (-1677.403) [-1675.282] (-1677.367) -- 0:01:05 693000 -- (-1685.868) [-1676.741] (-1684.953) (-1672.704) * (-1677.988) [-1675.327] (-1678.305) (-1681.573) -- 0:01:05 693500 -- (-1680.810) (-1685.655) [-1674.069] (-1673.031) * (-1677.554) (-1679.426) (-1676.879) [-1685.559] -- 0:01:05 694000 -- (-1674.959) (-1675.476) [-1676.182] (-1678.286) * (-1684.859) [-1674.856] (-1675.492) (-1680.328) -- 0:01:05 694500 -- (-1676.865) [-1680.204] (-1678.470) (-1677.317) * (-1676.714) (-1681.425) [-1671.602] (-1684.065) -- 0:01:05 695000 -- (-1681.588) (-1687.508) [-1681.626] (-1679.049) * (-1672.050) [-1673.710] (-1672.258) (-1677.774) -- 0:01:04 Average standard deviation of split frequencies: 0.007112 695500 -- [-1678.681] (-1681.572) (-1678.730) (-1676.786) * (-1680.750) [-1677.313] (-1677.599) (-1677.422) -- 0:01:04 696000 -- (-1689.308) (-1680.808) (-1675.829) [-1675.278] * [-1679.176] (-1679.174) (-1671.812) (-1675.302) -- 0:01:04 696500 -- (-1676.775) (-1680.716) [-1673.952] (-1675.645) * (-1678.123) (-1681.065) (-1683.388) [-1678.295] -- 0:01:04 697000 -- (-1679.564) (-1674.440) [-1675.303] (-1679.965) * (-1684.954) (-1676.259) (-1677.200) [-1679.533] -- 0:01:04 697500 -- (-1676.844) [-1683.423] (-1676.979) (-1677.095) * (-1679.377) (-1680.372) (-1683.607) [-1680.660] -- 0:01:04 698000 -- [-1674.293] (-1683.028) (-1680.393) (-1685.513) * [-1677.124] (-1678.714) (-1678.417) (-1684.500) -- 0:01:04 698500 -- (-1675.921) (-1675.146) (-1677.913) [-1675.503] * (-1675.331) (-1671.477) [-1677.151] (-1678.000) -- 0:01:04 699000 -- (-1676.307) [-1677.346] (-1679.278) (-1683.239) * [-1672.984] (-1684.176) (-1680.802) (-1675.336) -- 0:01:04 699500 -- (-1675.976) (-1677.392) [-1676.310] (-1676.975) * (-1682.749) [-1680.565] (-1675.574) (-1674.926) -- 0:01:04 700000 -- (-1674.608) [-1674.079] (-1680.858) (-1678.330) * [-1669.470] (-1676.767) (-1680.445) (-1684.538) -- 0:01:03 Average standard deviation of split frequencies: 0.006616 700500 -- (-1677.304) [-1675.068] (-1674.324) (-1696.675) * (-1672.621) (-1682.467) (-1680.988) [-1675.285] -- 0:01:03 701000 -- (-1674.331) (-1677.934) (-1675.767) [-1676.199] * (-1679.461) (-1674.762) [-1678.188] (-1673.182) -- 0:01:03 701500 -- (-1674.137) (-1679.783) (-1673.485) [-1676.167] * (-1680.959) [-1675.969] (-1680.465) (-1677.925) -- 0:01:03 702000 -- (-1671.399) (-1696.574) (-1675.297) [-1680.540] * (-1676.533) (-1681.514) (-1672.315) [-1679.001] -- 0:01:03 702500 -- (-1686.837) (-1679.153) [-1675.977] (-1676.111) * [-1681.528] (-1675.948) (-1673.801) (-1674.437) -- 0:01:03 703000 -- (-1676.949) (-1678.165) [-1675.873] (-1679.972) * (-1675.377) [-1676.158] (-1675.454) (-1680.705) -- 0:01:03 703500 -- (-1684.577) (-1675.757) [-1678.606] (-1673.103) * (-1679.716) (-1679.685) [-1681.603] (-1675.557) -- 0:01:03 704000 -- [-1676.713] (-1672.560) (-1675.787) (-1677.292) * (-1673.389) [-1676.632] (-1687.035) (-1677.168) -- 0:01:03 704500 -- (-1681.727) (-1682.243) (-1676.354) [-1681.001] * [-1678.144] (-1682.146) (-1676.987) (-1689.388) -- 0:01:02 705000 -- [-1678.084] (-1677.444) (-1683.038) (-1680.319) * (-1681.099) [-1670.176] (-1670.029) (-1672.771) -- 0:01:02 Average standard deviation of split frequencies: 0.006566 705500 -- [-1676.437] (-1684.767) (-1677.568) (-1692.789) * (-1675.842) (-1688.259) (-1671.293) [-1675.132] -- 0:01:02 706000 -- (-1683.463) [-1681.962] (-1678.065) (-1683.374) * (-1676.322) (-1681.303) [-1674.219] (-1674.972) -- 0:01:02 706500 -- [-1677.017] (-1675.792) (-1678.357) (-1694.793) * (-1680.540) (-1677.237) [-1671.596] (-1672.102) -- 0:01:02 707000 -- (-1678.999) [-1677.517] (-1674.688) (-1685.669) * (-1674.912) (-1679.951) [-1679.363] (-1677.547) -- 0:01:02 707500 -- [-1678.079] (-1675.046) (-1687.571) (-1683.805) * (-1677.222) [-1683.873] (-1679.389) (-1674.893) -- 0:01:02 708000 -- [-1680.661] (-1674.320) (-1685.599) (-1681.045) * [-1675.066] (-1674.953) (-1684.120) (-1682.070) -- 0:01:02 708500 -- (-1688.016) (-1673.322) [-1674.537] (-1679.342) * (-1682.513) [-1686.677] (-1682.663) (-1684.980) -- 0:01:02 709000 -- [-1678.740] (-1683.012) (-1682.192) (-1677.609) * (-1679.836) (-1680.292) (-1682.802) [-1681.585] -- 0:01:01 709500 -- [-1676.412] (-1674.535) (-1684.835) (-1673.517) * (-1674.053) (-1674.417) [-1687.223] (-1685.121) -- 0:01:01 710000 -- (-1686.682) (-1684.380) (-1687.222) [-1681.671] * (-1684.534) (-1678.709) (-1679.138) [-1676.561] -- 0:01:01 Average standard deviation of split frequencies: 0.006080 710500 -- (-1683.852) (-1676.484) (-1675.519) [-1676.721] * (-1683.107) [-1680.157] (-1681.099) (-1672.471) -- 0:01:01 711000 -- (-1677.157) (-1675.647) [-1676.678] (-1678.873) * [-1680.096] (-1681.379) (-1690.917) (-1678.803) -- 0:01:01 711500 -- (-1679.779) (-1677.064) (-1674.615) [-1671.286] * (-1676.231) (-1676.376) (-1680.234) [-1677.193] -- 0:01:01 712000 -- [-1674.497] (-1676.563) (-1686.997) (-1676.429) * (-1677.704) [-1678.005] (-1675.491) (-1677.315) -- 0:01:01 712500 -- (-1681.952) [-1675.206] (-1683.663) (-1677.556) * [-1679.676] (-1674.964) (-1682.945) (-1679.888) -- 0:01:01 713000 -- (-1677.617) [-1671.616] (-1684.429) (-1686.939) * (-1676.335) (-1675.861) (-1678.814) [-1670.912] -- 0:01:01 713500 -- (-1673.798) (-1677.256) [-1676.725] (-1673.764) * (-1687.544) (-1679.939) [-1671.865] (-1672.036) -- 0:01:01 714000 -- (-1678.815) [-1675.523] (-1680.174) (-1686.723) * (-1679.581) (-1681.131) [-1672.699] (-1679.217) -- 0:01:00 714500 -- (-1681.392) (-1675.022) (-1674.716) [-1672.613] * [-1673.809] (-1681.024) (-1682.486) (-1678.349) -- 0:01:00 715000 -- [-1674.865] (-1686.780) (-1684.009) (-1682.121) * [-1673.229] (-1680.596) (-1681.880) (-1679.453) -- 0:01:00 Average standard deviation of split frequencies: 0.006474 715500 -- (-1674.623) (-1682.626) (-1672.760) [-1669.642] * (-1676.689) [-1679.023] (-1678.094) (-1677.168) -- 0:01:00 716000 -- [-1675.993] (-1689.513) (-1680.161) (-1688.482) * [-1680.094] (-1674.964) (-1677.187) (-1687.584) -- 0:01:00 716500 -- (-1678.644) (-1681.037) (-1676.219) [-1675.234] * (-1676.152) [-1673.276] (-1679.354) (-1682.993) -- 0:01:00 717000 -- (-1686.209) (-1672.308) [-1674.054] (-1680.035) * [-1678.951] (-1673.656) (-1679.171) (-1681.836) -- 0:01:00 717500 -- [-1675.254] (-1676.896) (-1677.804) (-1687.743) * (-1673.570) [-1672.076] (-1675.273) (-1679.693) -- 0:01:00 718000 -- (-1673.526) [-1674.806] (-1671.562) (-1674.378) * (-1679.545) (-1685.846) (-1682.209) [-1676.986] -- 0:01:00 718500 -- (-1687.678) (-1675.329) [-1675.142] (-1676.881) * (-1675.664) (-1684.681) (-1678.842) [-1676.064] -- 0:00:59 719000 -- (-1682.089) (-1674.243) (-1683.071) [-1680.571] * (-1678.092) [-1675.932] (-1681.480) (-1676.813) -- 0:00:59 719500 -- (-1684.500) (-1681.984) (-1673.149) [-1676.629] * (-1679.898) (-1677.498) [-1674.082] (-1677.427) -- 0:00:59 720000 -- (-1692.306) [-1676.857] (-1678.463) (-1674.893) * (-1679.981) [-1681.085] (-1675.561) (-1692.687) -- 0:00:59 Average standard deviation of split frequencies: 0.006214 720500 -- (-1680.751) [-1679.518] (-1682.335) (-1682.699) * (-1685.286) [-1678.470] (-1671.730) (-1682.139) -- 0:00:59 721000 -- (-1681.410) (-1674.831) (-1681.773) [-1676.447] * (-1680.961) (-1685.348) (-1677.084) [-1687.710] -- 0:00:59 721500 -- (-1680.682) [-1678.944] (-1686.914) (-1680.172) * (-1681.412) (-1682.099) [-1672.123] (-1689.877) -- 0:00:59 722000 -- (-1678.653) (-1673.539) (-1691.662) [-1671.896] * (-1680.693) (-1678.378) [-1671.325] (-1686.869) -- 0:00:59 722500 -- (-1691.358) (-1677.847) (-1673.517) [-1673.819] * [-1673.755] (-1679.161) (-1675.830) (-1684.892) -- 0:00:59 723000 -- (-1678.575) (-1676.442) [-1672.159] (-1691.446) * (-1676.761) (-1679.780) [-1678.358] (-1677.650) -- 0:00:59 723500 -- (-1675.749) [-1672.556] (-1678.143) (-1675.543) * (-1684.387) [-1674.560] (-1680.694) (-1680.699) -- 0:00:58 724000 -- (-1677.867) (-1686.209) (-1679.560) [-1684.572] * (-1672.277) [-1673.318] (-1681.881) (-1676.043) -- 0:00:58 724500 -- (-1686.636) [-1673.124] (-1675.273) (-1677.485) * (-1680.244) (-1689.757) [-1684.206] (-1676.131) -- 0:00:58 725000 -- (-1677.742) (-1682.364) [-1676.658] (-1687.746) * (-1671.497) (-1690.782) [-1677.022] (-1675.234) -- 0:00:58 Average standard deviation of split frequencies: 0.006601 725500 -- [-1680.630] (-1677.001) (-1683.633) (-1678.778) * (-1677.893) (-1673.284) [-1679.910] (-1681.494) -- 0:00:58 726000 -- [-1677.180] (-1687.060) (-1679.053) (-1681.166) * (-1675.115) [-1676.022] (-1685.685) (-1678.588) -- 0:00:58 726500 -- (-1684.516) (-1683.644) [-1675.870] (-1676.142) * (-1681.665) (-1675.209) (-1672.145) [-1678.035] -- 0:00:58 727000 -- (-1679.233) [-1674.091] (-1680.845) (-1674.125) * (-1677.843) (-1676.921) (-1683.180) [-1678.318] -- 0:00:58 727500 -- (-1677.307) (-1679.231) (-1682.460) [-1670.991] * (-1682.990) [-1680.666] (-1676.577) (-1678.929) -- 0:00:58 728000 -- (-1675.119) [-1682.982] (-1686.183) (-1675.466) * [-1674.182] (-1675.941) (-1680.887) (-1677.480) -- 0:00:57 728500 -- [-1680.965] (-1686.809) (-1677.065) (-1676.451) * (-1680.032) (-1672.909) (-1687.486) [-1678.703] -- 0:00:57 729000 -- (-1680.734) (-1679.052) (-1684.157) [-1674.418] * (-1682.512) [-1678.388] (-1678.741) (-1679.854) -- 0:00:57 729500 -- [-1673.490] (-1681.972) (-1676.655) (-1678.788) * (-1680.810) [-1674.563] (-1673.067) (-1676.319) -- 0:00:57 730000 -- (-1680.246) [-1677.558] (-1674.436) (-1673.792) * (-1675.682) (-1675.621) (-1680.959) [-1675.893] -- 0:00:57 Average standard deviation of split frequencies: 0.006989 730500 -- (-1676.879) (-1685.879) [-1679.770] (-1676.345) * [-1674.995] (-1678.345) (-1683.912) (-1675.644) -- 0:00:57 731000 -- [-1676.733] (-1683.532) (-1680.537) (-1677.514) * (-1675.123) (-1683.807) [-1672.882] (-1679.327) -- 0:00:57 731500 -- [-1677.435] (-1689.828) (-1681.924) (-1685.609) * [-1677.442] (-1671.334) (-1682.761) (-1677.776) -- 0:00:57 732000 -- [-1671.394] (-1683.939) (-1679.182) (-1673.366) * [-1680.523] (-1675.628) (-1688.118) (-1680.964) -- 0:00:57 732500 -- (-1675.006) (-1677.342) [-1684.417] (-1680.863) * (-1680.342) (-1684.079) [-1676.534] (-1684.188) -- 0:00:56 733000 -- [-1682.349] (-1675.578) (-1679.032) (-1679.752) * (-1690.059) (-1688.979) (-1678.300) [-1677.720] -- 0:00:56 733500 -- (-1677.369) (-1680.152) (-1687.933) [-1674.165] * (-1679.751) [-1675.887] (-1678.759) (-1677.736) -- 0:00:56 734000 -- (-1675.440) (-1674.031) (-1679.642) [-1671.239] * (-1682.903) (-1678.392) [-1675.554] (-1683.309) -- 0:00:56 734500 -- (-1677.564) (-1680.759) (-1683.204) [-1676.969] * (-1675.560) (-1673.417) [-1676.083] (-1683.782) -- 0:00:56 735000 -- [-1676.039] (-1684.111) (-1681.792) (-1685.214) * (-1677.466) (-1676.420) [-1676.511] (-1676.214) -- 0:00:56 Average standard deviation of split frequencies: 0.007152 735500 -- (-1682.392) (-1692.294) [-1685.062] (-1685.341) * [-1679.981] (-1678.930) (-1673.488) (-1677.526) -- 0:00:56 736000 -- (-1679.833) [-1678.102] (-1685.645) (-1688.902) * (-1680.327) (-1678.859) (-1670.767) [-1681.438] -- 0:00:56 736500 -- [-1678.529] (-1679.778) (-1681.309) (-1687.340) * (-1685.803) [-1686.227] (-1679.976) (-1674.936) -- 0:00:56 737000 -- (-1681.149) [-1681.392] (-1679.712) (-1687.761) * (-1681.803) (-1682.374) [-1674.587] (-1679.950) -- 0:00:56 737500 -- [-1678.906] (-1676.095) (-1680.023) (-1691.466) * (-1679.299) [-1674.872] (-1675.495) (-1673.656) -- 0:00:55 738000 -- (-1678.481) [-1681.781] (-1688.757) (-1685.878) * (-1674.981) (-1673.388) [-1679.486] (-1686.391) -- 0:00:55 738500 -- [-1674.433] (-1677.049) (-1682.403) (-1688.797) * (-1679.564) [-1676.419] (-1683.400) (-1679.875) -- 0:00:55 739000 -- (-1677.017) [-1677.513] (-1676.566) (-1686.431) * (-1675.265) (-1678.183) [-1679.752] (-1675.747) -- 0:00:55 739500 -- (-1674.873) (-1680.846) (-1675.949) [-1676.347] * (-1674.198) (-1683.354) (-1681.947) [-1676.244] -- 0:00:55 740000 -- (-1678.271) (-1676.545) (-1678.140) [-1680.621] * [-1676.976] (-1693.782) (-1688.199) (-1672.927) -- 0:00:55 Average standard deviation of split frequencies: 0.007531 740500 -- [-1672.463] (-1679.757) (-1674.851) (-1685.229) * (-1680.631) (-1680.897) [-1675.479] (-1684.578) -- 0:00:55 741000 -- (-1673.352) (-1675.115) [-1678.689] (-1683.280) * [-1676.884] (-1676.795) (-1675.275) (-1676.937) -- 0:00:55 741500 -- [-1679.711] (-1682.889) (-1677.963) (-1683.293) * (-1675.348) (-1679.690) (-1682.518) [-1679.524] -- 0:00:55 742000 -- [-1682.899] (-1677.736) (-1680.131) (-1680.207) * (-1678.704) [-1673.676] (-1682.697) (-1671.595) -- 0:00:54 742500 -- (-1672.391) (-1681.812) (-1695.146) [-1678.020] * (-1675.069) [-1673.815] (-1677.285) (-1678.128) -- 0:00:54 743000 -- [-1675.814] (-1687.760) (-1679.553) (-1678.306) * (-1679.423) (-1677.427) (-1675.895) [-1677.634] -- 0:00:54 743500 -- (-1674.298) (-1678.487) [-1680.358] (-1676.475) * [-1676.318] (-1676.429) (-1688.605) (-1673.571) -- 0:00:54 744000 -- (-1681.759) (-1683.946) [-1675.097] (-1680.011) * (-1681.759) (-1680.011) (-1681.102) [-1682.347] -- 0:00:54 744500 -- (-1688.068) [-1676.641] (-1681.853) (-1676.395) * (-1679.012) (-1680.797) (-1680.177) [-1678.998] -- 0:00:54 745000 -- (-1676.621) [-1678.885] (-1680.732) (-1683.953) * (-1686.782) (-1676.040) [-1680.500] (-1684.877) -- 0:00:54 Average standard deviation of split frequencies: 0.007688 745500 -- [-1680.276] (-1682.371) (-1675.590) (-1675.734) * (-1676.859) [-1680.379] (-1682.290) (-1680.359) -- 0:00:54 746000 -- [-1686.389] (-1684.766) (-1680.650) (-1674.868) * [-1674.253] (-1676.291) (-1677.254) (-1681.077) -- 0:00:54 746500 -- (-1685.761) (-1676.012) [-1673.653] (-1681.694) * (-1683.183) [-1673.401] (-1679.981) (-1681.640) -- 0:00:53 747000 -- (-1679.103) [-1680.794] (-1680.430) (-1678.137) * (-1675.962) [-1675.814] (-1676.257) (-1682.265) -- 0:00:53 747500 -- (-1688.110) [-1678.952] (-1674.306) (-1682.449) * (-1673.453) (-1681.516) [-1673.686] (-1680.859) -- 0:00:53 748000 -- (-1688.239) [-1678.075] (-1676.779) (-1684.261) * (-1684.079) (-1676.711) [-1671.235] (-1679.253) -- 0:00:53 748500 -- (-1676.442) (-1683.754) (-1680.269) [-1680.951] * (-1678.887) (-1684.605) [-1681.045] (-1673.145) -- 0:00:53 749000 -- (-1677.650) (-1685.213) (-1678.529) [-1681.871] * [-1681.224] (-1676.035) (-1680.086) (-1678.995) -- 0:00:53 749500 -- (-1682.870) (-1679.688) [-1670.660] (-1684.369) * (-1680.244) (-1681.004) (-1686.094) [-1674.503] -- 0:00:53 750000 -- (-1684.365) [-1676.742] (-1682.537) (-1676.714) * (-1675.690) [-1678.928] (-1682.680) (-1681.211) -- 0:00:53 Average standard deviation of split frequencies: 0.007640 750500 -- (-1673.940) (-1682.485) [-1678.379] (-1682.174) * (-1678.362) (-1675.637) (-1687.200) [-1679.691] -- 0:00:53 751000 -- (-1674.957) (-1682.980) [-1683.029] (-1687.265) * (-1675.297) [-1673.464] (-1678.035) (-1692.595) -- 0:00:53 751500 -- (-1678.580) (-1679.884) [-1678.530] (-1685.615) * [-1679.392] (-1688.871) (-1682.259) (-1676.196) -- 0:00:52 752000 -- (-1679.638) [-1674.374] (-1689.554) (-1676.357) * (-1677.776) [-1682.628] (-1677.496) (-1680.978) -- 0:00:52 752500 -- (-1679.701) (-1676.698) (-1680.232) [-1674.769] * [-1674.851] (-1683.063) (-1680.575) (-1676.892) -- 0:00:52 753000 -- (-1688.098) (-1679.738) [-1674.875] (-1679.366) * [-1681.151] (-1680.262) (-1674.629) (-1678.730) -- 0:00:52 753500 -- (-1678.116) [-1679.208] (-1682.473) (-1673.466) * (-1677.873) (-1681.040) (-1678.826) [-1673.796] -- 0:00:52 754000 -- (-1680.897) (-1686.296) (-1676.543) [-1670.894] * (-1675.822) [-1675.541] (-1680.799) (-1684.417) -- 0:00:52 754500 -- (-1689.361) (-1672.464) (-1692.722) [-1674.433] * (-1679.716) (-1679.023) [-1679.333] (-1681.437) -- 0:00:52 755000 -- (-1682.406) (-1681.955) [-1680.664] (-1675.756) * (-1672.337) (-1678.060) [-1671.423] (-1685.370) -- 0:00:52 Average standard deviation of split frequencies: 0.007483 755500 -- [-1681.505] (-1682.083) (-1676.972) (-1680.696) * (-1676.813) [-1686.087] (-1681.260) (-1679.017) -- 0:00:52 756000 -- [-1671.769] (-1679.422) (-1675.955) (-1677.821) * [-1678.676] (-1685.807) (-1673.338) (-1680.822) -- 0:00:51 756500 -- (-1678.374) [-1678.188] (-1681.169) (-1677.957) * (-1687.408) [-1684.044] (-1674.279) (-1672.421) -- 0:00:51 757000 -- (-1676.697) (-1680.371) [-1674.596] (-1675.745) * (-1675.863) (-1677.958) [-1678.128] (-1680.149) -- 0:00:51 757500 -- (-1680.165) (-1678.821) [-1673.110] (-1673.825) * (-1679.324) [-1683.707] (-1685.207) (-1673.615) -- 0:00:51 758000 -- (-1674.720) (-1684.626) [-1680.273] (-1683.475) * [-1677.327] (-1669.883) (-1678.512) (-1679.306) -- 0:00:51 758500 -- (-1677.889) (-1681.416) (-1680.654) [-1674.122] * [-1679.404] (-1679.458) (-1676.833) (-1684.562) -- 0:00:51 759000 -- (-1679.184) (-1681.517) [-1685.040] (-1673.398) * (-1683.028) [-1673.201] (-1675.745) (-1679.667) -- 0:00:51 759500 -- (-1679.521) (-1677.631) [-1682.001] (-1675.293) * (-1676.162) [-1671.056] (-1681.026) (-1684.873) -- 0:00:51 760000 -- [-1674.295] (-1679.724) (-1672.993) (-1683.494) * (-1680.967) (-1678.443) (-1680.346) [-1670.468] -- 0:00:51 Average standard deviation of split frequencies: 0.007437 760500 -- (-1673.011) (-1675.250) (-1682.619) [-1674.567] * (-1680.524) (-1679.454) [-1683.099] (-1682.341) -- 0:00:51 761000 -- (-1677.497) (-1686.471) (-1674.746) [-1679.381] * (-1679.417) [-1682.365] (-1684.764) (-1683.571) -- 0:00:50 761500 -- [-1685.824] (-1676.624) (-1683.221) (-1673.210) * (-1676.750) (-1680.407) (-1687.663) [-1679.228] -- 0:00:50 762000 -- (-1678.765) (-1675.776) (-1675.690) [-1678.257] * (-1682.787) (-1676.827) (-1682.219) [-1672.851] -- 0:00:50 762500 -- [-1686.217] (-1671.518) (-1676.433) (-1687.639) * [-1677.862] (-1680.625) (-1690.663) (-1671.985) -- 0:00:50 763000 -- (-1677.119) [-1681.166] (-1679.559) (-1680.081) * (-1671.040) (-1674.743) [-1676.873] (-1676.482) -- 0:00:50 763500 -- (-1675.529) (-1674.466) [-1682.824] (-1680.272) * (-1682.263) (-1677.674) (-1678.413) [-1681.339] -- 0:00:50 764000 -- [-1670.111] (-1690.367) (-1679.158) (-1675.919) * [-1678.571] (-1676.920) (-1682.506) (-1673.558) -- 0:00:50 764500 -- (-1683.132) [-1674.568] (-1673.630) (-1677.281) * (-1677.172) (-1678.089) (-1672.735) [-1675.371] -- 0:00:50 765000 -- [-1673.929] (-1683.998) (-1681.409) (-1675.764) * (-1675.094) [-1677.950] (-1675.525) (-1682.830) -- 0:00:50 Average standard deviation of split frequencies: 0.006872 765500 -- (-1679.283) [-1673.889] (-1696.722) (-1675.803) * [-1676.224] (-1681.674) (-1674.449) (-1678.554) -- 0:00:49 766000 -- [-1674.002] (-1678.229) (-1682.742) (-1675.425) * (-1677.844) [-1680.097] (-1680.686) (-1679.242) -- 0:00:49 766500 -- [-1675.671] (-1677.111) (-1682.989) (-1685.152) * (-1677.744) (-1676.863) [-1669.788] (-1678.120) -- 0:00:49 767000 -- (-1674.133) (-1683.776) (-1682.699) [-1679.829] * (-1678.826) (-1685.267) (-1675.156) [-1674.463] -- 0:00:49 767500 -- (-1675.882) (-1676.102) [-1674.701] (-1673.442) * (-1679.209) (-1681.080) (-1685.748) [-1677.816] -- 0:00:49 768000 -- (-1677.692) (-1680.323) (-1677.726) [-1680.188] * [-1669.272] (-1680.876) (-1679.690) (-1682.066) -- 0:00:49 768500 -- [-1676.796] (-1685.547) (-1676.195) (-1674.395) * (-1679.136) (-1676.991) (-1673.677) [-1672.199] -- 0:00:49 769000 -- (-1679.826) (-1675.267) [-1680.874] (-1681.446) * [-1686.961] (-1671.725) (-1681.183) (-1675.193) -- 0:00:49 769500 -- (-1678.349) [-1678.068] (-1672.516) (-1678.803) * (-1675.298) (-1683.348) [-1679.520] (-1684.319) -- 0:00:49 770000 -- (-1684.874) [-1676.294] (-1677.487) (-1672.908) * (-1677.310) (-1673.407) [-1675.440] (-1677.056) -- 0:00:48 Average standard deviation of split frequencies: 0.007034 770500 -- (-1681.999) (-1681.620) [-1677.570] (-1680.485) * (-1678.654) (-1679.222) [-1670.529] (-1692.189) -- 0:00:48 771000 -- (-1683.687) (-1680.714) (-1683.718) [-1679.414] * (-1677.920) (-1679.082) [-1676.601] (-1683.995) -- 0:00:48 771500 -- (-1680.580) [-1674.375] (-1680.094) (-1679.657) * (-1681.262) (-1672.375) [-1675.027] (-1680.528) -- 0:00:48 772000 -- [-1681.862] (-1678.988) (-1675.284) (-1681.125) * [-1683.565] (-1684.692) (-1684.924) (-1685.783) -- 0:00:48 772500 -- (-1683.515) [-1682.510] (-1678.790) (-1680.608) * [-1678.385] (-1679.005) (-1680.882) (-1678.140) -- 0:00:48 773000 -- [-1680.692] (-1675.565) (-1684.232) (-1678.212) * (-1678.075) (-1672.409) [-1676.652] (-1673.056) -- 0:00:48 773500 -- [-1675.255] (-1680.780) (-1683.006) (-1672.916) * [-1681.086] (-1682.735) (-1681.662) (-1672.777) -- 0:00:48 774000 -- [-1673.890] (-1676.797) (-1681.496) (-1674.366) * [-1681.140] (-1677.435) (-1673.790) (-1678.257) -- 0:00:48 774500 -- [-1676.907] (-1692.625) (-1681.136) (-1678.198) * (-1681.645) (-1693.501) [-1684.939] (-1679.267) -- 0:00:48 775000 -- (-1686.254) (-1681.146) (-1680.391) [-1676.986] * (-1685.401) (-1689.244) (-1678.198) [-1673.106] -- 0:00:47 Average standard deviation of split frequencies: 0.007594 775500 -- (-1675.515) (-1677.832) (-1687.486) [-1678.488] * (-1679.225) (-1678.101) (-1690.729) [-1671.767] -- 0:00:47 776000 -- (-1675.018) [-1676.165] (-1680.902) (-1686.562) * (-1678.464) [-1677.297] (-1688.076) (-1676.415) -- 0:00:47 776500 -- (-1671.420) (-1680.966) (-1677.774) [-1670.673] * (-1679.751) (-1680.220) [-1675.078] (-1686.919) -- 0:00:47 777000 -- (-1679.056) (-1676.671) (-1676.152) [-1675.847] * (-1672.002) [-1675.138] (-1682.093) (-1677.640) -- 0:00:47 777500 -- [-1677.771] (-1675.205) (-1681.747) (-1679.008) * (-1677.460) (-1680.131) [-1677.274] (-1675.938) -- 0:00:47 778000 -- [-1673.455] (-1674.450) (-1682.860) (-1680.370) * (-1686.819) [-1673.802] (-1685.835) (-1674.263) -- 0:00:47 778500 -- (-1684.969) (-1681.844) [-1682.505] (-1676.279) * [-1674.713] (-1677.665) (-1677.794) (-1685.920) -- 0:00:47 779000 -- (-1676.283) (-1686.902) (-1683.736) [-1681.315] * (-1678.195) (-1672.372) (-1690.080) [-1681.866] -- 0:00:47 779500 -- (-1678.956) [-1674.449] (-1680.000) (-1680.655) * (-1685.395) (-1673.985) (-1689.386) [-1676.810] -- 0:00:46 780000 -- (-1674.309) [-1675.541] (-1678.765) (-1680.800) * (-1678.832) (-1682.749) (-1679.399) [-1676.927] -- 0:00:46 Average standard deviation of split frequencies: 0.008152 780500 -- (-1674.877) [-1678.488] (-1673.648) (-1679.919) * (-1683.743) [-1678.545] (-1680.555) (-1690.744) -- 0:00:46 781000 -- (-1674.758) (-1672.722) (-1675.142) [-1676.223] * [-1677.831] (-1683.525) (-1680.017) (-1679.026) -- 0:00:46 781500 -- (-1688.066) [-1672.943] (-1678.713) (-1678.779) * (-1671.115) [-1673.354] (-1678.039) (-1679.922) -- 0:00:46 782000 -- (-1675.728) [-1674.328] (-1680.012) (-1685.435) * (-1680.861) (-1685.026) [-1673.149] (-1684.680) -- 0:00:46 782500 -- [-1677.329] (-1690.959) (-1682.648) (-1681.319) * [-1677.114] (-1682.683) (-1679.899) (-1676.084) -- 0:00:46 783000 -- (-1676.917) (-1684.541) (-1686.508) [-1680.632] * (-1680.552) (-1679.348) [-1677.014] (-1673.015) -- 0:00:46 783500 -- (-1673.549) (-1682.270) [-1679.250] (-1680.778) * (-1683.552) (-1674.928) [-1686.835] (-1679.766) -- 0:00:46 784000 -- (-1682.569) (-1673.666) [-1678.401] (-1676.269) * (-1684.390) (-1687.220) [-1678.031] (-1687.218) -- 0:00:46 784500 -- [-1682.940] (-1679.038) (-1683.333) (-1677.326) * (-1677.510) (-1687.181) [-1675.441] (-1676.955) -- 0:00:45 785000 -- (-1676.009) [-1675.391] (-1682.430) (-1690.282) * (-1681.369) [-1675.888] (-1677.356) (-1681.245) -- 0:00:45 Average standard deviation of split frequencies: 0.007497 785500 -- [-1679.014] (-1674.665) (-1683.080) (-1673.509) * (-1676.952) (-1677.685) [-1676.661] (-1682.745) -- 0:00:45 786000 -- (-1677.841) [-1681.642] (-1683.132) (-1680.553) * (-1689.109) (-1683.705) (-1682.842) [-1691.260] -- 0:00:45 786500 -- (-1677.137) (-1681.442) [-1673.911] (-1674.376) * (-1678.805) [-1678.940] (-1680.933) (-1680.196) -- 0:00:45 787000 -- (-1680.439) (-1679.687) [-1677.381] (-1683.878) * (-1681.433) [-1676.039] (-1687.973) (-1680.414) -- 0:00:45 787500 -- (-1685.657) (-1681.768) (-1692.392) [-1677.249] * [-1681.340] (-1678.634) (-1679.658) (-1680.165) -- 0:00:45 788000 -- (-1675.801) (-1676.256) (-1676.349) [-1670.922] * (-1687.258) (-1675.490) (-1693.004) [-1680.434] -- 0:00:45 788500 -- (-1679.384) (-1679.392) (-1673.434) [-1674.675] * (-1678.976) (-1683.816) [-1676.726] (-1672.991) -- 0:00:45 789000 -- (-1677.310) (-1678.438) [-1676.945] (-1682.329) * (-1695.266) (-1684.261) (-1673.622) [-1672.656] -- 0:00:44 789500 -- [-1681.566] (-1685.988) (-1677.595) (-1676.599) * (-1680.732) (-1682.545) (-1680.524) [-1681.535] -- 0:00:44 790000 -- [-1673.210] (-1674.146) (-1680.957) (-1677.796) * (-1686.540) (-1676.020) [-1678.936] (-1676.899) -- 0:00:44 Average standard deviation of split frequencies: 0.007850 790500 -- (-1678.997) (-1678.635) (-1679.530) [-1675.376] * [-1680.270] (-1673.007) (-1686.761) (-1685.509) -- 0:00:44 791000 -- (-1674.048) [-1673.034] (-1675.683) (-1670.435) * (-1681.054) [-1678.776] (-1677.885) (-1676.143) -- 0:00:44 791500 -- (-1678.223) (-1678.632) [-1676.624] (-1677.184) * (-1672.401) [-1673.738] (-1676.297) (-1684.277) -- 0:00:44 792000 -- (-1683.937) (-1678.811) (-1680.365) [-1673.626] * (-1675.293) (-1673.058) (-1681.980) [-1676.517] -- 0:00:44 792500 -- (-1684.992) [-1676.437] (-1679.854) (-1679.638) * (-1676.753) (-1674.475) (-1691.103) [-1674.957] -- 0:00:44 793000 -- (-1687.646) [-1674.470] (-1675.702) (-1677.581) * (-1679.844) (-1681.976) (-1685.735) [-1674.013] -- 0:00:44 793500 -- (-1684.871) (-1676.879) (-1676.234) [-1676.365] * (-1678.500) (-1685.875) (-1682.726) [-1676.957] -- 0:00:43 794000 -- [-1683.969] (-1674.869) (-1679.479) (-1674.034) * (-1681.268) [-1676.231] (-1680.864) (-1681.580) -- 0:00:43 794500 -- (-1679.443) (-1676.848) (-1676.209) [-1674.621] * (-1680.239) [-1677.646] (-1695.270) (-1680.684) -- 0:00:43 795000 -- (-1675.498) [-1678.363] (-1688.846) (-1677.888) * (-1677.404) [-1678.299] (-1682.118) (-1674.192) -- 0:00:43 Average standard deviation of split frequencies: 0.007600 795500 -- (-1675.828) (-1678.399) (-1678.145) [-1671.852] * (-1680.583) [-1675.013] (-1682.216) (-1676.264) -- 0:00:43 796000 -- (-1673.256) (-1674.400) [-1677.549] (-1679.322) * (-1684.148) (-1672.791) (-1682.775) [-1675.363] -- 0:00:43 796500 -- (-1676.331) (-1672.236) [-1680.967] (-1678.180) * (-1679.317) (-1682.370) (-1679.627) [-1672.293] -- 0:00:43 797000 -- (-1674.807) (-1682.170) [-1677.773] (-1679.298) * (-1676.820) (-1679.980) [-1680.433] (-1672.790) -- 0:00:43 797500 -- [-1675.676] (-1677.658) (-1675.910) (-1684.653) * [-1674.556] (-1687.349) (-1688.828) (-1681.636) -- 0:00:43 798000 -- (-1682.995) [-1676.763] (-1682.483) (-1680.712) * (-1674.780) (-1682.006) [-1680.912] (-1680.740) -- 0:00:43 798500 -- (-1680.751) [-1680.063] (-1673.049) (-1675.112) * (-1675.757) (-1675.438) (-1698.885) [-1675.270] -- 0:00:42 799000 -- (-1676.111) (-1682.338) [-1676.400] (-1683.991) * (-1687.623) [-1675.040] (-1689.969) (-1682.048) -- 0:00:42 799500 -- (-1675.171) (-1683.621) (-1685.671) [-1676.909] * (-1674.618) [-1674.887] (-1682.905) (-1673.704) -- 0:00:42 800000 -- (-1672.965) (-1676.344) (-1683.054) [-1680.314] * (-1676.331) (-1678.021) (-1680.459) [-1689.966] -- 0:00:42 Average standard deviation of split frequencies: 0.007556 800500 -- (-1672.019) (-1686.305) [-1676.652] (-1681.965) * (-1682.552) (-1673.511) (-1685.163) [-1673.104] -- 0:00:42 801000 -- [-1692.182] (-1681.458) (-1675.616) (-1684.441) * (-1679.714) (-1682.176) (-1682.291) [-1670.662] -- 0:00:42 801500 -- (-1678.784) [-1685.561] (-1677.017) (-1674.568) * (-1680.742) (-1683.146) [-1672.910] (-1677.881) -- 0:00:42 802000 -- (-1687.815) (-1684.063) (-1673.991) [-1674.384] * (-1673.975) (-1683.057) (-1676.888) [-1675.770] -- 0:00:42 802500 -- [-1684.514] (-1673.393) (-1678.792) (-1675.624) * (-1678.877) (-1686.454) (-1673.842) [-1675.764] -- 0:00:42 803000 -- (-1689.194) (-1684.517) (-1680.014) [-1675.669] * (-1674.985) (-1673.477) (-1671.945) [-1675.974] -- 0:00:41 803500 -- (-1681.972) (-1684.026) [-1678.353] (-1680.486) * [-1675.730] (-1677.387) (-1683.385) (-1676.430) -- 0:00:41 804000 -- [-1675.360] (-1686.452) (-1677.134) (-1670.316) * (-1676.215) [-1679.860] (-1684.992) (-1673.145) -- 0:00:41 804500 -- (-1674.973) (-1675.559) (-1683.981) [-1675.389] * (-1679.601) (-1681.272) [-1680.579] (-1680.048) -- 0:00:41 805000 -- (-1682.765) [-1676.958] (-1676.734) (-1677.254) * (-1687.445) [-1672.731] (-1677.904) (-1678.578) -- 0:00:41 Average standard deviation of split frequencies: 0.008091 805500 -- (-1679.399) (-1680.329) [-1676.409] (-1685.851) * [-1675.170] (-1676.745) (-1677.233) (-1674.419) -- 0:00:41 806000 -- (-1673.823) (-1689.570) (-1680.940) [-1677.398] * (-1675.122) (-1677.495) (-1691.479) [-1673.956] -- 0:00:41 806500 -- [-1673.934] (-1681.063) (-1674.897) (-1674.773) * (-1675.107) (-1685.276) [-1675.540] (-1673.782) -- 0:00:41 807000 -- (-1675.564) (-1688.821) [-1683.066] (-1685.648) * (-1673.152) (-1678.327) (-1680.436) [-1676.939] -- 0:00:41 807500 -- (-1686.141) (-1684.304) [-1676.931] (-1682.007) * (-1671.688) (-1680.434) [-1684.957] (-1679.851) -- 0:00:41 808000 -- [-1675.036] (-1672.367) (-1684.799) (-1690.201) * (-1677.695) (-1687.530) (-1675.874) [-1675.248] -- 0:00:40 808500 -- (-1675.581) [-1675.267] (-1675.603) (-1679.178) * (-1673.239) (-1674.018) [-1679.048] (-1678.986) -- 0:00:40 809000 -- [-1672.505] (-1675.503) (-1681.257) (-1674.982) * (-1680.669) (-1675.146) [-1675.502] (-1678.006) -- 0:00:40 809500 -- (-1676.585) (-1683.386) (-1681.709) [-1678.279] * (-1685.070) [-1678.126] (-1683.657) (-1676.307) -- 0:00:40 810000 -- (-1689.486) [-1675.265] (-1688.246) (-1671.637) * (-1678.268) (-1679.565) [-1680.955] (-1680.177) -- 0:00:40 Average standard deviation of split frequencies: 0.007463 810500 -- (-1680.131) (-1683.607) [-1680.495] (-1686.588) * (-1677.207) (-1670.498) (-1683.800) [-1678.615] -- 0:00:40 811000 -- (-1685.360) (-1674.393) [-1679.822] (-1686.237) * (-1686.151) (-1676.777) [-1678.696] (-1676.401) -- 0:00:40 811500 -- [-1672.951] (-1677.946) (-1671.905) (-1688.733) * (-1685.832) (-1679.757) [-1671.440] (-1684.564) -- 0:00:40 812000 -- (-1679.613) (-1689.412) [-1674.579] (-1684.750) * (-1688.490) [-1682.432] (-1675.120) (-1678.581) -- 0:00:40 812500 -- (-1678.397) (-1678.698) [-1675.210] (-1682.799) * (-1690.538) [-1681.984] (-1676.815) (-1678.501) -- 0:00:39 813000 -- (-1684.232) [-1669.766] (-1685.560) (-1682.665) * (-1683.926) (-1683.023) [-1676.188] (-1686.486) -- 0:00:39 813500 -- (-1689.259) [-1673.281] (-1683.070) (-1673.752) * (-1675.620) [-1685.050] (-1681.716) (-1680.857) -- 0:00:39 814000 -- [-1679.292] (-1675.774) (-1682.804) (-1678.172) * (-1681.668) (-1677.208) (-1681.002) [-1675.526] -- 0:00:39 814500 -- [-1673.904] (-1675.866) (-1679.800) (-1683.833) * (-1682.696) [-1678.837] (-1679.776) (-1676.771) -- 0:00:39 815000 -- (-1687.446) (-1682.305) (-1680.956) [-1673.742] * (-1677.230) [-1671.299] (-1685.365) (-1686.423) -- 0:00:39 Average standard deviation of split frequencies: 0.008377 815500 -- (-1681.392) (-1671.191) [-1679.885] (-1681.372) * (-1676.749) [-1677.295] (-1685.027) (-1675.738) -- 0:00:39 816000 -- (-1686.018) (-1681.278) (-1678.650) [-1676.246] * (-1675.776) [-1674.109] (-1679.116) (-1679.018) -- 0:00:39 816500 -- (-1678.812) [-1684.497] (-1673.899) (-1674.639) * [-1674.183] (-1677.318) (-1673.627) (-1674.674) -- 0:00:39 817000 -- (-1674.118) [-1673.008] (-1679.564) (-1671.124) * (-1680.472) [-1674.942] (-1677.461) (-1687.844) -- 0:00:38 817500 -- (-1675.875) [-1677.391] (-1674.125) (-1682.434) * [-1673.668] (-1676.586) (-1677.068) (-1686.265) -- 0:00:38 818000 -- (-1685.233) (-1679.795) (-1674.828) [-1677.375] * (-1674.327) (-1674.109) [-1682.678] (-1685.002) -- 0:00:38 818500 -- (-1683.451) (-1675.330) (-1673.921) [-1681.199] * (-1674.207) (-1676.864) (-1677.971) [-1680.725] -- 0:00:38 819000 -- [-1684.603] (-1683.905) (-1674.314) (-1679.458) * (-1676.737) [-1677.051] (-1675.878) (-1677.243) -- 0:00:38 819500 -- [-1677.341] (-1676.629) (-1675.041) (-1673.744) * (-1676.228) (-1679.529) (-1674.949) [-1681.373] -- 0:00:38 820000 -- (-1680.568) (-1687.370) (-1682.925) [-1671.610] * (-1675.290) [-1673.685] (-1675.709) (-1683.308) -- 0:00:38 Average standard deviation of split frequencies: 0.008521 820500 -- (-1678.683) (-1675.824) (-1682.398) [-1672.751] * (-1680.762) (-1677.072) (-1679.382) [-1675.233] -- 0:00:38 821000 -- (-1678.340) [-1673.914] (-1679.399) (-1678.269) * (-1680.068) (-1680.099) [-1679.114] (-1674.543) -- 0:00:38 821500 -- (-1686.428) (-1676.691) [-1678.019] (-1683.760) * (-1679.538) [-1672.713] (-1682.906) (-1678.093) -- 0:00:38 822000 -- (-1677.477) [-1681.287] (-1684.100) (-1676.419) * [-1674.903] (-1679.875) (-1682.828) (-1668.532) -- 0:00:37 822500 -- (-1673.979) [-1677.106] (-1675.350) (-1683.141) * (-1678.450) [-1675.227] (-1680.255) (-1677.782) -- 0:00:37 823000 -- (-1680.269) (-1678.814) (-1676.826) [-1673.335] * (-1681.668) [-1674.093] (-1677.087) (-1673.857) -- 0:00:37 823500 -- [-1674.421] (-1677.995) (-1676.656) (-1676.009) * (-1676.215) [-1680.778] (-1676.335) (-1682.492) -- 0:00:37 824000 -- (-1674.263) (-1678.249) (-1673.432) [-1680.101] * (-1674.816) (-1677.733) (-1677.284) [-1673.473] -- 0:00:37 824500 -- (-1677.245) (-1678.432) [-1679.850] (-1677.321) * (-1680.363) [-1678.317] (-1680.797) (-1686.183) -- 0:00:37 825000 -- (-1686.861) (-1683.422) [-1679.208] (-1680.906) * (-1677.796) (-1677.484) (-1674.940) [-1677.312] -- 0:00:37 Average standard deviation of split frequencies: 0.008561 825500 -- [-1680.412] (-1683.803) (-1680.559) (-1683.873) * (-1686.130) (-1674.945) [-1676.290] (-1683.677) -- 0:00:37 826000 -- (-1681.404) (-1675.844) [-1674.312] (-1672.538) * (-1687.633) (-1678.810) [-1675.820] (-1673.803) -- 0:00:37 826500 -- (-1683.442) (-1702.488) (-1680.989) [-1682.811] * (-1673.408) (-1680.211) (-1671.236) [-1678.350] -- 0:00:36 827000 -- (-1679.095) (-1682.528) (-1681.520) [-1671.760] * (-1678.180) (-1690.437) [-1677.203] (-1678.700) -- 0:00:36 827500 -- (-1675.168) [-1677.233] (-1686.626) (-1684.582) * (-1677.388) [-1680.880] (-1683.032) (-1679.524) -- 0:00:36 828000 -- (-1679.963) [-1677.651] (-1679.466) (-1681.256) * (-1676.576) (-1682.499) [-1676.481] (-1672.953) -- 0:00:36 828500 -- (-1680.516) (-1673.986) (-1677.809) [-1677.998] * (-1683.974) (-1682.911) (-1674.470) [-1676.540] -- 0:00:36 829000 -- (-1679.156) (-1675.882) [-1680.981] (-1680.272) * [-1672.577] (-1684.992) (-1693.227) (-1675.309) -- 0:00:36 829500 -- (-1681.783) [-1676.211] (-1677.283) (-1686.010) * (-1677.704) (-1678.329) (-1676.915) [-1672.627] -- 0:00:36 830000 -- (-1673.994) (-1676.535) [-1677.037] (-1677.367) * (-1681.906) (-1674.107) [-1677.404] (-1682.193) -- 0:00:36 Average standard deviation of split frequencies: 0.008891 830500 -- [-1685.243] (-1679.038) (-1676.979) (-1675.722) * (-1675.791) [-1674.310] (-1682.516) (-1673.072) -- 0:00:36 831000 -- (-1679.427) [-1678.374] (-1681.414) (-1677.164) * (-1676.165) (-1680.732) [-1673.436] (-1676.385) -- 0:00:35 831500 -- (-1677.273) [-1678.312] (-1680.911) (-1679.653) * (-1686.702) (-1682.417) (-1679.856) [-1681.816] -- 0:00:35 832000 -- (-1681.651) (-1684.577) [-1672.659] (-1676.924) * (-1676.697) (-1679.095) [-1679.929] (-1675.802) -- 0:00:35 832500 -- [-1680.480] (-1679.204) (-1677.907) (-1674.519) * (-1682.852) [-1675.066] (-1685.313) (-1675.580) -- 0:00:35 833000 -- [-1673.022] (-1675.668) (-1680.130) (-1674.126) * [-1679.642] (-1679.514) (-1681.787) (-1678.267) -- 0:00:35 833500 -- [-1683.751] (-1682.287) (-1676.953) (-1676.623) * (-1678.887) (-1673.460) [-1676.625] (-1683.012) -- 0:00:35 834000 -- (-1678.866) (-1686.400) [-1679.926] (-1675.898) * (-1676.002) (-1677.952) (-1675.067) [-1672.963] -- 0:00:35 834500 -- (-1679.044) [-1677.521] (-1687.707) (-1683.937) * (-1679.273) (-1682.248) (-1669.747) [-1675.347] -- 0:00:35 835000 -- (-1686.806) (-1681.143) [-1684.310] (-1679.346) * (-1679.730) (-1677.122) [-1673.744] (-1688.169) -- 0:00:35 Average standard deviation of split frequencies: 0.008834 835500 -- (-1685.719) (-1678.403) (-1680.151) [-1672.872] * [-1679.535] (-1676.684) (-1685.967) (-1682.420) -- 0:00:35 836000 -- (-1678.684) [-1679.058] (-1673.479) (-1682.969) * (-1678.232) (-1678.643) (-1684.578) [-1680.078] -- 0:00:34 836500 -- (-1672.963) (-1680.453) [-1677.128] (-1685.028) * (-1674.424) (-1682.921) [-1681.513] (-1681.968) -- 0:00:34 837000 -- (-1678.253) (-1679.053) [-1673.999] (-1679.545) * [-1675.469] (-1674.670) (-1680.881) (-1679.841) -- 0:00:34 837500 -- [-1674.650] (-1677.292) (-1680.264) (-1679.755) * (-1674.266) (-1677.184) (-1691.191) [-1676.712] -- 0:00:34 838000 -- (-1676.745) (-1682.079) (-1676.000) [-1674.144] * (-1680.672) [-1674.797] (-1681.756) (-1679.464) -- 0:00:34 838500 -- (-1681.187) (-1677.498) [-1678.652] (-1680.872) * [-1679.853] (-1679.832) (-1683.157) (-1685.163) -- 0:00:34 839000 -- (-1677.940) (-1675.113) [-1672.998] (-1678.114) * (-1675.820) (-1673.586) (-1687.172) [-1678.915] -- 0:00:34 839500 -- (-1676.916) [-1675.440] (-1683.633) (-1672.738) * (-1681.025) [-1675.732] (-1690.223) (-1686.139) -- 0:00:34 840000 -- (-1679.012) (-1682.866) [-1676.282] (-1677.537) * (-1679.372) [-1682.306] (-1678.665) (-1690.493) -- 0:00:34 Average standard deviation of split frequencies: 0.008785 840500 -- [-1674.057] (-1683.567) (-1684.850) (-1674.119) * [-1683.293] (-1678.997) (-1679.437) (-1677.482) -- 0:00:33 841000 -- (-1686.204) (-1674.257) [-1683.660] (-1674.222) * [-1683.883] (-1680.049) (-1682.955) (-1681.570) -- 0:00:33 841500 -- (-1687.074) (-1685.312) (-1683.961) [-1678.011] * (-1682.948) (-1692.375) (-1677.586) [-1682.924] -- 0:00:33 842000 -- (-1680.579) (-1674.425) (-1678.359) [-1673.695] * (-1674.853) (-1678.707) [-1689.476] (-1679.426) -- 0:00:33 842500 -- (-1678.535) (-1679.675) [-1677.573] (-1679.374) * (-1678.751) [-1677.114] (-1679.416) (-1680.662) -- 0:00:33 843000 -- (-1678.252) (-1674.796) (-1672.596) [-1676.068] * [-1676.886] (-1679.489) (-1674.422) (-1683.906) -- 0:00:33 843500 -- (-1680.480) (-1674.990) (-1691.964) [-1677.299] * (-1684.489) (-1686.342) [-1683.210] (-1679.079) -- 0:00:33 844000 -- (-1677.045) (-1676.961) (-1682.385) [-1675.656] * (-1683.749) (-1672.070) [-1679.159] (-1681.475) -- 0:00:33 844500 -- (-1676.979) (-1682.947) (-1678.185) [-1672.206] * [-1677.372] (-1679.669) (-1670.062) (-1674.797) -- 0:00:33 845000 -- [-1679.232] (-1683.226) (-1681.990) (-1677.934) * (-1680.330) (-1685.689) [-1677.410] (-1676.072) -- 0:00:33 Average standard deviation of split frequencies: 0.008915 845500 -- (-1671.676) (-1679.813) (-1675.754) [-1672.466] * (-1687.674) (-1678.609) [-1677.138] (-1675.947) -- 0:00:32 846000 -- (-1674.212) (-1676.515) (-1674.519) [-1674.749] * (-1684.402) (-1675.978) [-1682.376] (-1676.989) -- 0:00:32 846500 -- (-1690.694) (-1673.987) (-1679.544) [-1675.208] * (-1682.434) [-1677.281] (-1681.788) (-1693.738) -- 0:00:32 847000 -- (-1683.278) [-1678.094] (-1678.093) (-1677.794) * [-1679.230] (-1678.280) (-1676.131) (-1690.288) -- 0:00:32 847500 -- (-1679.734) [-1674.349] (-1683.548) (-1680.730) * [-1674.801] (-1675.854) (-1673.720) (-1680.196) -- 0:00:32 848000 -- (-1683.959) (-1679.342) (-1685.985) [-1683.948] * (-1681.477) (-1684.492) [-1675.676] (-1673.635) -- 0:00:32 848500 -- [-1680.614] (-1679.215) (-1682.031) (-1672.970) * (-1672.952) (-1683.220) (-1677.624) [-1677.486] -- 0:00:32 849000 -- [-1679.667] (-1678.969) (-1672.965) (-1672.566) * (-1683.359) (-1684.472) [-1676.949] (-1679.353) -- 0:00:32 849500 -- (-1685.235) (-1681.364) (-1678.913) [-1677.243] * (-1674.612) (-1682.222) (-1671.474) [-1673.710] -- 0:00:32 850000 -- (-1677.968) (-1678.659) (-1682.886) [-1673.530] * (-1678.639) [-1681.004] (-1678.604) (-1675.134) -- 0:00:31 Average standard deviation of split frequencies: 0.008497 850500 -- (-1675.514) [-1678.090] (-1679.531) (-1684.383) * (-1684.578) (-1681.370) (-1685.792) [-1681.193] -- 0:00:31 851000 -- [-1676.417] (-1676.349) (-1676.266) (-1682.825) * (-1677.324) [-1681.179] (-1679.470) (-1680.558) -- 0:00:31 851500 -- [-1678.881] (-1671.538) (-1678.197) (-1682.160) * (-1672.781) [-1674.533] (-1685.103) (-1674.090) -- 0:00:31 852000 -- (-1675.945) (-1676.282) (-1679.016) [-1677.838] * [-1677.530] (-1675.815) (-1676.953) (-1675.229) -- 0:00:31 852500 -- (-1679.537) (-1675.944) [-1678.818] (-1679.021) * (-1679.906) (-1672.526) (-1677.528) [-1676.846] -- 0:00:31 853000 -- (-1686.107) [-1672.180] (-1674.085) (-1679.378) * (-1681.688) [-1678.682] (-1673.048) (-1683.436) -- 0:00:31 853500 -- (-1681.690) (-1677.955) (-1681.718) [-1675.857] * (-1675.140) [-1679.151] (-1682.016) (-1681.293) -- 0:00:31 854000 -- (-1686.808) (-1678.234) [-1680.522] (-1672.116) * [-1673.802] (-1680.773) (-1675.684) (-1680.458) -- 0:00:31 854500 -- [-1672.731] (-1680.330) (-1676.145) (-1679.154) * (-1681.553) (-1683.636) [-1674.892] (-1683.961) -- 0:00:30 855000 -- (-1673.242) (-1678.566) [-1672.580] (-1679.511) * (-1689.029) (-1677.328) [-1680.297] (-1677.848) -- 0:00:30 Average standard deviation of split frequencies: 0.008261 855500 -- (-1673.172) (-1678.963) (-1676.553) [-1676.646] * [-1673.941] (-1678.389) (-1678.965) (-1679.826) -- 0:00:30 856000 -- (-1672.340) [-1679.064] (-1677.967) (-1685.075) * [-1675.539] (-1675.080) (-1672.142) (-1695.625) -- 0:00:30 856500 -- [-1679.639] (-1695.571) (-1676.863) (-1674.631) * (-1679.961) (-1683.123) [-1680.319] (-1688.798) -- 0:00:30 857000 -- (-1670.767) [-1683.443] (-1679.478) (-1681.027) * (-1678.947) (-1689.504) (-1680.388) [-1677.381] -- 0:00:30 857500 -- (-1679.456) (-1685.128) [-1674.406] (-1685.850) * (-1690.709) (-1688.180) (-1670.700) [-1679.149] -- 0:00:30 858000 -- (-1678.821) (-1678.707) [-1677.285] (-1677.766) * [-1680.087] (-1677.541) (-1686.874) (-1678.240) -- 0:00:30 858500 -- (-1685.364) (-1682.320) (-1683.378) [-1677.291] * (-1687.362) (-1685.108) [-1682.610] (-1682.066) -- 0:00:30 859000 -- (-1672.420) [-1679.286] (-1683.356) (-1678.461) * [-1678.023] (-1685.916) (-1684.684) (-1678.561) -- 0:00:30 859500 -- (-1684.232) (-1678.426) [-1673.057] (-1673.797) * (-1680.197) (-1683.077) [-1682.316] (-1676.355) -- 0:00:29 860000 -- (-1673.891) [-1674.121] (-1676.674) (-1682.489) * (-1682.715) (-1675.661) [-1686.766] (-1678.658) -- 0:00:29 Average standard deviation of split frequencies: 0.007668 860500 -- (-1679.791) (-1674.290) (-1684.925) [-1680.082] * (-1681.260) (-1682.251) (-1675.278) [-1673.070] -- 0:00:29 861000 -- [-1676.505] (-1675.601) (-1681.444) (-1682.105) * (-1693.326) [-1675.411] (-1682.712) (-1675.616) -- 0:00:29 861500 -- [-1672.171] (-1675.287) (-1680.016) (-1685.656) * (-1688.788) [-1673.910] (-1681.944) (-1676.382) -- 0:00:29 862000 -- (-1678.527) (-1673.331) [-1678.115] (-1705.462) * (-1679.110) (-1680.229) (-1687.320) [-1671.647] -- 0:00:29 862500 -- (-1676.825) (-1678.875) (-1677.755) [-1683.584] * (-1671.960) (-1677.459) (-1678.660) [-1672.746] -- 0:00:29 863000 -- [-1676.013] (-1682.062) (-1671.717) (-1685.240) * (-1676.411) (-1678.136) [-1676.364] (-1677.281) -- 0:00:29 863500 -- (-1679.352) [-1677.033] (-1683.133) (-1682.678) * (-1681.193) [-1674.941] (-1684.456) (-1673.292) -- 0:00:29 864000 -- (-1676.894) [-1679.671] (-1678.586) (-1682.323) * [-1676.339] (-1679.736) (-1676.073) (-1680.673) -- 0:00:28 864500 -- [-1676.165] (-1678.120) (-1681.943) (-1676.739) * (-1683.416) (-1680.758) (-1678.518) [-1677.024] -- 0:00:28 865000 -- [-1675.023] (-1673.796) (-1674.103) (-1679.870) * (-1677.762) (-1678.545) [-1679.117] (-1676.690) -- 0:00:28 Average standard deviation of split frequencies: 0.006895 865500 -- (-1676.482) (-1681.082) [-1673.736] (-1676.569) * (-1678.157) (-1677.108) [-1674.937] (-1680.319) -- 0:00:28 866000 -- (-1688.924) (-1681.862) [-1673.006] (-1679.555) * (-1675.914) [-1676.630] (-1680.947) (-1673.295) -- 0:00:28 866500 -- (-1682.141) [-1678.285] (-1673.618) (-1684.969) * (-1679.095) [-1674.412] (-1676.642) (-1677.975) -- 0:00:28 867000 -- [-1675.087] (-1680.228) (-1692.003) (-1684.159) * (-1675.083) [-1672.751] (-1679.393) (-1677.267) -- 0:00:28 867500 -- [-1672.395] (-1683.192) (-1676.524) (-1675.726) * (-1689.680) (-1673.080) (-1685.032) [-1677.722] -- 0:00:28 868000 -- (-1677.115) (-1675.810) (-1684.436) [-1677.367] * (-1677.291) [-1675.339] (-1681.623) (-1680.862) -- 0:00:28 868500 -- (-1678.866) (-1688.840) (-1686.402) [-1681.260] * (-1680.808) [-1679.479] (-1681.411) (-1682.905) -- 0:00:28 869000 -- [-1672.706] (-1680.120) (-1682.290) (-1678.921) * (-1681.805) [-1675.816] (-1679.144) (-1682.168) -- 0:00:27 869500 -- (-1681.437) [-1677.627] (-1678.175) (-1672.781) * (-1680.639) (-1680.789) [-1683.183] (-1686.134) -- 0:00:27 870000 -- (-1677.941) [-1672.366] (-1683.759) (-1683.768) * (-1673.339) (-1685.882) [-1681.394] (-1680.619) -- 0:00:27 Average standard deviation of split frequencies: 0.007039 870500 -- [-1679.267] (-1674.328) (-1673.160) (-1679.945) * (-1691.451) [-1677.064] (-1677.181) (-1676.987) -- 0:00:27 871000 -- (-1684.250) (-1677.330) (-1671.270) [-1674.307] * (-1679.243) [-1673.281] (-1675.837) (-1678.835) -- 0:00:27 871500 -- (-1683.092) [-1673.805] (-1677.872) (-1674.328) * [-1681.002] (-1677.492) (-1675.198) (-1682.663) -- 0:00:27 872000 -- (-1681.464) (-1681.529) (-1677.693) [-1676.778] * (-1674.395) (-1683.036) (-1677.216) [-1674.372] -- 0:00:27 872500 -- [-1678.613] (-1673.395) (-1676.565) (-1679.782) * (-1689.860) [-1676.231] (-1682.411) (-1686.196) -- 0:00:27 873000 -- (-1679.831) [-1673.011] (-1684.982) (-1674.910) * [-1676.214] (-1676.421) (-1677.081) (-1677.780) -- 0:00:27 873500 -- (-1684.202) [-1677.345] (-1679.766) (-1677.753) * [-1678.357] (-1687.406) (-1677.063) (-1679.693) -- 0:00:26 874000 -- (-1681.790) (-1675.574) [-1675.512] (-1685.957) * (-1678.889) (-1676.339) (-1673.530) [-1678.679] -- 0:00:26 874500 -- (-1677.205) [-1671.072] (-1681.823) (-1681.160) * [-1676.373] (-1673.714) (-1675.649) (-1684.030) -- 0:00:26 875000 -- (-1672.788) [-1676.223] (-1687.445) (-1674.640) * (-1681.745) (-1674.175) (-1681.688) [-1678.891] -- 0:00:26 Average standard deviation of split frequencies: 0.007354 875500 -- (-1684.195) (-1675.507) (-1675.318) [-1685.761] * (-1677.522) [-1673.722] (-1686.631) (-1677.108) -- 0:00:26 876000 -- [-1676.455] (-1675.696) (-1683.496) (-1684.153) * [-1673.909] (-1678.218) (-1682.014) (-1680.241) -- 0:00:26 876500 -- [-1673.744] (-1673.080) (-1678.267) (-1684.149) * (-1677.191) (-1678.454) [-1676.167] (-1676.569) -- 0:00:26 877000 -- [-1670.861] (-1674.972) (-1681.315) (-1679.824) * [-1671.782] (-1678.692) (-1676.522) (-1681.286) -- 0:00:26 877500 -- (-1691.165) (-1678.914) (-1686.116) [-1678.378] * (-1673.658) [-1672.763] (-1680.690) (-1683.046) -- 0:00:26 878000 -- (-1684.593) (-1687.373) (-1676.985) [-1673.979] * (-1672.320) [-1676.303] (-1678.142) (-1679.980) -- 0:00:25 878500 -- (-1684.456) (-1676.291) [-1672.076] (-1676.304) * (-1676.184) (-1676.640) (-1673.309) [-1680.459] -- 0:00:25 879000 -- (-1678.016) (-1680.423) (-1677.692) [-1675.612] * (-1685.875) (-1682.279) [-1679.445] (-1679.412) -- 0:00:25 879500 -- (-1675.564) (-1680.242) (-1676.838) [-1675.061] * [-1674.989] (-1678.765) (-1680.779) (-1676.101) -- 0:00:25 880000 -- (-1678.324) (-1679.810) (-1687.984) [-1676.473] * (-1682.422) (-1674.321) (-1681.132) [-1673.109] -- 0:00:25 Average standard deviation of split frequencies: 0.007762 880500 -- (-1679.713) (-1673.799) (-1677.052) [-1676.064] * (-1678.059) (-1677.129) [-1684.025] (-1677.155) -- 0:00:25 881000 -- (-1689.105) (-1674.001) (-1672.560) [-1675.069] * (-1685.647) (-1677.816) (-1683.289) [-1674.284] -- 0:00:25 881500 -- (-1679.244) (-1676.400) [-1679.506] (-1676.815) * (-1680.528) (-1676.146) (-1683.353) [-1677.380] -- 0:00:25 882000 -- (-1672.610) [-1674.482] (-1687.075) (-1680.052) * (-1675.079) (-1683.907) [-1685.962] (-1678.859) -- 0:00:25 882500 -- (-1674.513) [-1680.546] (-1681.118) (-1679.059) * (-1675.342) (-1673.707) (-1679.603) [-1679.612] -- 0:00:25 883000 -- (-1689.467) [-1675.480] (-1677.234) (-1675.061) * [-1680.084] (-1675.745) (-1687.668) (-1674.405) -- 0:00:24 883500 -- (-1675.362) (-1678.742) [-1674.571] (-1677.690) * (-1678.514) [-1672.802] (-1690.072) (-1677.274) -- 0:00:24 884000 -- [-1672.843] (-1682.500) (-1682.970) (-1677.730) * (-1680.366) [-1674.061] (-1682.967) (-1677.479) -- 0:00:24 884500 -- (-1672.022) (-1677.920) [-1676.147] (-1693.359) * (-1687.043) (-1676.288) (-1675.536) [-1679.999] -- 0:00:24 885000 -- (-1684.655) (-1674.809) (-1676.543) [-1684.483] * (-1678.603) (-1674.719) (-1686.022) [-1681.437] -- 0:00:24 Average standard deviation of split frequencies: 0.008070 885500 -- (-1673.393) (-1677.444) [-1673.536] (-1674.176) * (-1678.051) (-1690.548) (-1676.735) [-1682.744] -- 0:00:24 886000 -- (-1676.223) [-1678.804] (-1677.517) (-1681.875) * (-1683.272) [-1674.998] (-1676.485) (-1680.176) -- 0:00:24 886500 -- (-1679.014) [-1677.058] (-1688.773) (-1675.428) * (-1684.850) [-1674.382] (-1680.561) (-1685.545) -- 0:00:24 887000 -- (-1678.245) [-1677.662] (-1671.594) (-1674.032) * (-1684.581) [-1672.886] (-1678.436) (-1680.796) -- 0:00:24 887500 -- [-1672.881] (-1676.769) (-1685.288) (-1675.263) * (-1691.578) (-1670.068) (-1678.330) [-1675.442] -- 0:00:23 888000 -- (-1680.109) (-1683.070) [-1678.687] (-1678.000) * (-1677.686) [-1679.639] (-1674.511) (-1677.807) -- 0:00:23 888500 -- (-1677.241) (-1679.848) [-1674.089] (-1676.719) * (-1674.905) [-1681.792] (-1676.489) (-1686.805) -- 0:00:23 889000 -- (-1684.305) (-1678.650) [-1677.169] (-1692.026) * (-1674.599) (-1677.104) (-1677.448) [-1674.544] -- 0:00:23 889500 -- [-1680.933] (-1679.947) (-1678.600) (-1681.438) * [-1677.577] (-1680.655) (-1680.633) (-1673.645) -- 0:00:23 890000 -- (-1675.433) [-1676.400] (-1675.141) (-1680.971) * [-1684.318] (-1680.821) (-1677.123) (-1676.786) -- 0:00:23 Average standard deviation of split frequencies: 0.008204 890500 -- (-1674.820) (-1685.531) [-1676.876] (-1689.111) * (-1680.226) (-1685.168) (-1685.999) [-1683.300] -- 0:00:23 891000 -- (-1677.010) (-1688.340) (-1677.817) [-1676.947] * (-1677.324) (-1678.899) [-1675.955] (-1678.307) -- 0:00:23 891500 -- (-1678.227) (-1687.338) [-1682.546] (-1677.241) * (-1674.809) (-1680.573) (-1681.106) [-1673.723] -- 0:00:23 892000 -- [-1674.543] (-1692.707) (-1690.519) (-1675.465) * (-1679.803) (-1687.029) (-1674.951) [-1677.624] -- 0:00:23 892500 -- [-1673.090] (-1691.918) (-1686.699) (-1676.274) * (-1677.707) (-1679.854) [-1679.448] (-1685.694) -- 0:00:22 893000 -- (-1678.909) (-1694.896) (-1676.248) [-1680.688] * (-1680.451) [-1683.398] (-1674.785) (-1686.152) -- 0:00:22 893500 -- [-1675.632] (-1674.301) (-1677.335) (-1684.519) * [-1673.431] (-1679.136) (-1677.443) (-1675.716) -- 0:00:22 894000 -- (-1677.563) [-1676.147] (-1672.540) (-1678.798) * (-1678.214) [-1676.146] (-1690.901) (-1677.300) -- 0:00:22 894500 -- (-1678.871) (-1673.902) (-1671.786) [-1677.346] * [-1678.196] (-1672.336) (-1679.720) (-1675.036) -- 0:00:22 895000 -- (-1679.799) (-1674.028) (-1680.079) [-1677.783] * [-1672.168] (-1676.493) (-1684.964) (-1677.093) -- 0:00:22 Average standard deviation of split frequencies: 0.008330 895500 -- [-1678.518] (-1678.619) (-1676.143) (-1678.271) * (-1681.634) (-1678.640) (-1680.294) [-1680.019] -- 0:00:22 896000 -- (-1676.579) (-1680.229) [-1679.252] (-1674.462) * (-1677.697) [-1672.382] (-1679.459) (-1685.707) -- 0:00:22 896500 -- (-1682.194) [-1674.485] (-1685.500) (-1673.776) * (-1683.470) (-1676.662) [-1680.202] (-1677.699) -- 0:00:22 897000 -- (-1679.843) (-1679.520) [-1677.022] (-1677.884) * (-1680.864) [-1677.655] (-1680.961) (-1681.832) -- 0:00:21 897500 -- (-1677.811) [-1673.753] (-1678.046) (-1685.187) * (-1680.682) (-1683.859) [-1682.533] (-1684.280) -- 0:00:21 898000 -- [-1676.454] (-1681.674) (-1680.999) (-1687.466) * [-1677.302] (-1677.448) (-1679.381) (-1680.978) -- 0:00:21 898500 -- (-1678.694) (-1683.759) [-1672.165] (-1678.406) * [-1682.619] (-1679.604) (-1686.780) (-1680.815) -- 0:00:21 899000 -- (-1676.550) (-1681.753) (-1675.069) [-1678.346] * (-1678.330) [-1673.243] (-1679.539) (-1687.786) -- 0:00:21 899500 -- [-1678.081] (-1687.255) (-1682.631) (-1682.888) * [-1675.096] (-1674.699) (-1678.546) (-1682.296) -- 0:00:21 900000 -- (-1680.256) [-1676.727] (-1678.461) (-1682.657) * (-1672.593) (-1676.893) [-1684.772] (-1681.448) -- 0:00:21 Average standard deviation of split frequencies: 0.007764 900500 -- (-1679.995) (-1680.209) (-1676.413) [-1673.811] * [-1674.086] (-1678.297) (-1676.412) (-1679.671) -- 0:00:21 901000 -- (-1678.094) (-1673.460) [-1676.013] (-1680.070) * (-1677.669) [-1678.353] (-1679.397) (-1686.617) -- 0:00:21 901500 -- (-1676.175) [-1674.789] (-1676.624) (-1684.844) * [-1680.453] (-1685.563) (-1680.007) (-1681.070) -- 0:00:20 902000 -- (-1679.082) (-1675.491) [-1683.963] (-1675.386) * [-1675.493] (-1677.242) (-1686.043) (-1682.361) -- 0:00:20 902500 -- [-1675.831] (-1674.094) (-1685.810) (-1673.955) * (-1675.730) (-1673.393) [-1680.772] (-1687.279) -- 0:00:20 903000 -- (-1679.465) (-1681.813) [-1683.059] (-1673.089) * [-1679.815] (-1679.822) (-1680.574) (-1676.052) -- 0:00:20 903500 -- (-1682.413) (-1684.284) (-1688.524) [-1680.431] * (-1682.916) (-1683.935) (-1685.742) [-1678.468] -- 0:00:20 904000 -- (-1680.482) [-1678.448] (-1679.374) (-1676.723) * (-1678.848) (-1678.064) [-1672.348] (-1681.024) -- 0:00:20 904500 -- (-1676.534) (-1680.283) (-1677.932) [-1687.867] * [-1675.414] (-1685.195) (-1677.467) (-1681.453) -- 0:00:20 905000 -- (-1677.368) (-1676.456) [-1676.380] (-1675.214) * (-1682.564) [-1676.731] (-1678.423) (-1688.073) -- 0:00:20 Average standard deviation of split frequencies: 0.007805 905500 -- (-1685.437) (-1675.441) [-1685.153] (-1683.590) * [-1684.224] (-1681.018) (-1681.007) (-1682.492) -- 0:00:20 906000 -- [-1677.185] (-1685.541) (-1683.293) (-1676.720) * (-1685.615) [-1682.035] (-1684.390) (-1682.159) -- 0:00:20 906500 -- (-1677.896) [-1674.954] (-1676.434) (-1678.795) * (-1675.260) [-1672.991] (-1679.861) (-1677.780) -- 0:00:19 907000 -- (-1680.465) (-1677.630) (-1679.650) [-1673.463] * (-1676.014) (-1672.077) (-1680.112) [-1673.992] -- 0:00:19 907500 -- (-1683.202) (-1680.296) (-1677.159) [-1676.300] * (-1688.039) [-1675.061] (-1680.056) (-1676.182) -- 0:00:19 908000 -- (-1679.309) (-1678.976) [-1678.617] (-1685.734) * [-1671.710] (-1679.516) (-1675.611) (-1678.398) -- 0:00:19 908500 -- (-1684.389) [-1672.500] (-1675.626) (-1683.372) * (-1679.282) [-1673.148] (-1673.177) (-1682.958) -- 0:00:19 909000 -- (-1680.214) (-1674.682) [-1672.653] (-1683.570) * (-1682.518) [-1680.232] (-1678.830) (-1677.075) -- 0:00:19 909500 -- (-1681.535) (-1684.714) [-1674.901] (-1680.894) * (-1677.107) (-1677.441) [-1684.648] (-1680.230) -- 0:00:19 910000 -- (-1682.173) [-1678.527] (-1680.195) (-1672.089) * (-1677.616) (-1671.481) [-1681.640] (-1672.234) -- 0:00:19 Average standard deviation of split frequencies: 0.008110 910500 -- (-1678.454) [-1672.615] (-1684.738) (-1680.339) * (-1681.845) (-1684.630) (-1679.511) [-1672.360] -- 0:00:19 911000 -- [-1679.077] (-1678.486) (-1676.768) (-1675.650) * (-1674.689) (-1679.113) (-1675.793) [-1671.786] -- 0:00:18 911500 -- [-1677.441] (-1679.116) (-1679.855) (-1684.516) * [-1677.952] (-1684.227) (-1677.045) (-1682.869) -- 0:00:18 912000 -- [-1671.054] (-1677.693) (-1674.271) (-1683.054) * (-1679.485) [-1687.520] (-1685.211) (-1678.333) -- 0:00:18 912500 -- (-1683.656) (-1683.479) [-1674.885] (-1676.302) * [-1673.076] (-1671.987) (-1677.028) (-1682.106) -- 0:00:18 913000 -- (-1679.334) (-1681.468) (-1679.251) [-1673.303] * (-1684.915) [-1674.560] (-1681.180) (-1682.849) -- 0:00:18 913500 -- (-1681.718) (-1677.758) (-1678.382) [-1680.143] * (-1678.354) [-1677.085] (-1676.578) (-1685.456) -- 0:00:18 914000 -- (-1682.372) (-1681.295) (-1679.299) [-1678.033] * [-1679.350] (-1672.992) (-1676.599) (-1678.825) -- 0:00:18 914500 -- (-1676.655) (-1678.442) [-1678.043] (-1680.580) * (-1679.958) (-1673.500) [-1675.902] (-1678.822) -- 0:00:18 915000 -- (-1678.428) [-1676.182] (-1680.675) (-1686.905) * (-1689.367) (-1676.732) [-1676.622] (-1675.708) -- 0:00:18 Average standard deviation of split frequencies: 0.008234 915500 -- (-1672.417) (-1678.434) [-1684.763] (-1681.893) * (-1683.070) [-1675.014] (-1679.600) (-1675.959) -- 0:00:17 916000 -- (-1683.418) [-1680.283] (-1683.071) (-1674.069) * [-1678.237] (-1675.745) (-1682.961) (-1674.499) -- 0:00:17 916500 -- (-1682.385) (-1675.253) [-1674.063] (-1678.913) * [-1677.072] (-1681.435) (-1689.629) (-1676.131) -- 0:00:17 917000 -- [-1678.441] (-1677.936) (-1679.374) (-1680.164) * (-1673.844) (-1680.065) (-1677.963) [-1673.703] -- 0:00:17 917500 -- (-1684.713) (-1674.467) [-1675.459] (-1674.878) * (-1679.560) [-1682.329] (-1682.015) (-1676.715) -- 0:00:17 918000 -- (-1680.513) (-1678.472) [-1685.342] (-1678.024) * (-1676.664) (-1679.256) [-1678.852] (-1675.447) -- 0:00:17 918500 -- (-1678.518) [-1677.576] (-1687.937) (-1678.773) * (-1677.655) (-1686.197) [-1687.856] (-1679.292) -- 0:00:17 919000 -- (-1672.259) (-1676.196) (-1674.636) [-1674.407] * [-1676.571] (-1677.748) (-1687.716) (-1674.302) -- 0:00:17 919500 -- (-1685.477) [-1681.079] (-1676.367) (-1683.352) * (-1676.408) (-1681.630) [-1678.503] (-1685.816) -- 0:00:17 920000 -- [-1676.700] (-1671.338) (-1677.017) (-1683.889) * [-1674.081] (-1679.039) (-1678.478) (-1675.542) -- 0:00:17 Average standard deviation of split frequencies: 0.007851 920500 -- (-1678.375) (-1677.140) (-1673.398) [-1678.596] * [-1669.198] (-1681.807) (-1678.771) (-1671.010) -- 0:00:16 921000 -- (-1679.657) (-1672.783) [-1675.529] (-1682.172) * (-1681.147) (-1677.366) (-1678.805) [-1671.946] -- 0:00:16 921500 -- (-1683.586) [-1677.391] (-1683.267) (-1680.187) * (-1681.334) (-1675.881) [-1681.789] (-1678.413) -- 0:00:16 922000 -- [-1672.150] (-1681.594) (-1679.315) (-1680.929) * (-1677.656) [-1672.419] (-1678.132) (-1678.836) -- 0:00:16 922500 -- (-1676.702) (-1678.704) [-1676.645] (-1680.166) * [-1672.362] (-1683.023) (-1675.453) (-1675.113) -- 0:00:16 923000 -- (-1674.178) (-1678.719) [-1674.754] (-1685.477) * [-1676.167] (-1678.062) (-1677.283) (-1685.871) -- 0:00:16 923500 -- (-1678.748) (-1678.747) (-1683.431) [-1681.058] * [-1677.493] (-1675.178) (-1678.927) (-1681.777) -- 0:00:16 924000 -- [-1676.988] (-1675.309) (-1679.703) (-1683.243) * [-1680.132] (-1680.467) (-1677.588) (-1681.693) -- 0:00:16 924500 -- [-1674.901] (-1681.041) (-1683.043) (-1679.088) * [-1673.695] (-1679.949) (-1684.833) (-1682.840) -- 0:00:16 925000 -- (-1683.781) (-1683.651) (-1677.049) [-1677.214] * (-1680.694) (-1679.830) [-1676.102] (-1679.346) -- 0:00:15 Average standard deviation of split frequencies: 0.007806 925500 -- [-1678.431] (-1678.217) (-1677.210) (-1675.436) * (-1676.600) (-1685.555) (-1679.223) [-1681.122] -- 0:00:15 926000 -- (-1681.747) [-1677.955] (-1675.154) (-1679.570) * (-1677.360) (-1683.698) (-1675.651) [-1675.861] -- 0:00:15 926500 -- (-1673.371) [-1674.343] (-1676.790) (-1682.718) * (-1681.639) (-1678.707) [-1685.591] (-1677.833) -- 0:00:15 927000 -- (-1673.637) (-1688.667) [-1674.654] (-1687.311) * [-1680.369] (-1688.304) (-1676.557) (-1678.135) -- 0:00:15 927500 -- (-1676.400) (-1676.693) (-1679.067) [-1679.267] * [-1678.996] (-1678.727) (-1678.756) (-1681.425) -- 0:00:15 928000 -- (-1672.561) [-1680.679] (-1671.550) (-1674.264) * (-1678.678) [-1675.796] (-1684.685) (-1680.129) -- 0:00:15 928500 -- (-1673.927) (-1674.131) (-1677.885) [-1675.319] * (-1674.087) (-1678.557) [-1677.473] (-1681.382) -- 0:00:15 929000 -- (-1688.953) (-1677.266) (-1684.525) [-1678.545] * (-1677.389) (-1673.284) (-1680.198) [-1677.651] -- 0:00:15 929500 -- [-1679.676] (-1673.318) (-1677.406) (-1680.604) * (-1683.383) (-1680.431) [-1674.672] (-1680.089) -- 0:00:15 930000 -- (-1681.848) (-1676.984) [-1689.562] (-1676.313) * (-1679.212) (-1679.785) (-1676.025) [-1674.067] -- 0:00:14 Average standard deviation of split frequencies: 0.007345 930500 -- (-1686.194) (-1684.862) [-1675.874] (-1676.469) * [-1671.956] (-1685.749) (-1677.719) (-1674.148) -- 0:00:14 931000 -- [-1670.199] (-1684.134) (-1673.237) (-1681.632) * [-1673.191] (-1694.678) (-1688.679) (-1680.438) -- 0:00:14 931500 -- (-1674.987) [-1678.034] (-1683.035) (-1680.089) * (-1677.141) (-1678.210) [-1675.069] (-1688.815) -- 0:00:14 932000 -- [-1675.227] (-1675.174) (-1681.688) (-1674.480) * (-1688.791) (-1675.204) (-1687.261) [-1680.935] -- 0:00:14 932500 -- (-1677.852) (-1676.462) [-1679.920] (-1676.526) * [-1674.729] (-1679.660) (-1680.956) (-1685.761) -- 0:00:14 933000 -- (-1679.418) (-1677.186) (-1680.336) [-1679.441] * (-1678.979) [-1673.803] (-1675.433) (-1686.402) -- 0:00:14 933500 -- (-1679.643) [-1675.868] (-1691.663) (-1681.692) * [-1681.649] (-1679.527) (-1679.171) (-1684.033) -- 0:00:14 934000 -- [-1676.809] (-1679.357) (-1678.750) (-1674.127) * [-1681.046] (-1680.603) (-1684.705) (-1680.767) -- 0:00:14 934500 -- [-1680.274] (-1679.055) (-1679.729) (-1682.707) * [-1678.127] (-1672.509) (-1674.758) (-1677.198) -- 0:00:13 935000 -- (-1689.480) (-1685.714) [-1683.881] (-1676.637) * (-1675.345) [-1680.376] (-1675.382) (-1674.413) -- 0:00:13 Average standard deviation of split frequencies: 0.007135 935500 -- (-1674.072) (-1678.276) (-1679.162) [-1673.762] * (-1677.591) [-1682.618] (-1673.868) (-1686.772) -- 0:00:13 936000 -- [-1682.905] (-1678.592) (-1678.786) (-1675.824) * (-1684.102) (-1685.575) (-1675.377) [-1680.803] -- 0:00:13 936500 -- (-1678.784) (-1675.973) (-1684.459) [-1673.160] * (-1685.442) (-1687.516) (-1686.207) [-1674.980] -- 0:00:13 937000 -- [-1675.427] (-1675.778) (-1681.381) (-1679.579) * (-1685.617) (-1685.816) [-1684.979] (-1680.056) -- 0:00:13 937500 -- (-1688.790) (-1671.600) [-1675.339] (-1685.491) * (-1680.489) (-1687.257) [-1678.873] (-1678.397) -- 0:00:13 938000 -- (-1682.800) (-1678.363) [-1670.646] (-1689.432) * [-1678.099] (-1687.971) (-1674.985) (-1684.864) -- 0:00:13 938500 -- [-1683.682] (-1681.768) (-1682.360) (-1683.661) * [-1676.316] (-1692.328) (-1673.246) (-1676.267) -- 0:00:13 939000 -- (-1681.917) [-1677.628] (-1675.814) (-1678.797) * (-1676.888) (-1682.823) [-1678.068] (-1674.943) -- 0:00:12 939500 -- (-1675.325) (-1682.950) (-1682.796) [-1672.808] * (-1684.397) (-1681.710) (-1675.907) [-1675.138] -- 0:00:12 940000 -- [-1682.658] (-1680.096) (-1681.806) (-1676.009) * (-1678.392) (-1681.170) [-1677.897] (-1680.492) -- 0:00:12 Average standard deviation of split frequencies: 0.006598 940500 -- [-1674.971] (-1678.506) (-1684.686) (-1680.038) * (-1677.101) [-1674.381] (-1677.605) (-1680.217) -- 0:00:12 941000 -- (-1682.033) (-1686.344) [-1676.670] (-1677.485) * (-1675.792) (-1676.868) (-1681.076) [-1672.256] -- 0:00:12 941500 -- (-1682.980) (-1678.691) [-1675.423] (-1678.049) * [-1673.241] (-1672.326) (-1675.960) (-1677.197) -- 0:00:12 942000 -- (-1675.429) (-1688.038) (-1683.607) [-1677.578] * (-1676.210) (-1685.328) [-1679.402] (-1677.159) -- 0:00:12 942500 -- (-1685.897) (-1686.319) [-1675.877] (-1685.434) * [-1682.074] (-1681.162) (-1679.780) (-1681.198) -- 0:00:12 943000 -- (-1687.989) (-1679.958) [-1673.109] (-1686.775) * [-1672.715] (-1681.694) (-1678.219) (-1680.676) -- 0:00:12 943500 -- (-1678.670) (-1680.552) [-1676.539] (-1677.322) * (-1680.424) [-1680.026] (-1678.690) (-1682.379) -- 0:00:12 944000 -- (-1674.728) [-1677.107] (-1685.721) (-1673.133) * [-1672.267] (-1680.320) (-1680.994) (-1682.053) -- 0:00:11 944500 -- (-1677.065) (-1683.343) (-1686.586) [-1674.485] * (-1676.117) (-1680.931) [-1674.444] (-1684.453) -- 0:00:11 945000 -- (-1680.909) [-1683.270] (-1682.630) (-1679.008) * (-1673.281) (-1685.648) [-1674.247] (-1683.850) -- 0:00:11 Average standard deviation of split frequencies: 0.006561 945500 -- [-1682.937] (-1685.888) (-1685.559) (-1679.648) * (-1679.534) (-1682.553) [-1687.601] (-1679.519) -- 0:00:11 946000 -- (-1679.075) [-1680.996] (-1678.613) (-1679.481) * (-1684.579) (-1676.207) (-1678.868) [-1674.998] -- 0:00:11 946500 -- (-1686.896) (-1683.875) (-1678.010) [-1673.945] * (-1674.335) (-1695.366) [-1673.925] (-1684.900) -- 0:00:11 947000 -- (-1675.926) (-1687.042) (-1686.680) [-1675.699] * [-1674.191] (-1680.882) (-1679.890) (-1678.495) -- 0:00:11 947500 -- (-1682.880) [-1678.996] (-1676.357) (-1669.623) * (-1676.044) [-1675.627] (-1680.440) (-1678.431) -- 0:00:11 948000 -- (-1682.750) [-1672.484] (-1683.836) (-1679.259) * (-1686.515) (-1685.271) (-1675.526) [-1674.172] -- 0:00:11 948500 -- [-1675.418] (-1677.589) (-1682.399) (-1674.754) * (-1676.035) (-1682.228) [-1674.804] (-1682.735) -- 0:00:10 949000 -- (-1675.326) (-1676.560) [-1677.776] (-1676.501) * (-1674.967) (-1678.478) (-1673.458) [-1679.061] -- 0:00:10 949500 -- (-1683.334) [-1677.405] (-1678.171) (-1679.947) * [-1676.740] (-1683.967) (-1678.415) (-1675.968) -- 0:00:10 950000 -- (-1670.895) [-1678.041] (-1677.945) (-1684.444) * [-1677.954] (-1690.511) (-1671.698) (-1679.727) -- 0:00:10 Average standard deviation of split frequencies: 0.006859 950500 -- (-1679.670) (-1679.246) (-1674.930) [-1678.199] * (-1676.948) [-1685.392] (-1684.690) (-1683.960) -- 0:00:10 951000 -- [-1677.290] (-1678.037) (-1678.816) (-1683.202) * (-1687.908) (-1689.529) (-1681.795) [-1675.339] -- 0:00:10 951500 -- (-1676.609) [-1676.096] (-1677.974) (-1673.569) * (-1680.592) (-1685.417) [-1673.099] (-1678.595) -- 0:00:10 952000 -- (-1678.952) [-1678.170] (-1685.640) (-1672.696) * (-1682.044) [-1681.606] (-1681.667) (-1675.705) -- 0:00:10 952500 -- (-1676.179) (-1680.350) [-1675.493] (-1675.967) * (-1676.528) (-1675.629) (-1674.754) [-1671.495] -- 0:00:10 953000 -- (-1681.987) (-1677.024) (-1685.491) [-1681.416] * (-1677.702) [-1672.477] (-1677.160) (-1676.915) -- 0:00:10 953500 -- [-1676.065] (-1679.654) (-1676.441) (-1683.823) * [-1686.040] (-1674.690) (-1677.842) (-1681.010) -- 0:00:09 954000 -- [-1681.914] (-1676.416) (-1680.263) (-1680.795) * (-1673.213) (-1677.079) (-1681.376) [-1673.912] -- 0:00:09 954500 -- (-1672.862) (-1689.139) [-1682.471] (-1677.306) * (-1689.162) [-1678.554] (-1677.858) (-1681.887) -- 0:00:09 955000 -- (-1678.166) (-1681.736) (-1677.970) [-1677.364] * (-1676.366) (-1685.704) [-1676.227] (-1680.740) -- 0:00:09 Average standard deviation of split frequencies: 0.006328 955500 -- (-1681.542) [-1676.068] (-1680.126) (-1683.288) * (-1677.514) (-1681.074) (-1674.948) [-1674.104] -- 0:00:09 956000 -- (-1687.622) (-1677.079) (-1689.241) [-1675.051] * (-1681.561) [-1675.565] (-1671.685) (-1673.455) -- 0:00:09 956500 -- [-1675.248] (-1679.505) (-1682.395) (-1674.691) * [-1678.671] (-1680.973) (-1686.977) (-1673.618) -- 0:00:09 957000 -- (-1677.934) [-1677.200] (-1675.298) (-1674.648) * (-1680.291) (-1687.527) (-1673.749) [-1679.811] -- 0:00:09 957500 -- (-1674.124) (-1681.313) [-1679.725] (-1669.536) * (-1678.816) (-1682.805) [-1674.760] (-1684.012) -- 0:00:09 958000 -- [-1681.167] (-1680.314) (-1686.774) (-1672.697) * [-1673.421] (-1681.510) (-1676.319) (-1677.813) -- 0:00:08 958500 -- (-1680.058) (-1683.837) (-1684.112) [-1673.140] * [-1692.106] (-1673.199) (-1684.381) (-1681.878) -- 0:00:08 959000 -- (-1676.563) (-1679.153) (-1677.016) [-1675.846] * (-1674.346) (-1678.573) (-1678.951) [-1675.273] -- 0:00:08 959500 -- (-1673.923) (-1681.251) [-1676.486] (-1681.686) * (-1678.080) (-1687.153) [-1676.323] (-1676.492) -- 0:00:08 960000 -- [-1679.011] (-1688.178) (-1688.380) (-1672.207) * (-1677.798) [-1678.348] (-1679.379) (-1676.938) -- 0:00:08 Average standard deviation of split frequencies: 0.005480 960500 -- (-1685.722) [-1683.612] (-1690.430) (-1676.002) * (-1678.521) (-1673.142) (-1681.486) [-1677.154] -- 0:00:08 961000 -- (-1680.545) (-1675.463) [-1672.776] (-1678.169) * (-1684.877) [-1679.282] (-1675.754) (-1676.441) -- 0:00:08 961500 -- (-1681.378) [-1673.826] (-1685.315) (-1681.752) * (-1681.559) (-1675.388) (-1675.444) [-1680.306] -- 0:00:08 962000 -- (-1682.706) (-1684.711) [-1683.619] (-1682.183) * (-1682.618) [-1687.159] (-1677.209) (-1674.706) -- 0:00:08 962500 -- (-1679.526) [-1680.174] (-1683.211) (-1676.589) * (-1677.323) [-1679.085] (-1674.781) (-1680.818) -- 0:00:07 963000 -- (-1685.515) [-1675.335] (-1679.210) (-1682.088) * [-1680.692] (-1674.817) (-1682.955) (-1673.758) -- 0:00:07 963500 -- [-1680.199] (-1672.005) (-1674.876) (-1679.907) * [-1679.931] (-1679.268) (-1680.873) (-1677.950) -- 0:00:07 964000 -- (-1679.103) (-1679.646) [-1674.324] (-1685.037) * (-1678.750) (-1677.479) [-1675.243] (-1674.432) -- 0:00:07 964500 -- (-1676.792) (-1675.079) [-1678.780] (-1689.780) * (-1676.326) [-1682.835] (-1679.443) (-1675.733) -- 0:00:07 965000 -- [-1677.427] (-1688.284) (-1680.627) (-1673.131) * (-1677.310) (-1680.260) (-1687.169) [-1676.614] -- 0:00:07 Average standard deviation of split frequencies: 0.005449 965500 -- [-1673.171] (-1678.963) (-1679.212) (-1683.581) * (-1673.956) [-1675.379] (-1681.702) (-1681.750) -- 0:00:07 966000 -- (-1681.373) (-1680.650) [-1681.323] (-1683.478) * (-1687.937) (-1677.543) (-1677.175) [-1672.132] -- 0:00:07 966500 -- (-1670.503) (-1680.915) [-1679.684] (-1679.291) * (-1681.113) (-1683.391) [-1682.776] (-1674.922) -- 0:00:07 967000 -- (-1679.744) [-1686.357] (-1675.656) (-1680.879) * (-1685.699) (-1682.414) [-1674.108] (-1677.417) -- 0:00:07 967500 -- (-1679.889) [-1674.314] (-1673.205) (-1680.558) * (-1689.145) [-1679.266] (-1677.759) (-1678.300) -- 0:00:06 968000 -- (-1683.579) (-1679.067) (-1683.109) [-1673.775] * [-1674.066] (-1672.782) (-1688.158) (-1675.416) -- 0:00:06 968500 -- (-1683.269) (-1681.498) (-1681.760) [-1670.609] * (-1678.624) [-1675.025] (-1679.144) (-1678.388) -- 0:00:06 969000 -- (-1684.757) [-1672.452] (-1681.646) (-1676.817) * [-1678.691] (-1685.663) (-1690.455) (-1677.835) -- 0:00:06 969500 -- (-1683.960) (-1685.226) [-1678.908] (-1678.241) * (-1673.145) (-1680.336) [-1675.033] (-1676.326) -- 0:00:06 970000 -- (-1693.637) (-1679.967) [-1675.694] (-1673.283) * (-1674.371) (-1674.555) [-1674.795] (-1678.991) -- 0:00:06 Average standard deviation of split frequencies: 0.005747 970500 -- (-1675.970) [-1673.786] (-1686.613) (-1672.944) * [-1678.209] (-1677.561) (-1682.598) (-1671.640) -- 0:00:06 971000 -- [-1675.527] (-1684.823) (-1677.190) (-1678.165) * (-1669.549) (-1682.660) (-1671.532) [-1672.788] -- 0:00:06 971500 -- (-1682.556) (-1673.785) [-1681.209] (-1676.726) * (-1682.199) (-1679.562) (-1681.968) [-1678.273] -- 0:00:06 972000 -- (-1683.481) [-1673.541] (-1678.377) (-1678.105) * (-1678.162) (-1679.373) (-1682.755) [-1677.821] -- 0:00:05 972500 -- (-1674.715) [-1678.222] (-1675.483) (-1675.476) * (-1688.168) [-1674.618] (-1686.318) (-1678.640) -- 0:00:05 973000 -- (-1683.170) (-1679.025) (-1688.091) [-1679.383] * [-1679.121] (-1681.722) (-1687.157) (-1681.480) -- 0:00:05 973500 -- (-1688.962) [-1677.247] (-1686.810) (-1685.535) * (-1683.672) (-1675.984) [-1679.212] (-1678.793) -- 0:00:05 974000 -- (-1677.077) (-1683.930) (-1684.613) [-1675.676] * [-1680.025] (-1677.152) (-1682.812) (-1679.654) -- 0:00:05 974500 -- (-1683.566) (-1677.555) (-1681.308) [-1673.883] * (-1678.209) (-1681.841) [-1676.002] (-1677.091) -- 0:00:05 975000 -- (-1677.858) (-1676.363) [-1670.132] (-1674.319) * [-1679.431] (-1674.898) (-1681.919) (-1688.834) -- 0:00:05 Average standard deviation of split frequencies: 0.005393 975500 -- (-1676.528) (-1680.199) [-1673.663] (-1684.750) * [-1680.856] (-1677.356) (-1675.338) (-1685.095) -- 0:00:05 976000 -- [-1679.330] (-1677.801) (-1687.975) (-1682.056) * (-1677.751) (-1681.426) [-1675.447] (-1686.076) -- 0:00:05 976500 -- (-1683.446) (-1680.138) [-1671.056] (-1679.885) * (-1675.706) (-1684.686) [-1674.826] (-1680.394) -- 0:00:05 977000 -- (-1678.284) (-1682.729) [-1676.576] (-1679.058) * (-1681.166) [-1674.326] (-1687.503) (-1678.817) -- 0:00:04 977500 -- (-1682.327) [-1683.557] (-1678.684) (-1673.051) * (-1679.015) (-1676.161) [-1675.912] (-1683.329) -- 0:00:04 978000 -- [-1676.824] (-1680.526) (-1677.945) (-1677.413) * (-1673.986) (-1675.461) [-1677.953] (-1680.955) -- 0:00:04 978500 -- [-1680.401] (-1678.753) (-1681.409) (-1678.272) * (-1677.981) [-1676.149] (-1692.621) (-1677.894) -- 0:00:04 979000 -- (-1686.528) [-1675.817] (-1672.131) (-1671.648) * (-1687.353) [-1676.330] (-1687.837) (-1693.696) -- 0:00:04 979500 -- [-1677.639] (-1677.779) (-1677.952) (-1678.497) * [-1676.847] (-1678.863) (-1687.458) (-1676.768) -- 0:00:04 980000 -- [-1674.760] (-1673.145) (-1678.595) (-1672.283) * (-1676.424) (-1684.535) [-1685.242] (-1688.137) -- 0:00:04 Average standard deviation of split frequencies: 0.005528 980500 -- (-1675.039) (-1675.884) [-1679.201] (-1677.713) * [-1678.963] (-1685.981) (-1686.584) (-1679.303) -- 0:00:04 981000 -- (-1675.132) (-1678.091) (-1683.461) [-1675.112] * (-1674.099) (-1683.885) (-1688.172) [-1671.952] -- 0:00:04 981500 -- (-1682.836) (-1675.845) (-1688.374) [-1688.727] * (-1673.885) [-1679.893] (-1683.631) (-1676.529) -- 0:00:03 982000 -- [-1680.191] (-1681.882) (-1687.029) (-1673.297) * [-1676.920] (-1682.396) (-1689.065) (-1678.030) -- 0:00:03 982500 -- (-1676.088) (-1675.846) (-1683.785) [-1675.734] * (-1676.714) (-1676.369) (-1697.865) [-1674.439] -- 0:00:03 983000 -- (-1682.367) (-1682.449) [-1675.011] (-1681.143) * [-1676.903] (-1681.165) (-1676.374) (-1675.755) -- 0:00:03 983500 -- (-1676.109) (-1678.315) (-1676.356) [-1677.665] * (-1673.211) (-1683.214) [-1679.948] (-1679.364) -- 0:00:03 984000 -- (-1676.601) (-1684.754) (-1676.468) [-1675.447] * (-1678.805) (-1685.686) [-1679.933] (-1676.243) -- 0:00:03 984500 -- (-1675.015) [-1672.825] (-1672.601) (-1676.105) * (-1696.055) (-1678.603) (-1682.356) [-1679.019] -- 0:00:03 985000 -- (-1681.169) (-1677.693) [-1672.750] (-1678.177) * (-1678.888) (-1677.648) [-1676.990] (-1680.762) -- 0:00:03 Average standard deviation of split frequencies: 0.005657 985500 -- [-1677.501] (-1673.175) (-1675.010) (-1675.704) * (-1678.188) (-1681.463) [-1675.197] (-1681.777) -- 0:00:03 986000 -- (-1681.047) (-1678.214) (-1678.854) [-1676.571] * [-1673.715] (-1683.570) (-1686.428) (-1675.383) -- 0:00:02 986500 -- (-1678.417) (-1682.906) (-1678.978) [-1674.085] * [-1676.421] (-1691.243) (-1678.127) (-1675.700) -- 0:00:02 987000 -- [-1678.458] (-1680.249) (-1676.067) (-1678.631) * (-1681.068) (-1683.158) [-1682.238] (-1678.342) -- 0:00:02 987500 -- (-1681.424) [-1681.166] (-1681.902) (-1673.241) * (-1676.521) (-1678.663) [-1678.957] (-1685.012) -- 0:00:02 988000 -- (-1677.053) [-1674.539] (-1684.458) (-1678.384) * (-1674.920) (-1693.926) [-1677.030] (-1675.423) -- 0:00:02 988500 -- [-1679.317] (-1688.681) (-1674.012) (-1677.432) * (-1672.769) (-1679.396) (-1675.941) [-1675.722] -- 0:00:02 989000 -- (-1686.126) (-1681.417) [-1675.263] (-1678.770) * [-1671.953] (-1689.875) (-1684.666) (-1671.467) -- 0:00:02 989500 -- (-1680.351) (-1680.758) [-1675.153] (-1677.916) * (-1682.323) (-1682.590) (-1671.693) [-1673.014] -- 0:00:02 990000 -- (-1683.128) (-1679.391) [-1685.917] (-1683.156) * (-1672.338) (-1680.743) (-1677.058) [-1676.085] -- 0:00:02 Average standard deviation of split frequencies: 0.005631 990500 -- (-1685.765) (-1674.203) (-1686.702) [-1680.851] * (-1687.450) (-1682.268) (-1677.836) [-1678.086] -- 0:00:02 991000 -- (-1673.474) (-1673.608) (-1678.829) [-1678.944] * (-1677.444) (-1681.255) [-1675.384] (-1678.740) -- 0:00:01 991500 -- [-1677.728] (-1674.826) (-1680.200) (-1679.740) * (-1688.515) (-1679.341) (-1674.302) [-1675.344] -- 0:00:01 992000 -- (-1687.669) (-1671.838) [-1673.167] (-1682.250) * (-1674.347) [-1677.210] (-1682.959) (-1680.010) -- 0:00:01 992500 -- [-1676.550] (-1678.242) (-1676.385) (-1679.225) * [-1676.308] (-1688.481) (-1684.590) (-1674.191) -- 0:00:01 993000 -- (-1681.906) (-1680.857) (-1675.991) [-1672.751] * (-1673.040) (-1672.890) [-1677.475] (-1687.173) -- 0:00:01 993500 -- (-1679.930) (-1680.497) [-1676.471] (-1676.625) * (-1676.867) (-1685.682) [-1678.218] (-1685.564) -- 0:00:01 994000 -- [-1680.313] (-1678.279) (-1675.351) (-1674.831) * (-1677.016) (-1678.475) [-1672.501] (-1683.289) -- 0:00:01 994500 -- (-1683.450) (-1684.496) [-1678.279] (-1687.681) * (-1687.186) [-1676.444] (-1678.996) (-1677.807) -- 0:00:01 995000 -- (-1676.579) (-1684.455) (-1683.714) [-1672.126] * (-1675.281) [-1674.615] (-1675.197) (-1678.110) -- 0:00:01 Average standard deviation of split frequencies: 0.005285 995500 -- (-1686.558) (-1681.119) [-1679.231] (-1671.516) * (-1677.738) (-1683.172) (-1692.421) [-1679.624] -- 0:00:00 996000 -- (-1677.456) [-1679.340] (-1684.579) (-1675.302) * [-1678.059] (-1676.455) (-1684.805) (-1684.111) -- 0:00:00 996500 -- (-1671.275) [-1676.730] (-1671.827) (-1680.798) * [-1677.890] (-1676.273) (-1678.655) (-1677.239) -- 0:00:00 997000 -- (-1673.089) [-1676.963] (-1680.982) (-1684.728) * (-1675.342) (-1677.865) [-1673.021] (-1678.541) -- 0:00:00 997500 -- (-1681.598) [-1677.233] (-1683.298) (-1679.559) * (-1674.664) (-1680.835) [-1678.673] (-1685.938) -- 0:00:00 998000 -- (-1673.139) (-1681.218) (-1677.539) [-1683.259] * (-1681.516) [-1674.951] (-1680.445) (-1678.114) -- 0:00:00 998500 -- (-1675.622) (-1679.816) (-1675.239) [-1670.922] * [-1676.450] (-1679.714) (-1681.909) (-1677.162) -- 0:00:00 999000 -- (-1690.049) [-1673.172] (-1676.491) (-1677.469) * (-1674.155) [-1671.876] (-1685.279) (-1675.876) -- 0:00:00 999500 -- [-1674.905] (-1675.405) (-1673.759) (-1672.755) * (-1675.944) [-1673.854] (-1683.719) (-1672.316) -- 0:00:00 1000000 -- (-1678.999) (-1674.266) [-1677.167] (-1674.091) * (-1675.442) (-1675.700) [-1690.382] (-1677.060) -- 0:00:00 Average standard deviation of split frequencies: 0.006046 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -1678.998908 -- 20.275392 Chain 1 -- -1678.998910 -- 20.275392 Chain 2 -- -1674.266264 -- 20.763155 Chain 2 -- -1674.266263 -- 20.763155 Chain 3 -- -1677.166721 -- 21.275881 Chain 3 -- -1677.166721 -- 21.275881 Chain 4 -- -1674.091032 -- 18.554574 Chain 4 -- -1674.091031 -- 18.554574 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -1675.442113 -- 18.151496 Chain 1 -- -1675.442113 -- 18.151496 Chain 2 -- -1675.700400 -- 20.782595 Chain 2 -- -1675.700399 -- 20.782595 Chain 3 -- -1690.381887 -- 22.255644 Chain 3 -- -1690.381887 -- 22.255644 Chain 4 -- -1677.059835 -- 20.540290 Chain 4 -- -1677.059837 -- 20.540290 Analysis completed in 3 mins 33 seconds Analysis used 212.69 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1667.27 Likelihood of best state for "cold" chain of run 2 was -1667.38 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 59.6 % ( 57 %) Dirichlet(Revmat{all}) 72.9 % ( 56 %) Slider(Revmat{all}) 26.4 % ( 29 %) Dirichlet(Pi{all}) 28.3 % ( 29 %) Slider(Pi{all}) 69.6 % ( 34 %) Multiplier(Alpha{1,2}) 52.1 % ( 26 %) Multiplier(Alpha{3}) 76.4 % ( 47 %) Slider(Pinvar{all}) 12.8 % ( 14 %) ExtSPR(Tau{all},V{all}) 6.1 % ( 6 %) ExtTBR(Tau{all},V{all}) 25.0 % ( 25 %) NNI(Tau{all},V{all}) 20.6 % ( 21 %) ParsSPR(Tau{all},V{all}) 26.8 % ( 33 %) Multiplier(V{all}) 43.2 % ( 38 %) Nodeslider(V{all}) 25.7 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 59.7 % ( 55 %) Dirichlet(Revmat{all}) 72.7 % ( 57 %) Slider(Revmat{all}) 26.7 % ( 19 %) Dirichlet(Pi{all}) 28.1 % ( 20 %) Slider(Pi{all}) 69.0 % ( 38 %) Multiplier(Alpha{1,2}) 51.9 % ( 23 %) Multiplier(Alpha{3}) 76.6 % ( 53 %) Slider(Pinvar{all}) 12.6 % ( 15 %) ExtSPR(Tau{all},V{all}) 6.1 % ( 5 %) ExtTBR(Tau{all},V{all}) 24.9 % ( 25 %) NNI(Tau{all},V{all}) 20.6 % ( 19 %) ParsSPR(Tau{all},V{all}) 26.7 % ( 23 %) Multiplier(V{all}) 43.3 % ( 47 %) Nodeslider(V{all}) 25.7 % ( 26 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.80 0.63 0.49 2 | 167063 0.82 0.66 3 | 166583 167081 0.83 4 | 166931 165397 166945 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.80 0.63 0.48 2 | 167068 0.82 0.65 3 | 166547 166208 0.83 4 | 166363 166925 166889 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1675.35 | 1 | | 2 2 | | 1 2 2 1 | | 2 1 1 21 2 | | 1 1 2 22 2 1 1 1 2 2| | 1 2 1 2 1 2 11 2 *2 12 1 1 11 | | 12 2 1 1 11 1 1 2 2 2 2 1| |21 11 12 2 12 1 1 21 11 22 | |1 22 2212 2 21 1 * 11 | | 2 2 2 1 2 1 222 2 2 1 2 22 1 1 | | 2 1 12 2 1 1 2 2 | | 1 1 | | 1 | | 2 | | 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1679.40 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1673.23 -1688.92 2 -1673.37 -1685.58 -------------------------------------- TOTAL -1673.30 -1688.26 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.190660 0.000783 0.140924 0.247460 0.188393 1413.45 1421.44 1.000 r(A<->C){all} 0.162236 0.002012 0.079987 0.252656 0.159264 792.69 852.70 1.000 r(A<->G){all} 0.219248 0.002299 0.123586 0.311306 0.216976 810.27 921.38 1.000 r(A<->T){all} 0.141515 0.001241 0.078625 0.210845 0.138640 980.96 1054.29 1.000 r(C<->G){all} 0.080594 0.001234 0.020637 0.151444 0.075934 709.48 758.09 1.000 r(C<->T){all} 0.321923 0.003292 0.211766 0.437870 0.320041 772.99 821.89 1.000 r(G<->T){all} 0.074484 0.000793 0.022586 0.128365 0.071487 840.37 973.50 1.000 pi(A){all} 0.303661 0.000243 0.272296 0.332785 0.303464 1135.61 1234.40 1.000 pi(C){all} 0.186293 0.000174 0.161011 0.212818 0.185683 1025.79 1102.18 1.000 pi(G){all} 0.231001 0.000210 0.202854 0.258815 0.230795 1369.51 1431.44 1.000 pi(T){all} 0.279045 0.000235 0.249413 0.308227 0.278883 964.48 1118.27 1.000 alpha{1,2} 0.080343 0.004599 0.000122 0.205071 0.065455 1436.12 1468.56 1.000 alpha{3} 1.664866 0.562131 0.440022 3.171361 1.519917 1357.56 1429.28 1.000 pinvar{all} 0.312698 0.019010 0.023165 0.540322 0.324277 1044.58 1171.10 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 Key to taxon bipartitions (saved to file "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------- 1 -- .****** 2 -- .*..... 3 -- ..*.... 4 -- ...*... 5 -- ....*.. 6 -- .....*. 7 -- ......* 8 -- .****.. 9 -- .....** 10 -- .***... 11 -- .*.*... 12 -- ..**... 13 -- .**.... ------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 8 3002 1.000000 0.000000 1.000000 1.000000 2 9 3002 1.000000 0.000000 1.000000 1.000000 2 10 2976 0.991339 0.001884 0.990007 0.992672 2 11 1028 0.342438 0.013191 0.333111 0.351765 2 12 992 0.330446 0.017901 0.317788 0.343105 2 13 971 0.323451 0.003298 0.321119 0.325783 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.021380 0.000050 0.009262 0.035952 0.020642 1.000 2 length{all}[2] 0.001456 0.000002 0.000000 0.004321 0.000986 1.000 2 length{all}[3] 0.003017 0.000005 0.000109 0.007322 0.002504 1.000 2 length{all}[4] 0.002909 0.000004 0.000075 0.006921 0.002460 1.000 2 length{all}[5] 0.004117 0.000007 0.000036 0.009075 0.003634 1.000 2 length{all}[6] 0.054456 0.000180 0.031243 0.081937 0.052800 1.000 2 length{all}[7] 0.032120 0.000090 0.015343 0.050446 0.030871 1.001 2 length{all}[8] 0.023844 0.000058 0.010406 0.039235 0.023075 1.000 2 length{all}[9] 0.041138 0.000122 0.021566 0.063785 0.039909 1.000 2 length{all}[10] 0.004742 0.000008 0.000184 0.010199 0.004146 1.000 2 length{all}[11] 0.001445 0.000002 0.000000 0.004434 0.000950 0.999 2 length{all}[12] 0.001526 0.000003 0.000004 0.004559 0.001029 1.001 2 length{all}[13] 0.001552 0.000002 0.000001 0.004788 0.001102 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006046 Maximum standard deviation of split frequencies = 0.017901 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------ C6 (6) |----------------------100----------------------+ | \------------------------ C7 (7) + | /------------------------ C2 (2) | | | /-----------99----------+------------------------ C3 (3) | | | \----------100----------+ \------------------------ C4 (4) | \------------------------------------------------ C5 (5) Phylogram (based on average branch lengths): /---------------- C1 (1) | | /----------------------------------------- C6 (6) |------------------------------+ | \------------------------ C7 (7) + | /- C2 (2) | | | /--+-- C3 (3) | | | \-----------------+ \-- C4 (4) | \--- C5 (5) |--------------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (13 trees sampled): 50 % credible set contains 2 trees 90 % credible set contains 3 trees 95 % credible set contains 3 trees 99 % credible set contains 3 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 7 ls = 804 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Sequences read.. Counting site patterns.. 0:00 129 patterns at 268 / 268 sites (100.0%), 0:00 Counting codons.. 168 bytes for distance 125904 bytes for conP 17544 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 251808 bytes for conP, adjusted 0.049548 0.084008 0.107280 0.079722 0.047513 0.008124 0.000000 0.003851 0.003910 0.007029 0.300000 1.300000 ntime & nrate & np: 10 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 12 lnL0 = -1714.440139 Iterating by ming2 Initial: fx= 1714.440139 x= 0.04955 0.08401 0.10728 0.07972 0.04751 0.00812 0.00000 0.00385 0.00391 0.00703 0.30000 1.30000 1 h-m-p 0.0000 0.0000 296.7319 ++ 1714.439873 m 0.0000 17 | 1/12 2 h-m-p 0.0000 0.0001 1229.9121 +CCYCC 1708.258973 4 0.0001 41 | 1/12 3 h-m-p 0.0000 0.0001 2156.0596 CYCCC 1706.459684 4 0.0000 63 | 1/12 4 h-m-p 0.0000 0.0001 407.4853 +YYYYYCCCCC 1703.000461 9 0.0001 92 | 1/12 5 h-m-p 0.0000 0.0001 1033.1696 +YYYCCC 1698.468081 5 0.0001 115 | 1/12 6 h-m-p 0.0002 0.0008 258.8824 CYCC 1696.912221 3 0.0002 135 | 1/12 7 h-m-p 0.0006 0.0048 80.5676 CC 1695.108506 1 0.0009 152 | 1/12 8 h-m-p 0.0003 0.0033 249.3654 +CYCYCCC 1680.962067 6 0.0019 178 | 1/12 9 h-m-p 0.0000 0.0001 4719.8264 +YYYYCCC 1659.855287 6 0.0001 202 | 1/12 10 h-m-p 0.0000 0.0001 872.8241 YYCC 1659.331016 3 0.0000 221 | 1/12 11 h-m-p 0.0035 0.0558 6.4196 CCC 1659.292886 2 0.0007 240 | 1/12 12 h-m-p 0.0049 0.1515 0.9402 ++YYCCC 1652.984809 4 0.0619 263 | 1/12 13 h-m-p 0.1176 0.5881 0.3751 +YYCCC 1630.494385 4 0.4279 296 | 1/12 14 h-m-p 0.1505 0.7524 0.1067 +YYCCC 1628.704416 4 0.4782 329 | 1/12 15 h-m-p 0.4698 2.7905 0.1086 +YYYC 1623.526528 3 1.7581 359 | 1/12 16 h-m-p 0.4836 2.4180 0.1012 YCCC 1621.878252 3 0.9931 390 | 1/12 17 h-m-p 0.8518 4.2588 0.0966 CCC 1620.865317 2 0.8460 420 | 1/12 18 h-m-p 0.4656 2.3279 0.0545 YCCCC 1620.364425 4 0.9961 453 | 1/12 19 h-m-p 0.8465 4.2843 0.0641 CCCC 1620.034522 3 1.0827 485 | 1/12 20 h-m-p 1.6000 8.0000 0.0411 CCC 1619.877533 2 1.3586 515 | 1/12 21 h-m-p 1.6000 8.0000 0.0216 CC 1619.801171 1 1.8820 543 | 1/12 22 h-m-p 1.6000 8.0000 0.0140 CCC 1619.734456 2 2.4183 573 | 1/12 23 h-m-p 1.6000 8.0000 0.0066 YC 1619.650709 1 3.2832 600 | 1/12 24 h-m-p 1.5849 8.0000 0.0137 CCC 1619.613988 2 2.3072 630 | 1/12 25 h-m-p 1.6000 8.0000 0.0187 CCC 1619.594052 2 1.4345 660 | 1/12 26 h-m-p 1.6000 8.0000 0.0097 YC 1619.591094 1 1.1600 687 | 1/12 27 h-m-p 1.6000 8.0000 0.0006 Y 1619.591070 0 1.1206 713 | 1/12 28 h-m-p 1.6000 8.0000 0.0001 C 1619.591069 0 1.5781 739 | 1/12 29 h-m-p 1.6000 8.0000 0.0000 C 1619.591069 0 1.8135 765 | 1/12 30 h-m-p 1.6000 8.0000 0.0000 Y 1619.591069 0 2.9066 791 | 1/12 31 h-m-p 1.6000 8.0000 0.0000 C 1619.591069 0 1.4049 817 | 1/12 32 h-m-p 1.6000 8.0000 0.0000 -C 1619.591069 0 0.1468 844 | 1/12 33 h-m-p 0.1330 8.0000 0.0000 -------Y 1619.591069 0 0.0000 877 Out.. lnL = -1619.591069 878 lfun, 878 eigenQcodon, 8780 P(t) Time used: 0:03 Model 1: NearlyNeutral TREE # 1 (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 0.049627 0.084060 0.107247 0.079749 0.047419 0.008062 0.000000 0.003802 0.003831 0.007035 1.510113 0.877411 0.315445 ntime & nrate & np: 10 2 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.974221 np = 13 lnL0 = -1630.424267 Iterating by ming2 Initial: fx= 1630.424267 x= 0.04963 0.08406 0.10725 0.07975 0.04742 0.00806 0.00000 0.00380 0.00383 0.00703 1.51011 0.87741 0.31544 1 h-m-p 0.0000 0.0000 272.8647 ++ 1630.424034 m 0.0000 18 | 1/13 2 h-m-p 0.0000 0.0001 713.0303 +CYYYYC 1627.888327 5 0.0001 41 | 1/13 3 h-m-p 0.0000 0.0000 6366.5829 +YCYCCC 1625.253602 5 0.0000 66 | 1/13 4 h-m-p 0.0000 0.0000 6142.8383 CCC 1624.728115 2 0.0000 86 | 1/13 5 h-m-p 0.0000 0.0002 732.8534 +CYCCC 1621.128270 4 0.0001 111 | 1/13 6 h-m-p 0.0000 0.0002 621.1065 YCYCCC 1619.132020 5 0.0001 135 | 1/13 7 h-m-p 0.0003 0.0014 80.5834 CCCCC 1618.371009 4 0.0004 159 | 1/13 8 h-m-p 0.0009 0.0044 28.1319 CYC 1618.287799 2 0.0003 178 | 1/13 9 h-m-p 0.0022 0.0389 3.3513 YC 1618.271767 1 0.0013 195 | 1/13 10 h-m-p 0.0004 0.0215 10.9892 CC 1618.246199 1 0.0006 213 | 1/13 11 h-m-p 0.0006 0.0674 11.3609 ++CCCC 1617.579143 3 0.0127 237 | 1/13 12 h-m-p 0.0009 0.0045 169.6184 YCCCC 1615.884445 4 0.0022 260 | 1/13 13 h-m-p 0.1166 0.5829 1.6405 YCYCCC 1613.689666 5 0.3110 284 | 1/13 14 h-m-p 0.3443 1.7216 0.8896 YCCC 1612.920474 3 0.1802 305 | 1/13 15 h-m-p 0.8086 8.0000 0.1983 CYCC 1612.495748 3 1.0724 338 | 1/13 16 h-m-p 1.6000 8.0000 0.0931 YC 1612.378437 1 0.8695 367 | 1/13 17 h-m-p 1.6000 8.0000 0.0124 YC 1612.351097 1 0.9873 396 | 1/13 18 h-m-p 1.6000 8.0000 0.0033 CC 1612.346057 1 1.7724 426 | 1/13 19 h-m-p 0.7750 8.0000 0.0075 CC 1612.343777 1 1.0723 456 | 1/13 20 h-m-p 1.6000 8.0000 0.0037 C 1612.343362 0 1.5456 484 | 1/13 21 h-m-p 1.6000 8.0000 0.0006 Y 1612.343258 0 2.5894 512 | 1/13 22 h-m-p 1.6000 8.0000 0.0002 C 1612.343211 0 2.3575 540 | 1/13 23 h-m-p 1.6000 8.0000 0.0001 C 1612.343192 0 1.9498 568 | 1/13 24 h-m-p 0.8795 8.0000 0.0002 C 1612.343190 0 1.1355 596 | 1/13 25 h-m-p 1.6000 8.0000 0.0000 C 1612.343190 0 2.0992 624 | 1/13 26 h-m-p 1.6000 8.0000 0.0000 C 1612.343190 0 1.9784 652 | 1/13 27 h-m-p 1.6000 8.0000 0.0000 C 1612.343190 0 0.4778 680 | 1/13 28 h-m-p 0.7384 8.0000 0.0000 ---Y 1612.343190 0 0.0029 711 Out.. lnL = -1612.343190 712 lfun, 2136 eigenQcodon, 14240 P(t) Time used: 0:08 Model 2: PositiveSelection TREE # 1 (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 initial w for M2:NSpselection reset. 0.049586 0.084064 0.107250 0.079811 0.047444 0.008020 0.000000 0.003783 0.003789 0.007009 1.494368 1.591876 0.136540 0.318247 2.382499 ntime & nrate & np: 10 3 15 Bounds (np=15): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 6.826840 np = 15 lnL0 = -1643.363853 Iterating by ming2 Initial: fx= 1643.363853 x= 0.04959 0.08406 0.10725 0.07981 0.04744 0.00802 0.00000 0.00378 0.00379 0.00701 1.49437 1.59188 0.13654 0.31825 2.38250 1 h-m-p 0.0000 0.0000 259.5771 ++ 1643.363626 m 0.0000 20 | 1/15 2 h-m-p 0.0000 0.0001 224.8315 +CYCCC 1642.683343 4 0.0001 46 | 1/15 3 h-m-p 0.0000 0.0001 622.0992 YCYCCC 1641.354448 5 0.0001 72 | 1/15 4 h-m-p 0.0000 0.0002 175.3830 CYCCC 1640.960127 4 0.0001 97 | 1/15 5 h-m-p 0.0000 0.0001 638.6593 YCYCCC 1640.283183 5 0.0000 123 | 1/15 6 h-m-p 0.0000 0.0001 2143.9995 ++ 1630.640069 m 0.0001 141 | 2/15 7 h-m-p 0.0009 0.0043 44.8917 YCC 1630.506964 2 0.0004 162 | 2/15 8 h-m-p 0.0002 0.0200 87.3670 +YCCC 1629.649700 3 0.0013 186 | 2/15 9 h-m-p 0.0010 0.0050 105.4010 CCCCC 1628.441659 4 0.0015 212 | 2/15 10 h-m-p 0.0023 0.0234 68.6182 CCC 1627.498357 2 0.0020 234 | 1/15 11 h-m-p 0.0007 0.0075 211.5165 YCCCC 1626.637192 4 0.0004 259 | 1/15 12 h-m-p 0.0092 0.0880 10.0948 +YYYYC 1621.443712 4 0.0353 282 | 1/15 13 h-m-p 0.3055 1.6325 1.1675 CCCCC 1615.836196 4 0.5023 308 | 1/15 14 h-m-p 0.1590 0.7952 2.6303 CYCCCC 1613.773577 5 0.2304 335 | 1/15 15 h-m-p 0.3650 8.0000 1.6604 CCCC 1612.025153 3 0.3444 359 | 1/15 16 h-m-p 0.7238 7.3249 0.7900 CCC 1611.124560 2 0.9472 381 | 1/15 17 h-m-p 0.6984 3.4920 0.3262 YYYC 1610.521134 3 0.6493 416 | 1/15 18 h-m-p 0.5695 8.0000 0.3719 +YCC 1609.956676 2 1.4984 452 | 1/15 19 h-m-p 0.8276 8.0000 0.6733 CCC 1609.628714 2 1.0900 488 | 1/15 20 h-m-p 1.6000 8.0000 0.2249 YCC 1609.395323 2 2.7590 523 | 1/15 21 h-m-p 1.6000 8.0000 0.2996 CYC 1609.328348 2 1.8319 558 | 1/15 22 h-m-p 1.6000 8.0000 0.1303 CC 1609.313662 1 1.7448 592 | 1/15 23 h-m-p 1.6000 8.0000 0.1411 CC 1609.304505 1 1.8425 626 | 1/15 24 h-m-p 1.6000 8.0000 0.0888 CC 1609.298860 1 2.0113 660 | 1/15 25 h-m-p 1.6000 8.0000 0.0557 YC 1609.290860 1 2.9264 693 | 1/15 26 h-m-p 1.0000 8.0000 0.1631 +YC 1609.265420 1 4.9811 727 | 1/15 27 h-m-p 1.6000 8.0000 0.1898 YC 1609.247706 1 2.5990 760 | 1/15 28 h-m-p 1.3225 8.0000 0.3731 YC 1609.237229 1 2.6691 793 | 1/15 29 h-m-p 1.6000 8.0000 0.2930 CC 1609.233316 1 1.9927 827 | 1/15 30 h-m-p 1.6000 8.0000 0.2943 YC 1609.231614 1 3.1149 860 | 1/15 31 h-m-p 1.6000 8.0000 0.2556 YC 1609.230568 1 2.7325 893 | 1/15 32 h-m-p 1.6000 8.0000 0.3251 CC 1609.230161 1 2.1353 927 | 1/15 33 h-m-p 1.6000 8.0000 0.2482 YC 1609.229956 1 3.3318 960 | 1/15 34 h-m-p 1.6000 8.0000 0.3350 C 1609.229842 0 2.2022 992 | 1/15 35 h-m-p 1.6000 8.0000 0.2604 Y 1609.229809 0 2.6972 1024 | 1/15 36 h-m-p 1.6000 8.0000 0.3080 Y 1609.229783 0 2.9326 1056 | 1/15 37 h-m-p 1.6000 8.0000 0.3256 C 1609.229775 0 2.1412 1088 | 1/15 38 h-m-p 1.6000 8.0000 0.3115 Y 1609.229770 0 3.0162 1120 | 1/15 39 h-m-p 1.6000 8.0000 0.3463 C 1609.229768 0 2.1180 1152 | 1/15 40 h-m-p 1.6000 8.0000 0.2952 Y 1609.229768 0 2.8643 1184 | 1/15 41 h-m-p 1.6000 8.0000 0.3240 Y 1609.229767 0 2.9871 1216 | 1/15 42 h-m-p 1.6000 8.0000 0.3285 C 1609.229767 0 2.0640 1248 | 1/15 43 h-m-p 1.6000 8.0000 0.3031 Y 1609.229767 0 3.3469 1280 | 1/15 44 h-m-p 1.6000 8.0000 0.3007 C 1609.229767 0 1.9649 1312 | 1/15 45 h-m-p 1.6000 8.0000 0.3633 Y 1609.229767 0 3.4172 1344 | 1/15 46 h-m-p 1.6000 8.0000 0.3007 +Y 1609.229767 0 4.0578 1377 | 1/15 47 h-m-p 1.6000 8.0000 0.0010 C 1609.229767 0 0.6212 1409 | 1/15 48 h-m-p 0.0160 8.0000 0.1020 Y 1609.229767 0 0.0160 1441 | 1/15 49 h-m-p 0.0160 8.0000 4.4247 ------C 1609.229767 0 0.0000 1479 | 1/15 50 h-m-p 0.0160 8.0000 0.0784 --C 1609.229767 0 0.0004 1499 | 1/15 51 h-m-p 0.0160 8.0000 0.0026 -------------.. | 1/15 52 h-m-p 0.0160 8.0000 0.0039 ------------Y 1609.229767 0 0.0000 1586 | 1/15 53 h-m-p 0.0054 2.7012 0.0980 ------------.. | 1/15 54 h-m-p 0.0160 8.0000 0.0039 ----------C 1609.229767 0 0.0000 1670 | 1/15 55 h-m-p 0.0160 8.0000 0.0015 -------------.. | 1/15 56 h-m-p 0.0160 8.0000 0.0039 ------------- | 1/15 57 h-m-p 0.0160 8.0000 0.0039 ------------- Out.. lnL = -1609.229767 1800 lfun, 7200 eigenQcodon, 54000 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -1619.075286 S = -1538.448974 -73.055856 Calculating f(w|X), posterior probabilities of site classes. did 10 / 129 patterns 0:27 did 20 / 129 patterns 0:27 did 30 / 129 patterns 0:27 did 40 / 129 patterns 0:27 did 50 / 129 patterns 0:27 did 60 / 129 patterns 0:27 did 70 / 129 patterns 0:27 did 80 / 129 patterns 0:27 did 90 / 129 patterns 0:27 did 100 / 129 patterns 0:27 did 110 / 129 patterns 0:27 did 120 / 129 patterns 0:27 did 129 / 129 patterns 0:27 Time used: 0:27 Model 3: discrete TREE # 1 (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 0.049696 0.084116 0.107312 0.079641 0.047369 0.008070 0.000000 0.003901 0.003860 0.007189 1.541542 0.465673 0.549129 0.067804 0.150911 0.281925 ntime & nrate & np: 10 4 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 15.459136 np = 16 lnL0 = -1618.378341 Iterating by ming2 Initial: fx= 1618.378341 x= 0.04970 0.08412 0.10731 0.07964 0.04737 0.00807 0.00000 0.00390 0.00386 0.00719 1.54154 0.46567 0.54913 0.06780 0.15091 0.28193 1 h-m-p 0.0000 0.0000 151.6394 ++ 1618.378116 m 0.0000 37 | 1/16 2 h-m-p 0.0000 0.0003 188.1242 +YCCC 1617.945005 3 0.0001 78 | 1/16 3 h-m-p 0.0000 0.0002 102.9655 YC 1617.877767 1 0.0000 113 | 1/16 4 h-m-p 0.0000 0.0003 96.5268 CCC 1617.781578 2 0.0001 151 | 1/16 5 h-m-p 0.0000 0.0005 147.6134 +YCC 1617.514449 2 0.0001 189 | 1/16 6 h-m-p 0.0000 0.0001 393.9532 CCCC 1617.220967 3 0.0001 229 | 1/16 7 h-m-p 0.0001 0.0003 121.8885 ++ 1616.578986 m 0.0003 263 | 2/16 8 h-m-p 0.0003 0.0023 75.0074 YCCC 1616.054899 3 0.0007 302 | 2/16 9 h-m-p 0.0004 0.0018 96.8832 YCCC 1615.442008 3 0.0007 340 | 2/16 10 h-m-p 0.0005 0.0024 85.4320 +YCCC 1614.506107 3 0.0016 379 | 2/16 11 h-m-p 0.0009 0.0045 28.8570 YCCC 1614.419161 3 0.0005 417 | 2/16 12 h-m-p 0.0198 4.5469 0.7314 +CYC 1614.364020 2 0.0620 454 | 1/16 13 h-m-p 0.0016 0.0082 9.9201 +CCC 1614.288320 2 0.0055 492 | 1/16 14 h-m-p 0.0197 0.2159 2.7725 ++ 1613.885814 m 0.2159 526 | 2/16 15 h-m-p 1.6000 8.0000 0.1752 YCC 1613.671595 2 0.9984 563 | 1/16 16 h-m-p 0.0013 0.0265 129.8483 -CC 1613.670715 1 0.0001 599 | 1/16 17 h-m-p 0.0160 8.0000 0.8160 ++YCC 1613.597030 2 0.1852 638 | 1/16 18 h-m-p 0.2151 8.0000 0.7026 +CCC 1613.361727 2 1.0869 677 | 1/16 19 h-m-p 1.3752 8.0000 0.5554 YCCC 1612.648943 3 2.9848 716 | 1/16 20 h-m-p 0.5731 2.8656 0.7009 CCC 1612.546795 2 0.2163 754 | 1/16 21 h-m-p 0.2647 4.8144 0.5729 +YYCCCC 1611.829830 5 1.1035 797 | 1/16 22 h-m-p 1.0785 5.3923 0.2866 CYCCCC 1611.234936 5 1.7220 840 | 1/16 23 h-m-p 0.2557 8.0000 1.9300 CYC 1611.005563 2 0.2970 877 | 1/16 24 h-m-p 0.9517 4.7583 0.1902 CCCC 1610.663882 3 1.5735 917 | 1/16 25 h-m-p 1.1664 8.0000 0.2566 YCCC 1610.227649 3 1.9975 956 | 1/16 26 h-m-p 0.8175 8.0000 0.6270 YC 1609.749502 1 1.8249 991 | 1/16 27 h-m-p 1.2406 6.2031 0.4697 CCCC 1609.394563 3 1.3146 1031 | 1/16 28 h-m-p 1.3220 8.0000 0.4670 YCC 1609.311003 2 0.7679 1068 | 1/16 29 h-m-p 1.0845 7.2113 0.3307 YYC 1609.273231 2 0.9176 1104 | 1/16 30 h-m-p 1.6000 8.0000 0.1160 YC 1609.262379 1 1.0534 1139 | 1/16 31 h-m-p 1.6000 8.0000 0.0198 C 1609.261395 0 1.5616 1173 | 1/16 32 h-m-p 1.6000 8.0000 0.0029 ++ 1609.259859 m 8.0000 1207 | 1/16 33 h-m-p 0.7563 8.0000 0.0309 ++ 1609.252047 m 8.0000 1241 | 1/16 34 h-m-p 1.6000 8.0000 0.0292 YC 1609.237890 1 3.0505 1276 | 1/16 35 h-m-p 0.9166 8.0000 0.0973 CCC 1609.232641 2 1.3410 1314 | 1/16 36 h-m-p 1.6000 8.0000 0.0478 CC 1609.230414 1 1.5700 1350 | 1/16 37 h-m-p 1.6000 8.0000 0.0262 C 1609.229928 0 1.6000 1384 | 1/16 38 h-m-p 1.6000 8.0000 0.0076 YC 1609.229784 1 1.1901 1419 | 1/16 39 h-m-p 1.5815 8.0000 0.0057 Y 1609.229767 0 1.1826 1453 | 1/16 40 h-m-p 1.6000 8.0000 0.0008 Y 1609.229767 0 1.1037 1487 | 1/16 41 h-m-p 1.6000 8.0000 0.0001 Y 1609.229767 0 0.9235 1521 | 1/16 42 h-m-p 0.9371 8.0000 0.0001 C 1609.229767 0 1.0591 1555 | 1/16 43 h-m-p 1.6000 8.0000 0.0000 Y 1609.229767 0 3.8737 1589 | 1/16 44 h-m-p 1.3961 8.0000 0.0001 --Y 1609.229767 0 0.0218 1625 | 1/16 45 h-m-p 0.0206 8.0000 0.0001 Y 1609.229767 0 0.0206 1659 | 1/16 46 h-m-p 0.0221 8.0000 0.0001 --------C 1609.229767 0 0.0000 1701 Out.. lnL = -1609.229767 1702 lfun, 6808 eigenQcodon, 51060 P(t) Time used: 0:45 Model 7: beta TREE # 1 (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 0.049894 0.084170 0.107295 0.079595 0.047335 0.008236 0.000000 0.003844 0.003817 0.007355 1.541544 0.702842 1.818396 ntime & nrate & np: 10 1 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 12.019217 np = 13 lnL0 = -1621.540511 Iterating by ming2 Initial: fx= 1621.540511 x= 0.04989 0.08417 0.10730 0.07959 0.04733 0.00824 0.00000 0.00384 0.00382 0.00736 1.54154 0.70284 1.81840 1 h-m-p 0.0000 0.0000 148.8694 ++ 1621.540289 m 0.0000 31 | 1/13 2 h-m-p 0.0000 0.0001 198.8735 +YYYCCCC 1621.315467 6 0.0000 70 | 1/13 3 h-m-p 0.0000 0.0001 250.7213 CCCC 1621.148486 3 0.0000 104 | 1/13 4 h-m-p 0.0001 0.0003 61.4012 YC 1621.120438 1 0.0000 133 | 1/13 5 h-m-p 0.0000 0.0005 104.6630 +CYC 1621.014772 2 0.0001 165 | 1/13 6 h-m-p 0.0001 0.0007 132.9333 +YCCC 1620.741429 3 0.0002 199 | 1/13 7 h-m-p 0.0003 0.0084 84.7041 ++YYCCC 1617.355014 4 0.0034 235 | 1/13 8 h-m-p 0.0002 0.0009 440.3413 CYCCCC 1615.862858 5 0.0003 272 | 1/13 9 h-m-p 0.0016 0.0080 20.2787 CCC 1615.799931 2 0.0005 304 | 1/13 10 h-m-p 0.0044 1.1926 2.1927 +++YCC 1614.926977 2 0.2034 338 | 1/13 11 h-m-p 0.0019 0.0095 44.7086 CYC 1614.890420 2 0.0004 369 | 1/13 12 h-m-p 0.0205 1.7790 0.9043 +YCCC 1614.771787 3 0.1668 403 | 1/13 13 h-m-p 0.3906 4.5628 0.3862 YCCC 1614.464108 3 0.9629 436 | 1/13 14 h-m-p 0.9621 5.3346 0.3866 +YYYCCC 1613.698921 5 3.5392 472 | 1/13 15 h-m-p 0.0399 0.1997 3.4614 YCYCCCC 1613.584808 6 0.0581 510 | 1/13 16 h-m-p 0.7895 7.3358 0.2549 CYC 1613.365263 2 0.9299 541 | 1/13 17 h-m-p 0.3859 1.9295 0.3783 CCCC 1613.256495 3 0.4489 575 | 1/13 18 h-m-p 1.6000 8.0000 0.0152 YC 1613.243937 1 0.8791 604 | 1/13 19 h-m-p 0.9046 8.0000 0.0148 CC 1613.242566 1 0.7784 634 | 1/13 20 h-m-p 1.6000 8.0000 0.0068 YC 1613.242372 1 0.9563 663 | 1/13 21 h-m-p 1.6000 8.0000 0.0015 Y 1613.242352 0 0.9090 691 | 1/13 22 h-m-p 1.6000 8.0000 0.0002 Y 1613.242351 0 0.8665 719 | 1/13 23 h-m-p 1.6000 8.0000 0.0001 Y 1613.242351 0 0.9548 747 | 1/13 24 h-m-p 1.6000 8.0000 0.0000 C 1613.242351 0 1.8487 775 | 1/13 25 h-m-p 1.6000 8.0000 0.0000 C 1613.242351 0 0.3617 803 | 1/13 26 h-m-p 0.5477 8.0000 0.0000 ---------------C 1613.242351 0 0.0000 846 Out.. lnL = -1613.242351 847 lfun, 9317 eigenQcodon, 84700 P(t) Time used: 1:13 Model 8: beta&w>1 TREE # 1 (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 initial w for M8:NSbetaw>1 reset. 0.049633 0.084080 0.107252 0.079770 0.047432 0.008053 0.000000 0.003840 0.003820 0.007031 1.511833 0.900000 1.017304 1.339697 2.499728 ntime & nrate & np: 10 2 15 Bounds (np=15): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 7.403730 np = 15 lnL0 = -1638.715371 Iterating by ming2 Initial: fx= 1638.715371 x= 0.04963 0.08408 0.10725 0.07977 0.04743 0.00805 0.00000 0.00384 0.00382 0.00703 1.51183 0.90000 1.01730 1.33970 2.49973 1 h-m-p 0.0000 0.0000 184.3329 ++ 1638.715073 m 0.0000 35 | 1/15 2 h-m-p 0.0000 0.0001 513.8962 +YCYCCC 1636.809419 5 0.0001 78 | 1/15 3 h-m-p 0.0000 0.0000 1758.2402 +YCYCCC 1634.068307 5 0.0000 119 | 1/15 4 h-m-p 0.0000 0.0000 1076.6930 CCC 1633.795974 2 0.0000 155 | 1/15 5 h-m-p 0.0000 0.0001 299.0529 YCYCCC 1633.172193 5 0.0000 195 | 1/15 6 h-m-p 0.0000 0.0001 480.4861 +CCCC 1632.103442 3 0.0000 234 | 1/15 7 h-m-p 0.0009 0.0088 24.7631 YCCC 1631.457993 3 0.0021 271 | 1/15 8 h-m-p 0.0003 0.0067 175.0586 ++YYYYYCC 1617.663124 6 0.0047 312 | 1/15 9 h-m-p 0.0001 0.0005 679.2103 CCCCC 1616.589850 4 0.0001 352 | 1/15 10 h-m-p 0.0019 0.0094 11.2796 YCC 1616.538794 2 0.0008 387 | 1/15 11 h-m-p 0.0003 0.0437 32.3539 ++YCCC 1614.907627 3 0.0106 426 | 1/15 12 h-m-p 0.0014 0.0069 123.7926 CYC 1614.261547 2 0.0012 461 | 1/15 13 h-m-p 0.0938 1.3491 1.5451 +YYYC 1612.561206 3 0.3431 497 | 1/15 14 h-m-p 0.3103 1.5515 1.2462 YCC 1611.594017 2 0.2336 532 | 1/15 15 h-m-p 0.4474 4.4963 0.6506 YCCC 1610.812847 3 0.9577 569 | 1/15 16 h-m-p 0.7417 8.0000 0.8400 CYC 1610.616102 2 0.6459 604 | 1/15 17 h-m-p 0.9362 4.6810 0.4671 CYCCC 1610.195366 4 1.8608 643 | 1/15 18 h-m-p 1.6000 8.0000 0.4948 CCC 1609.944268 2 2.1177 679 | 1/15 19 h-m-p 1.6000 8.0000 0.3277 CCC 1609.857159 2 1.4717 715 | 1/15 20 h-m-p 1.6000 8.0000 0.2867 CYC 1609.830310 2 1.4715 750 | 1/15 21 h-m-p 1.6000 8.0000 0.1906 CC 1609.821829 1 0.4640 784 | 1/15 22 h-m-p 0.8956 8.0000 0.0988 +YC 1609.809019 1 2.7708 818 | 1/15 23 h-m-p 1.6000 8.0000 0.0684 ++ 1609.755691 m 8.0000 850 | 1/15 24 h-m-p 0.7510 8.0000 0.7285 +YCC 1609.671906 2 2.4991 886 | 1/15 25 h-m-p 1.6000 8.0000 0.6343 YCCC 1609.555644 3 3.3296 923 | 1/15 26 h-m-p 1.6000 8.0000 1.1141 CCC 1609.477116 2 2.2979 959 | 1/15 27 h-m-p 1.6000 8.0000 1.3819 YC 1609.401113 1 3.9465 992 | 1/15 28 h-m-p 1.6000 8.0000 1.9169 YC 1609.353086 1 3.0260 1025 | 1/15 29 h-m-p 1.6000 8.0000 2.8533 YCC 1609.325563 2 2.5538 1060 | 1/15 30 h-m-p 1.6000 8.0000 3.2763 YC 1609.309912 1 2.6506 1093 | 1/15 31 h-m-p 1.6000 8.0000 3.9527 +YC 1609.289897 1 4.4087 1127 | 1/15 32 h-m-p 1.1192 5.5960 8.0731 YC 1609.273236 1 2.6463 1160 | 1/15 33 h-m-p 0.5498 2.7492 8.6620 ++ 1609.264814 m 2.7492 1192 | 2/15 34 h-m-p 0.6066 8.0000 4.3676 ----------------.. | 2/15 35 h-m-p 0.0000 0.0008 10.7469 YC 1609.263688 1 0.0000 1270 | 2/15 36 h-m-p 0.0001 0.0039 3.0305 YC 1609.263532 1 0.0000 1302 | 2/15 37 h-m-p 0.0034 1.7232 0.9136 --C 1609.263501 0 0.0001 1335 | 2/15 38 h-m-p 0.0000 0.0099 1.7068 C 1609.263475 0 0.0000 1366 | 2/15 39 h-m-p 0.0001 0.0660 1.7151 Y 1609.263428 0 0.0001 1397 | 2/15 40 h-m-p 0.0008 0.2590 0.2227 -C 1609.263427 0 0.0001 1429 | 2/15 41 h-m-p 0.0011 0.5645 0.2238 C 1609.263422 0 0.0003 1460 | 2/15 42 h-m-p 0.0115 5.7604 0.0939 -Y 1609.263418 0 0.0013 1492 | 2/15 43 h-m-p 0.0033 1.6688 0.1622 Y 1609.263410 0 0.0018 1523 | 2/15 44 h-m-p 0.0053 2.6394 0.7073 C 1609.263306 0 0.0056 1554 | 2/15 45 h-m-p 0.0022 1.1200 4.8224 C 1609.263046 0 0.0021 1585 | 2/15 46 h-m-p 0.1023 8.0000 0.0973 ++YC 1609.255272 1 3.8837 1619 | 2/15 47 h-m-p 1.6000 8.0000 0.0146 +C 1609.254731 0 6.1182 1651 | 2/15 48 h-m-p 1.6000 8.0000 0.0138 Y 1609.254657 0 1.1596 1682 | 2/15 49 h-m-p 1.6000 8.0000 0.0007 Y 1609.254657 0 1.0246 1713 | 2/15 50 h-m-p 1.6000 8.0000 0.0000 Y 1609.254657 0 0.7955 1744 | 2/15 51 h-m-p 1.6000 8.0000 0.0000 --C 1609.254657 0 0.0250 1777 Out.. lnL = -1609.254657 1778 lfun, 21336 eigenQcodon, 195580 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -1618.037759 S = -1538.472894 -72.900657 Calculating f(w|X), posterior probabilities of site classes. did 10 / 129 patterns 2:21 did 20 / 129 patterns 2:21 did 30 / 129 patterns 2:21 did 40 / 129 patterns 2:21 did 50 / 129 patterns 2:21 did 60 / 129 patterns 2:22 did 70 / 129 patterns 2:22 did 80 / 129 patterns 2:22 did 90 / 129 patterns 2:22 did 100 / 129 patterns 2:22 did 110 / 129 patterns 2:23 did 120 / 129 patterns 2:23 did 129 / 129 patterns 2:23 Time used: 2:23 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 D_melanogaster_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR D_sechellia_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR D_sechellia_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR D_sechellia_CG40498-PF MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR D_simulans_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR D_yakuba_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR D_erecta_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR ****.******************************************:** D_melanogaster_CG40498-PF KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET D_sechellia_CG40498-PF KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET D_sechellia_CG40498-PF KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET D_sechellia_CG40498-PF KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET D_simulans_CG40498-PF KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET D_yakuba_CG40498-PF KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET D_erecta_CG40498-PF KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET ******:.**.*.************************************* D_melanogaster_CG40498-PF MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ D_sechellia_CG40498-PF MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ D_sechellia_CG40498-PF MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ D_sechellia_CG40498-PF MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ D_simulans_CG40498-PF MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ D_yakuba_CG40498-PF MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ D_erecta_CG40498-PF MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ ***::**************************:****************** D_melanogaster_CG40498-PF RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG D_sechellia_CG40498-PF RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG D_sechellia_CG40498-PF RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG D_sechellia_CG40498-PF RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG D_simulans_CG40498-PF RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG D_yakuba_CG40498-PF RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG D_erecta_CG40498-PF RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS ***************:********************* **********. D_melanogaster_CG40498-PF SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK D_sechellia_CG40498-PF SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK D_sechellia_CG40498-PF SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK D_sechellia_CG40498-PF SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK D_simulans_CG40498-PF SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK D_yakuba_CG40498-PF SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK D_erecta_CG40498-PF SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK *:***.**.** ******:**:********.:*****.******:***** D_melanogaster_CG40498-PF KLLLRRESLNDAISITRI D_sechellia_CG40498-PF KQLLRRESLSDAISITRI D_sechellia_CG40498-PF KQLLRREFLSDAISITRI D_sechellia_CG40498-PF KQLLRRESLSDAISITRI D_simulans_CG40498-PF KQLLRRESLSDAISITRI D_yakuba_CG40498-PF KQLLRRESTNDAINITRI D_erecta_CG40498-PF KLLLRRESINDAINITRI * ***** .***.****
>D_melanogaster_CG40498-PF ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGCTATAGCACGCAAA GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATACCACCATCCTCGTAATGCAGTTAGTTCTGGCACCGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGTGCTGGTATTATTCCAGACGAAACT ATGTCATGGAACGTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTTAC TTGCACAGGTTTATTTTCTCTGGGATTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGCCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCTCGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTTGTAAATTGCGGC TCTTCAGAGAATATGAGCAATGGAACGATAGTCAGCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT TAAACGACCGCAGCTCCGGAATATCTCCAATTGATTTAGAAAATGATAAG AAACTGCTTTTAAGAAGAGAATCTCTAAATGACGCAATCAGTATAACACG TATT >D_sechellia_CG40498-PF ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG TATT >D_sechellia_CG40498-PF ATGCATTCAGTTGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG AAACAGCTCTTAAGAAGAGAATTTCTAAGTGACGCAATCAGTATAACGCG TATT >D_sechellia_CG40498-PF ATGCATTCAGTTAGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTATTAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATACTTATT TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG TATT >D_simulans_CG40498-PF ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAAAAAAGGGCGCGAGAAAGACGTTATAGCACGCAAA GTTCTGAAAGCGGGGAAACATTTCATTCTCCAACAGGATCCGTGAGGCGA AAATATCACCATCCTCGTCATGCAGTTAGTTCTGGCCCGGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAAGTTATTTAGCTCAAGCTCAGCCTGGTGGAATGAAGTAAC TTGCACAGGATTATTTTCTCTTGGATTGGGACTGTTTTTACTAGTTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTCGATCTCGCTCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCACGCAAAGCTGTTGCCTTACAAA AGGGCGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCGGC TCTTCAGAGAATATGTGCAATGGACCGATAGTCGTCCATAATGTTTTAAA CAGTTCTGATGCTATCCTTGAAAAAATTGTGGAGGAGGATAATGCTTATT TAAACGACCGCAGCTCCGGAATATCTCCGATTGATTTAGAAAATGATAAG AAACAGCTCTTAAGAAGAGAATCTCTAAGTGACGCAATCAGTATAACGCG TATT >D_yakuba_CG40498-PF ATGCATTCCGTGGGCATTCATTCGGCAATGGCGATCAAAAGGCAACGGAA ACGTCGAGATGAACAGAAAAGGGCTCGAGAAAGACGTTATAGCACGCAAA GTTCTGAGAGCGGAGAAACATTTCATTCTCCAACAGGATCCCTGAGACGA AAATATCACCATCCTCGTCATCCAGTTAGTCCCGGCCCCGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAACGTATTTAGCTCAAGCTCTGCCTGGTGGAATGAAGTTAC ATGCACAGGCTTATTTTCTCTTGGACTGGGACTGTTTTTACTTATTTTAA ACTGTCTTATAAGTCGAAAAGAGGAGGAGGATCTTGAAGACTATGTGCAA CGTCAACTAACTAGATCTCGATCTGGACACCGACTTGAAAGAGATATTGA AACTGGTGTTTTGACAACGCGACATGCTCGAAAAGCTGTTGCTTTACAAA AGGGCGGACGTAATATATCTCCTACAGATGTTTCCGTCGTAAATTGTGGC TCTGCAGAAAATATGTGCAATGGACCGATAGTTAACCATAATGTTTTAAA CAGCACTGATGCAATCCTCGAAAAAATTGTGGAGGAAGATACAACTTATT TAAACGACCGTAACTCTGGAATATCTCCGATTGAATTAGAAAATGATAAG AAGCAATTATTAAGAAGAGAATCTACGAATGACGCAATCAATATTACACG TATT >D_erecta_CG40498-PF ATGCATTCAGTGGGCATTCATTCCGCAATGGCGATCAAAAGGCAACGGAA ACGTCGTGATGAACAAAAAAGGGCTCGGGAAAGACGCTATAGCACGCAAA GTTCTGAGAGCGGCGAAACATTTCATTCTCCAACAGGATCTGTGAGACGA AAATATCACCACCCTCGGCATGCAGTTAGTCCCGGCACCGGAATGCTTGA CAGCCAGGTAGTTACTAGTATTGGCATGTTGCATATAGGTATTGTATTCG TTGTGTTTGGAGTTTTTCTTTGCGGCGCTGGTATTATTCCAGACGAAACT ATGTCATGGAACGTATTTAGCTCAAGCTCAGCATGGTGGAATGAAGTTAC TTGCACAGGATTATTTTCCCTTGGACTGGGACTGTTTTTACTAATTTTAA ACTGTCTTATAAGTCGAAAGGAGGAGGAGGATCTTGAAGACTATGTACAA CGTCAACTAACTCGATCTCGATCTGGACACCGACTTGAAAGAGATGTTGA AACTGGTGTTTTGACAACGCGCCATGCTCGAAAAGCGGTTGCTTTACAAA AGGGTGGACGTAATAACTCTCCTACAGATGTTTCCGTCGTAAATTGCAGT TCTGCTGAAAATATGTGCAATGGACCGATAGTTGGCCATAATGTCTTAAA CAGCTCTGATGCTTTCCTCGAAAAAATTGTGGAGGAAGATACTACTTATT TAAACGACCGTAGCTCTGGAATATCTCCGATTGATTTAGAAAATGATAAG AAGCTGTTATTAAGAAGAGAATCTATAAATGACGCAATCAATATAACACG TATT
>D_melanogaster_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRNAVSSGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KLLLRRESLNDAISITRI >D_sechellia_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >D_sechellia_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRREFLSDAISITRI >D_sechellia_CG40498-PF MHSVSIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRINSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNTYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >D_simulans_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSSGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWKLFSSSSAWWNEVTCTGLFSLGLGLFLLVLNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCG SSENMCNGPIVVHNVLNSSDAILEKIVEEDNAYLNDRSSGISPIDLENDK KQLLRRESLSDAISITRI >D_yakuba_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSLRR KYHHPRHPVSPGPGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDIETGVLTTRHARKAVALQKGGRNISPTDVSVVNCG SAENMCNGPIVNHNVLNSTDAILEKIVEEDTTYLNDRNSGISPIELENDK KQLLRRESTNDAINITRI >D_erecta_CG40498-PF MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRR KYHHPRHAVSPGTGMLDSQVVTSIGMLHIGIVFVVFGVFLCGAGIIPDET MSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQ RQLTRSRSGHRLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCS SAENMCNGPIVGHNVLNSSDAFLEKIVEEDTTYLNDRSSGISPIDLENDK KLLLRRESINDAINITRI
#NEXUS [ID: 2045496021] begin taxa; dimensions ntax=7; taxlabels D_melanogaster_CG40498-PF D_sechellia_CG40498-PF D_sechellia_CG40498-PF D_sechellia_CG40498-PF D_simulans_CG40498-PF D_yakuba_CG40498-PF D_erecta_CG40498-PF ; end; begin trees; translate 1 D_melanogaster_CG40498-PF, 2 D_sechellia_CG40498-PF, 3 D_sechellia_CG40498-PF, 4 D_sechellia_CG40498-PF, 5 D_simulans_CG40498-PF, 6 D_yakuba_CG40498-PF, 7 D_erecta_CG40498-PF ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.0206419,(6:0.05279978,7:0.03087142)1.000:0.0399089,((2:9.859612E-4,3:0.002504129,4:0.002460313)0.991:0.00414607,5:0.003633705)1.000:0.02307541); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.0206419,(6:0.05279978,7:0.03087142):0.0399089,((2:9.859612E-4,3:0.002504129,4:0.002460313):0.00414607,5:0.003633705):0.02307541); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1673.23 -1688.92 2 -1673.37 -1685.58 -------------------------------------- TOTAL -1673.30 -1688.26 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/138/CG40498-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.190660 0.000783 0.140924 0.247460 0.188393 1413.45 1421.44 1.000 r(A<->C){all} 0.162236 0.002012 0.079987 0.252656 0.159264 792.69 852.70 1.000 r(A<->G){all} 0.219248 0.002299 0.123586 0.311306 0.216976 810.27 921.38 1.000 r(A<->T){all} 0.141515 0.001241 0.078625 0.210845 0.138640 980.96 1054.29 1.000 r(C<->G){all} 0.080594 0.001234 0.020637 0.151444 0.075934 709.48 758.09 1.000 r(C<->T){all} 0.321923 0.003292 0.211766 0.437870 0.320041 772.99 821.89 1.000 r(G<->T){all} 0.074484 0.000793 0.022586 0.128365 0.071487 840.37 973.50 1.000 pi(A){all} 0.303661 0.000243 0.272296 0.332785 0.303464 1135.61 1234.40 1.000 pi(C){all} 0.186293 0.000174 0.161011 0.212818 0.185683 1025.79 1102.18 1.000 pi(G){all} 0.231001 0.000210 0.202854 0.258815 0.230795 1369.51 1431.44 1.000 pi(T){all} 0.279045 0.000235 0.249413 0.308227 0.278883 964.48 1118.27 1.000 alpha{1,2} 0.080343 0.004599 0.000122 0.205071 0.065455 1436.12 1468.56 1.000 alpha{3} 1.664866 0.562131 0.440022 3.171361 1.519917 1357.56 1429.28 1.000 pinvar{all} 0.312698 0.019010 0.023165 0.540322 0.324277 1044.58 1171.10 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/138/CG40498-PF/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 7 ls = 268 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 6 6 7 6 6 6 | Ser TCT 11 11 10 11 11 11 | Tyr TAT 3 4 4 4 4 4 | Cys TGT 1 1 1 1 1 2 TTC 1 1 1 1 1 1 | TCC 4 4 4 4 4 3 | TAC 1 0 0 0 0 0 | TGC 3 4 4 4 4 3 Leu TTA 8 9 9 9 9 9 | TCA 5 5 5 5 5 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 3 3 3 3 3 2 | TCG 0 0 0 0 0 1 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 7 7 7 7 7 7 | Pro CCT 2 2 2 2 2 2 | His CAT 7 8 8 8 8 8 | Arg CGT 5 6 6 6 6 7 CTC 0 1 1 1 1 1 | CCC 0 0 0 0 0 2 | CAC 2 2 2 2 2 2 | CGC 5 4 4 4 4 0 CTA 3 3 3 3 3 1 | CCA 3 2 2 2 2 3 | Gln CAA 6 6 6 6 6 6 | CGA 6 6 6 6 6 8 CTG 3 1 1 1 1 3 | CCG 0 3 3 3 3 2 | CAG 1 2 2 2 2 2 | CGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 9 10 10 10 8 11 | Thr ACT 6 6 6 6 5 6 | Asn AAT 10 7 7 7 8 9 | Ser AGT 5 7 7 7 7 4 ATC 3 3 3 3 3 3 | ACC 1 0 0 0 0 0 | AAC 5 4 4 4 4 6 | AGC 9 6 6 7 6 6 ATA 5 5 5 5 5 5 | ACA 6 5 5 5 5 8 | Lys AAA 8 8 8 8 8 7 | Arg AGA 4 4 4 4 4 6 Met ATG 6 6 6 6 6 6 | ACG 3 3 3 3 3 3 | AAG 2 3 3 3 3 3 | AGG 3 3 3 3 3 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 11 10 10 10 10 10 | Ala GCT 4 3 3 3 4 5 | Asp GAT 8 8 8 8 8 7 | Gly GGT 5 3 3 3 3 3 GTC 1 3 3 3 3 1 | GCC 2 2 2 2 2 1 | GAC 5 5 5 5 5 5 | GGC 6 6 6 5 6 7 GTA 4 4 4 4 4 4 | GCA 3 4 4 4 4 4 | Glu GAA 11 12 12 12 12 14 | GGA 9 10 10 10 10 10 GTG 5 4 4 4 5 4 | GCG 2 2 2 2 2 1 | GAG 7 6 6 6 6 5 | GGG 0 1 1 1 1 0 -------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------ Phe TTT 6 | Ser TCT 11 | Tyr TAT 4 | Cys TGT 1 TTC 2 | TCC 3 | TAC 0 | TGC 4 Leu TTA 9 | TCA 4 | *** TAA 0 | *** TGA 0 TTG 2 | TCG 0 | TAG 0 | Trp TGG 3 ------------------------------------------------------ Leu CTT 6 | Pro CCT 2 | His CAT 7 | Arg CGT 6 CTC 1 | CCC 1 | CAC 3 | CGC 2 CTA 2 | CCA 2 | Gln CAA 6 | CGA 6 CTG 3 | CCG 2 | CAG 1 | CGG 3 ------------------------------------------------------ Ile ATT 9 | Thr ACT 7 | Asn AAT 9 | Ser AGT 5 ATC 2 | ACC 1 | AAC 5 | AGC 7 ATA 6 | ACA 6 | Lys AAA 6 | Arg AGA 5 Met ATG 6 | ACG 2 | AAG 4 | AGG 2 ------------------------------------------------------ Val GTT 10 | Ala GCT 6 | Asp GAT 8 | Gly GGT 4 GTC 2 | GCC 0 | GAC 5 | GGC 6 GTA 5 | GCA 4 | Glu GAA 13 | GGA 10 GTG 4 | GCG 2 | GAG 5 | GGG 0 ------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_CG40498-PF position 1: T:0.18284 C:0.19030 A:0.31716 G:0.30970 position 2: T:0.27985 C:0.19403 A:0.28358 G:0.24254 position 3: T:0.37313 C:0.17910 A:0.30224 G:0.14552 Average T:0.27861 C:0.18781 A:0.30100 G:0.23259 #2: D_sechellia_CG40498-PF position 1: T:0.19030 C:0.20149 A:0.29851 G:0.30970 position 2: T:0.28358 C:0.19403 A:0.27985 G:0.24254 position 3: T:0.36940 C:0.16791 A:0.30970 G:0.15299 Average T:0.28109 C:0.18781 A:0.29602 G:0.23507 #3: D_sechellia_CG40498-PF position 1: T:0.19030 C:0.20149 A:0.29851 G:0.30970 position 2: T:0.28731 C:0.19030 A:0.27985 G:0.24254 position 3: T:0.36940 C:0.16791 A:0.30970 G:0.15299 Average T:0.28234 C:0.18657 A:0.29602 G:0.23507 #4: D_sechellia_CG40498-PF position 1: T:0.19030 C:0.20149 A:0.30224 G:0.30597 position 2: T:0.28358 C:0.19403 A:0.27985 G:0.24254 position 3: T:0.36940 C:0.16791 A:0.30970 G:0.15299 Average T:0.28109 C:0.18781 A:0.29726 G:0.23383 #5: D_simulans_CG40498-PF position 1: T:0.19030 C:0.20149 A:0.29104 G:0.31716 position 2: T:0.27985 C:0.19403 A:0.28358 G:0.24254 position 3: T:0.36567 C:0.16791 A:0.30970 G:0.15672 Average T:0.27861 C:0.18781 A:0.29478 G:0.23881 #6: D_yakuba_CG40498-PF position 1: T:0.17537 C:0.20522 A:0.31716 G:0.30224 position 2: T:0.27612 C:0.20149 A:0.29104 G:0.23134 position 3: T:0.38060 C:0.15299 A:0.32463 G:0.14179 Average T:0.27736 C:0.18657 A:0.31095 G:0.22512 #7: D_erecta_CG40498-PF position 1: T:0.18284 C:0.19776 A:0.30597 G:0.31343 position 2: T:0.27985 C:0.19776 A:0.28358 G:0.23881 position 3: T:0.37687 C:0.16418 A:0.31343 G:0.14552 Average T:0.27985 C:0.18657 A:0.30100 G:0.23259 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 43 | Ser S TCT 76 | Tyr Y TAT 27 | Cys C TGT 8 TTC 8 | TCC 26 | TAC 1 | TGC 26 Leu L TTA 62 | TCA 31 | *** * TAA 0 | *** * TGA 0 TTG 19 | TCG 1 | TAG 0 | Trp W TGG 21 ------------------------------------------------------------------------------ Leu L CTT 48 | Pro P CCT 14 | His H CAT 54 | Arg R CGT 42 CTC 6 | CCC 3 | CAC 15 | CGC 23 CTA 18 | CCA 16 | Gln Q CAA 42 | CGA 44 CTG 13 | CCG 16 | CAG 12 | CGG 9 ------------------------------------------------------------------------------ Ile I ATT 67 | Thr T ACT 42 | Asn N AAT 57 | Ser S AGT 42 ATC 20 | ACC 2 | AAC 32 | AGC 47 ATA 36 | ACA 40 | Lys K AAA 53 | Arg R AGA 31 Met M ATG 42 | ACG 20 | AAG 21 | AGG 19 ------------------------------------------------------------------------------ Val V GTT 71 | Ala A GCT 28 | Asp D GAT 55 | Gly G GGT 24 GTC 16 | GCC 11 | GAC 35 | GGC 42 GTA 29 | GCA 27 | Glu E GAA 86 | GGA 69 GTG 30 | GCG 13 | GAG 41 | GGG 4 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.18603 C:0.19989 A:0.30437 G:0.30970 position 2: T:0.28145 C:0.19510 A:0.28305 G:0.24041 position 3: T:0.37207 C:0.16684 A:0.31130 G:0.14979 Average T:0.27985 C:0.18728 A:0.29957 G:0.23330 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_CG40498-PF D_sechellia_CG40498-PF 0.2064 (0.0182 0.0882) D_sechellia_CG40498-PF 0.2248 (0.0199 0.0884)-1.0000 (0.0016 0.0000) D_sechellia_CG40498-PF 0.2248 (0.0199 0.0884)-1.0000 (0.0016 0.0000)-1.0000 (0.0033 0.0000) D_simulans_CG40498-PF 0.2413 (0.0199 0.0824) 0.9422 (0.0049 0.0052) 1.2547 (0.0066 0.0052) 1.2547 (0.0066 0.0052) D_yakuba_CG40498-PF 0.1507 (0.0354 0.2352) 0.1552 (0.0354 0.2282) 0.1623 (0.0371 0.2287) 0.1623 (0.0371 0.2287) 0.1679 (0.0371 0.2212) D_erecta_CG40498-PF 0.0896 (0.0199 0.2219) 0.1089 (0.0249 0.2290) 0.1160 (0.0266 0.2295) 0.1160 (0.0266 0.2295) 0.1200 (0.0266 0.2220) 0.1377 (0.0249 0.1811) Model 0: one-ratio TREE # 1: (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 lnL(ntime: 10 np: 12): -1619.591069 +0.000000 8..1 8..9 9..6 9..7 8..10 10..11 11..2 11..3 11..4 10..5 0.047403 0.090038 0.121792 0.069511 0.053571 0.007748 0.000004 0.003866 0.003869 0.007780 1.510113 0.135607 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.40558 (1: 0.047403, (6: 0.121792, 7: 0.069511): 0.090038, ((2: 0.000004, 3: 0.003866, 4: 0.003869): 0.007748, 5: 0.007780): 0.053571); (D_melanogaster_CG40498-PF: 0.047403, (D_yakuba_CG40498-PF: 0.121792, D_erecta_CG40498-PF: 0.069511): 0.090038, ((D_sechellia_CG40498-PF: 0.000004, D_sechellia_CG40498-PF: 0.003866, D_sechellia_CG40498-PF: 0.003869): 0.007748, D_simulans_CG40498-PF: 0.007780): 0.053571); Detailed output identifying parameters kappa (ts/tv) = 1.51011 omega (dN/dS) = 0.13561 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.047 623.8 180.2 0.1356 0.0065 0.0480 4.1 8.6 8..9 0.090 623.8 180.2 0.1356 0.0124 0.0911 7.7 16.4 9..6 0.122 623.8 180.2 0.1356 0.0167 0.1233 10.4 22.2 9..7 0.070 623.8 180.2 0.1356 0.0095 0.0703 6.0 12.7 8..10 0.054 623.8 180.2 0.1356 0.0074 0.0542 4.6 9.8 10..11 0.008 623.8 180.2 0.1356 0.0011 0.0078 0.7 1.4 11..2 0.000 623.8 180.2 0.1356 0.0000 0.0000 0.0 0.0 11..3 0.004 623.8 180.2 0.1356 0.0005 0.0039 0.3 0.7 11..4 0.004 623.8 180.2 0.1356 0.0005 0.0039 0.3 0.7 10..5 0.008 623.8 180.2 0.1356 0.0011 0.0079 0.7 1.4 tree length for dN: 0.0557 tree length for dS: 0.4105 Time used: 0:03 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 lnL(ntime: 10 np: 13): -1612.343190 +0.000000 8..1 8..9 9..6 9..7 8..10 10..11 11..2 11..3 11..4 10..5 0.049127 0.093976 0.126350 0.072029 0.055134 0.008001 0.000004 0.003965 0.003968 0.007940 1.494368 0.920016 0.062293 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.42049 (1: 0.049127, (6: 0.126350, 7: 0.072029): 0.093976, ((2: 0.000004, 3: 0.003965, 4: 0.003968): 0.008001, 5: 0.007940): 0.055134); (D_melanogaster_CG40498-PF: 0.049127, (D_yakuba_CG40498-PF: 0.126350, D_erecta_CG40498-PF: 0.072029): 0.093976, ((D_sechellia_CG40498-PF: 0.000004, D_sechellia_CG40498-PF: 0.003965, D_sechellia_CG40498-PF: 0.003968): 0.008001, D_simulans_CG40498-PF: 0.007940): 0.055134); Detailed output identifying parameters kappa (ts/tv) = 1.49437 dN/dS (w) for site classes (K=2) p: 0.92002 0.07998 w: 0.06229 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.049 624.0 180.0 0.1373 0.0068 0.0496 4.2 8.9 8..9 0.094 624.0 180.0 0.1373 0.0130 0.0948 8.1 17.1 9..6 0.126 624.0 180.0 0.1373 0.0175 0.1275 10.9 22.9 9..7 0.072 624.0 180.0 0.1373 0.0100 0.0727 6.2 13.1 8..10 0.055 624.0 180.0 0.1373 0.0076 0.0556 4.8 10.0 10..11 0.008 624.0 180.0 0.1373 0.0011 0.0081 0.7 1.5 11..2 0.000 624.0 180.0 0.1373 0.0000 0.0000 0.0 0.0 11..3 0.004 624.0 180.0 0.1373 0.0005 0.0040 0.3 0.7 11..4 0.004 624.0 180.0 0.1373 0.0005 0.0040 0.3 0.7 10..5 0.008 624.0 180.0 0.1373 0.0011 0.0080 0.7 1.4 Time used: 0:08 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 check convergence.. lnL(ntime: 10 np: 15): -1609.229767 +0.000000 8..1 8..9 9..6 9..7 8..10 10..11 11..2 11..3 11..4 10..5 0.053422 0.101742 0.133629 0.077686 0.057705 0.008392 0.000004 0.004177 0.004179 0.008418 1.541542 0.982328 0.000000 0.096823 5.254437 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.44935 (1: 0.053422, (6: 0.133629, 7: 0.077686): 0.101742, ((2: 0.000004, 3: 0.004177, 4: 0.004179): 0.008392, 5: 0.008418): 0.057705); (D_melanogaster_CG40498-PF: 0.053422, (D_yakuba_CG40498-PF: 0.133629, D_erecta_CG40498-PF: 0.077686): 0.101742, ((D_sechellia_CG40498-PF: 0.000004, D_sechellia_CG40498-PF: 0.004177, D_sechellia_CG40498-PF: 0.004179): 0.008392, D_simulans_CG40498-PF: 0.008418): 0.057705); Detailed output identifying parameters kappa (ts/tv) = 1.54154 dN/dS (w) for site classes (K=3) p: 0.98233 0.00000 0.01767 w: 0.09682 1.00000 5.25444 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.053 623.4 180.6 0.1880 0.0090 0.0481 5.6 8.7 8..9 0.102 623.4 180.6 0.1880 0.0172 0.0916 10.7 16.5 9..6 0.134 623.4 180.6 0.1880 0.0226 0.1203 14.1 21.7 9..7 0.078 623.4 180.6 0.1880 0.0131 0.0699 8.2 12.6 8..10 0.058 623.4 180.6 0.1880 0.0098 0.0519 6.1 9.4 10..11 0.008 623.4 180.6 0.1880 0.0014 0.0076 0.9 1.4 11..2 0.000 623.4 180.6 0.1880 0.0000 0.0000 0.0 0.0 11..3 0.004 623.4 180.6 0.1880 0.0007 0.0038 0.4 0.7 11..4 0.004 623.4 180.6 0.1880 0.0007 0.0038 0.4 0.7 10..5 0.008 623.4 180.6 0.1880 0.0014 0.0076 0.9 1.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.879 4.631 212 S 1.000** 5.254 252 L 0.889 4.681 259 L 0.878 4.624 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.759 3.433 +- 2.310 212 S 0.947 4.067 +- 2.183 252 L 0.770 3.496 +- 2.328 259 L 0.742 3.318 +- 2.253 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.967 0.033 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.138 0.218 0.206 0.153 0.104 0.069 0.045 0.031 0.021 0.015 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.064 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.049 0.885 sum of density on p0-p1 = 1.000000 Time used: 0:27 Model 3: discrete (3 categories) TREE # 1: (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 lnL(ntime: 10 np: 16): -1609.229767 +0.000000 8..1 8..9 9..6 9..7 8..10 10..11 11..2 11..3 11..4 10..5 0.053422 0.101741 0.133629 0.077685 0.057705 0.008392 0.000004 0.004177 0.004179 0.008418 1.541544 0.644956 0.337372 0.096822 0.096825 5.254413 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.44935 (1: 0.053422, (6: 0.133629, 7: 0.077685): 0.101741, ((2: 0.000004, 3: 0.004177, 4: 0.004179): 0.008392, 5: 0.008418): 0.057705); (D_melanogaster_CG40498-PF: 0.053422, (D_yakuba_CG40498-PF: 0.133629, D_erecta_CG40498-PF: 0.077685): 0.101741, ((D_sechellia_CG40498-PF: 0.000004, D_sechellia_CG40498-PF: 0.004177, D_sechellia_CG40498-PF: 0.004179): 0.008392, D_simulans_CG40498-PF: 0.008418): 0.057705); Detailed output identifying parameters kappa (ts/tv) = 1.54154 dN/dS (w) for site classes (K=3) p: 0.64496 0.33737 0.01767 w: 0.09682 0.09682 5.25441 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.053 623.4 180.6 0.1880 0.0090 0.0481 5.6 8.7 8..9 0.102 623.4 180.6 0.1880 0.0172 0.0916 10.7 16.5 9..6 0.134 623.4 180.6 0.1880 0.0226 0.1203 14.1 21.7 9..7 0.078 623.4 180.6 0.1880 0.0131 0.0699 8.2 12.6 8..10 0.058 623.4 180.6 0.1880 0.0098 0.0519 6.1 9.4 10..11 0.008 623.4 180.6 0.1880 0.0014 0.0076 0.9 1.4 11..2 0.000 623.4 180.6 0.1880 0.0000 0.0000 0.0 0.0 11..3 0.004 623.4 180.6 0.1880 0.0007 0.0038 0.4 0.7 11..4 0.004 623.4 180.6 0.1880 0.0007 0.0038 0.4 0.7 10..5 0.008 623.4 180.6 0.1880 0.0014 0.0076 0.9 1.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.879 4.631 212 S 1.000** 5.254 252 L 0.889 4.681 259 L 0.878 4.624 Time used: 0:45 Model 7: beta (10 categories) TREE # 1: (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 lnL(ntime: 10 np: 13): -1613.242351 +0.000000 8..1 8..9 9..6 9..7 8..10 10..11 11..2 11..3 11..4 10..5 0.049000 0.093774 0.126106 0.071923 0.055038 0.008026 0.000004 0.003957 0.003959 0.007886 1.511833 0.094602 0.538856 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.41967 (1: 0.049000, (6: 0.126106, 7: 0.071923): 0.093774, ((2: 0.000004, 3: 0.003957, 4: 0.003959): 0.008026, 5: 0.007886): 0.055038); (D_melanogaster_CG40498-PF: 0.049000, (D_yakuba_CG40498-PF: 0.126106, D_erecta_CG40498-PF: 0.071923): 0.093774, ((D_sechellia_CG40498-PF: 0.000004, D_sechellia_CG40498-PF: 0.003957, D_sechellia_CG40498-PF: 0.003959): 0.008026, D_simulans_CG40498-PF: 0.007886): 0.055038); Detailed output identifying parameters kappa (ts/tv) = 1.51183 Parameters in M7 (beta): p = 0.09460 q = 0.53886 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00005 0.00064 0.00536 0.03100 0.13434 0.43018 0.88995 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.049 623.8 180.2 0.1492 0.0072 0.0481 4.5 8.7 8..9 0.094 623.8 180.2 0.1492 0.0137 0.0920 8.6 16.6 9..6 0.126 623.8 180.2 0.1492 0.0184 0.1237 11.5 22.3 9..7 0.072 623.8 180.2 0.1492 0.0105 0.0705 6.6 12.7 8..10 0.055 623.8 180.2 0.1492 0.0081 0.0540 5.0 9.7 10..11 0.008 623.8 180.2 0.1492 0.0012 0.0079 0.7 1.4 11..2 0.000 623.8 180.2 0.1492 0.0000 0.0000 0.0 0.0 11..3 0.004 623.8 180.2 0.1492 0.0006 0.0039 0.4 0.7 11..4 0.004 623.8 180.2 0.1492 0.0006 0.0039 0.4 0.7 10..5 0.008 623.8 180.2 0.1492 0.0012 0.0077 0.7 1.4 Time used: 1:13 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (6, 7), ((2, 3, 4), 5)); MP score: 91 lnL(ntime: 10 np: 15): -1609.254657 +0.000000 8..1 8..9 9..6 9..7 8..10 10..11 11..2 11..3 11..4 10..5 0.053411 0.101717 0.133594 0.077662 0.057683 0.008391 0.000004 0.004176 0.004178 0.008415 1.541481 0.982508 10.724004 99.000000 5.278335 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.44923 (1: 0.053411, (6: 0.133594, 7: 0.077662): 0.101717, ((2: 0.000004, 3: 0.004176, 4: 0.004178): 0.008391, 5: 0.008415): 0.057683); (D_melanogaster_CG40498-PF: 0.053411, (D_yakuba_CG40498-PF: 0.133594, D_erecta_CG40498-PF: 0.077662): 0.101717, ((D_sechellia_CG40498-PF: 0.000004, D_sechellia_CG40498-PF: 0.004176, D_sechellia_CG40498-PF: 0.004178): 0.008391, D_simulans_CG40498-PF: 0.008415): 0.057683); Detailed output identifying parameters kappa (ts/tv) = 1.54148 Parameters in M8 (beta&w>1): p0 = 0.98251 p = 10.72400 q = 99.00000 (p1 = 0.01749) w = 5.27834 dN/dS (w) for site classes (K=11) p: 0.09825 0.09825 0.09825 0.09825 0.09825 0.09825 0.09825 0.09825 0.09825 0.09825 0.01749 w: 0.05583 0.06888 0.07751 0.08486 0.09181 0.09886 0.10646 0.11532 0.12699 0.14799 5.27834 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.053 623.4 180.6 0.1881 0.0090 0.0481 5.6 8.7 8..9 0.102 623.4 180.6 0.1881 0.0172 0.0915 10.7 16.5 9..6 0.134 623.4 180.6 0.1881 0.0226 0.1202 14.1 21.7 9..7 0.078 623.4 180.6 0.1881 0.0131 0.0699 8.2 12.6 8..10 0.058 623.4 180.6 0.1881 0.0098 0.0519 6.1 9.4 10..11 0.008 623.4 180.6 0.1881 0.0014 0.0075 0.9 1.4 11..2 0.000 623.4 180.6 0.1881 0.0000 0.0000 0.0 0.0 11..3 0.004 623.4 180.6 0.1881 0.0007 0.0038 0.4 0.7 11..4 0.004 623.4 180.6 0.1881 0.0007 0.0038 0.4 0.7 10..5 0.008 623.4 180.6 0.1881 0.0014 0.0076 0.9 1.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.870 4.605 212 S 1.000** 5.278 252 L 0.880 4.658 259 L 0.867 4.593 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.831 2.904 +- 1.917 212 S 0.980* 3.277 +- 1.766 252 L 0.835 2.926 +- 1.925 259 L 0.835 2.887 +- 1.882 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 0.982 0.018 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.001 0.013 0.050 0.103 0.155 0.197 0.228 0.252 ws: 0.234 0.303 0.203 0.115 0.064 0.036 0.021 0.012 0.008 0.005 Time used: 2:23
Model 1: NearlyNeutral -1612.34319 Model 2: PositiveSelection -1609.229767 Model 0: one-ratio -1619.591069 Model 3: discrete -1609.229767 Model 7: beta -1613.242351 Model 8: beta&w>1 -1609.254657 Model 0 vs 1 14.495758000000023 Model 2 vs 1 6.226846000000023 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.879 4.631 212 S 1.000** 5.254 252 L 0.889 4.681 259 L 0.878 4.624 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.759 3.433 +- 2.310 212 S 0.947 4.067 +- 2.183 252 L 0.770 3.496 +- 2.328 259 L 0.742 3.318 +- 2.253 Model 8 vs 7 7.975388000000294 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.870 4.605 212 S 1.000** 5.278 252 L 0.880 4.658 259 L 0.867 4.593 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG40498-PF) Pr(w>1) post mean +- SE for w 63 T 0.831 2.904 +- 1.917 212 S 0.980* 3.277 +- 1.766 252 L 0.835 2.926 +- 1.925 259 L 0.835 2.887 +- 1.882